BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018E07

Length=583
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    377   1e-124   Solanum tuberosum [potatoes]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        381   2e-122   Cucumis melo [Oriental melon]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    380   3e-122   
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    378   3e-122   Cucurbita maxima [Boston marrow]
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   375   4e-122   Citrus sinensis [apfelsine]
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    380   4e-122   Solanum tuberosum [potatoes]
gb|AAO62410.1|  aconitase                                               378   5e-122   Solanum pennellii
gb|ADZ57218.1|  aconitase protein                                       377   6e-122   Litchi chinensis [litchi]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             377   6e-122   
gb|KCW88792.1|  hypothetical protein EUGRSUZ_A01129                     372   7e-122   Eucalyptus grandis [rose gum]
ref|XP_002524184.1|  aconitase, putative                                379   1e-121   Ricinus communis
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    379   1e-121   Cucumis sativus [cucumbers]
emb|CBE71058.1|  aconitate hydratase 2                                  377   2e-121   Citrus clementina [clementine]
gb|AAP30039.1|  aconitase                                               376   2e-121   Solanum pennellii
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   376   2e-121   Citrus sinensis [apfelsine]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   376   2e-121   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   376   3e-121   Citrus sinensis [apfelsine]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        378   3e-121   Solanum lycopersicum
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     373   4e-121   Eucalyptus grandis [rose gum]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             377   6e-121   Citrus clementina [clementine]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        377   6e-121   Nicotiana tomentosiformis
dbj|BAG16527.1|  putative aconitase                                     377   8e-121   Capsicum chinense [bonnet pepper]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        377   9e-121   Nicotiana sylvestris
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   376   1e-120   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   376   2e-120   Citrus sinensis [apfelsine]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    376   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         375   3e-120   Jatropha curcas
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    374   6e-120   Nicotiana tomentosiformis
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    374   2e-119   Sesamum indicum [beniseed]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    372   4e-119   Cicer arietinum [garbanzo]
ref|NP_001136484.1|  uncharacterized protein LOC100216599               361   4e-119   
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        372   4e-119   Eucalyptus grandis [rose gum]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    372   5e-119   Nelumbo nucifera [Indian lotus]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           370   5e-119   Nicotiana tabacum [American tobacco]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        372   6e-119   Vitis vinifera
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    372   8e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        371   1e-118   Vitis vinifera
gb|KJB60836.1|  hypothetical protein B456_009G327800                    368   1e-118   Gossypium raimondii
gb|KJB60837.1|  hypothetical protein B456_009G327800                    368   2e-118   Gossypium raimondii
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    361   2e-118   
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    370   2e-118   Solanum tuberosum [potatoes]
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    370   2e-118   Nicotiana sylvestris
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    370   2e-118   Populus euphratica
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   365   3e-118   Citrus sinensis [apfelsine]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    361   4e-118   
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        370   5e-118   Nelumbo nucifera [Indian lotus]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    367   6e-118   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        367   1e-117   Glycine soja [wild soybean]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   366   1e-117   Citrus sinensis [apfelsine]
gb|EEE68177.1|  hypothetical protein OsJ_26310                          367   2e-117   Oryza sativa Japonica Group [Japonica rice]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    368   2e-117   Gossypium raimondii
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...    365   3e-117   
ref|XP_003605929.1|  Aconitate hydratase                                367   4e-117   Medicago truncatula
gb|ADD62592.1|  cytosolic aconitase                                     352   4e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    365   4e-117   
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    367   4e-117   Glycine max [soybeans]
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    362   4e-117   
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             367   4e-117   Populus trichocarpa [western balsam poplar]
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            363   5e-117   Phaseolus vulgaris [French bean]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    367   5e-117   Gossypium raimondii
emb|CDP10817.1|  unnamed protein product                                367   5e-117   Coffea canephora [robusta coffee]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        367   5e-117   Solanum lycopersicum
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    367   5e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB30565.1|  hypothetical protein B456_005G149700                    365   6e-117   Gossypium raimondii
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          363   6e-117   
ref|XP_007045642.1|  Aconitase 3                                        366   9e-117   
ref|XP_006376779.1|  aconitate hydratase family protein                 366   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    363   1e-116   Glycine max [soybeans]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             366   1e-116   Prunus persica
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        364   2e-116   Glycine soja [wild soybean]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      363   2e-116   Citrus limon [lemon]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    365   2e-116   Gossypium raimondii
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             365   2e-116   Citrus clementina [clementine]
emb|CBE71057.1|  aconitate hydratase 3                                  363   2e-116   Citrus clementina [clementine]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    362   2e-116   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    365   2e-116   Gossypium raimondii
gb|EEC83021.1|  hypothetical protein OsI_28098                          355   3e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    365   3e-116   Phoenix dactylifera
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    364   5e-116   Glycine max [soybeans]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                365   5e-116   Erythranthe guttata [common monkey flower]
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    364   6e-116   Elaeis guineensis
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        364   7e-116   Populus euphratica
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          363   9e-116   Sorghum bicolor [broomcorn]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         363   1e-115   Jatropha curcas
dbj|BAJ85661.1|  predicted protein                                      363   1e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003596988.1|  Aconitate hydratase                                363   1e-115   Medicago truncatula
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    363   2e-115   Brachypodium distachyon [annual false brome]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    363   2e-115   
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          362   2e-115   Amborella trichopoda
gb|KHG02134.1|  hypothetical protein F383_25649                         362   3e-115   Gossypium arboreum [tree cotton]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    362   3e-115   Gossypium raimondii
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    361   8e-115   
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    361   8e-115   Tarenaya hassleriana [spider flower]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    360   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002532564.1|  aconitase, putative                                359   3e-114   
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    358   1e-113   Cicer arietinum [garbanzo]
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        356   1e-113   Gossypium arboreum [tree cotton]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        358   1e-113   Fragaria vesca subsp. vesca
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        358   2e-113   
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    357   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             356   5e-113   Eutrema salsugineum [saltwater cress]
emb|CDP05740.1|  unnamed protein product                                357   6e-113   Coffea canephora [robusta coffee]
ref|XP_002870438.1|  predicted protein                                  355   8e-113   Arabidopsis lyrata subsp. lyrata
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    355   1e-112   Arabis alpina [alpine rockcress]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    355   1e-112   
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         353   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|ADM34980.1|  cytosolic aconitase                                     353   2e-112   Pyrus pyrifolia [sha li]
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    351   2e-112   Nicotiana sylvestris
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    355   2e-112   Camelina sativa [gold-of-pleasure]
gb|KHG08189.1|  hypothetical protein F383_11434                         352   2e-112   Gossypium arboreum [tree cotton]
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    354   4e-112   Elaeis guineensis
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               353   4e-112   
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        353   6e-112   Pyrus x bretschneideri [bai li]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             353   7e-112   Phaseolus vulgaris [French bean]
gb|EPS60517.1|  hypothetical protein M569_14286                         350   8e-112   Genlisea aurea
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    353   8e-112   Gossypium arboreum [tree cotton]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    353   9e-112   Glycine max [soybeans]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        353   9e-112   Glycine soja [wild soybean]
ref|NP_178634.2|  aconitate hydratase 3                                 353   1e-111   Arabidopsis thaliana [mouse-ear cress]
gb|ACK56135.1|  putative aconitase                                      333   2e-111   Dimocarpus longan [longan]
ref|XP_002530635.1|  aconitase, putative                                350   2e-111   Ricinus communis
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    352   2e-111   Solanum tuberosum [potatoes]
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     348   2e-111   Eucalyptus grandis [rose gum]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    352   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    352   2e-111   Glycine max [soybeans]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    349   3e-111   Nicotiana tomentosiformis
ref|XP_007046597.1|  Aconitase 1                                        350   3e-111   
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     350   3e-111   Cucumis melo [Oriental melon]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             352   3e-111   
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              349   4e-111   Cucumis sativus [cucumbers]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    349   4e-111   Gossypium raimondii
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             351   4e-111   Capsella rubella
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    350   1e-110   Elaeis guineensis
dbj|BAE98476.1|  aconitase like protein                                 330   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25210.1|  unknown                                                 338   2e-110   Picea sitchensis
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    350   3e-110   Nicotiana sylvestris
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    345   3e-110   
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     347   3e-110   Eucalyptus grandis [rose gum]
emb|CDX97969.1|  BnaA06g07200D                                          349   3e-110   
emb|CDX93088.1|  BnaA03g38100D                                          349   3e-110   
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    349   3e-110   Brassica rapa
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   338   4e-110   Citrus sinensis [apfelsine]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   347   4e-110   Eucalyptus grandis [rose gum]
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   347   4e-110   Vitis vinifera
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    348   4e-110   Phoenix dactylifera
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    348   5e-110   Brassica rapa
emb|CBI24446.3|  unnamed protein product                                347   7e-110   Vitis vinifera
emb|CDY18054.1|  BnaC07g04160D                                          348   7e-110   Brassica napus [oilseed rape]
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    348   9e-110   Phoenix dactylifera
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              343   9e-110   
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             345   1e-109   Prunus persica
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   345   1e-109   Prunus mume [ume]
emb|CDY50945.1|  BnaC03g74450D                                          347   1e-109   Brassica napus [oilseed rape]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    348   1e-109   Nicotiana tomentosiformis
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             345   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   345   2e-109   Populus euphratica
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         344   3e-109   Jatropha curcas
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   339   4e-109   Citrus sinensis [apfelsine]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    345   9e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   343   1e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   342   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              342   3e-108   Pyrus x bretschneideri [bai li]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   341   4e-108   Fragaria vesca subsp. vesca
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   341   4e-108   Pyrus x bretschneideri [bai li]
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   339   5e-108   Citrus sinensis [apfelsine]
gb|KGN48958.1|  Aconitase                                               340   6e-108   Cucumis sativus [cucumbers]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              341   7e-108   Pyrus x bretschneideri [bai li]
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                   338   8e-108   Citrus sinensis [apfelsine]
ref|XP_010113288.1|  Aconitate hydratase 1                              342   1e-107   
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        340   2e-107   Gossypium arboreum [tree cotton]
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    337   2e-107   Medicago truncatula
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    340   2e-107   Glycine max [soybeans]
gb|KHN41868.1|  Aconitate hydratase 1                                   339   2e-107   Glycine soja [wild soybean]
emb|CAN83844.1|  hypothetical protein VITISV_003004                     339   3e-107   Vitis vinifera
gb|EEE58288.1|  hypothetical protein OsJ_09326                          339   3e-107   Oryza sativa Japonica Group [Japonica rice]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   338   4e-107   Citrus sinensis [apfelsine]
ref|XP_006383042.1|  aconitate hydratase family protein                 339   4e-107   Populus trichocarpa [western balsam poplar]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   339   4e-107   Citrus sinensis [apfelsine]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             339   4e-107   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   338   5e-107   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                  338   5e-107   Citrus clementina [clementine]
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    340   5e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg             335   6e-107   
ref|NP_001048898.1|  Os03g0136900                                       340   7e-107   
gb|EEC74472.1|  hypothetical protein OsI_09921                          340   8e-107   Oryza sativa Indica Group [Indian rice]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                340   1e-106   Erythranthe guttata [common monkey flower]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             337   1e-106   Phaseolus vulgaris [French bean]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   337   1e-106   
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              337   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_003612247.1|  Aconitate hydratase                                337   2e-106   Medicago truncatula
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    337   3e-106   Arabis alpina [alpine rockcress]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        338   3e-106   Sesamum indicum [beniseed]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    338   3e-106   Setaria italica
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        337   4e-106   Glycine soja [wild soybean]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   336   4e-106   Glycine max [soybeans]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             335   8e-106   Eutrema salsugineum [saltwater cress]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              335   9e-106   Cicer arietinum [garbanzo]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    335   1e-105   
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   335   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             335   2e-105   Capsella rubella
emb|CDY41626.1|  BnaC03g62580D                                          335   2e-105   Brassica napus [oilseed rape]
emb|CDY24823.1|  BnaA08g14870D                                          335   2e-105   Brassica napus [oilseed rape]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              334   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             335   6e-105   
ref|NP_001119125.1|  aconitate hydratase 1                              330   9e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75532.1|  BnaA01g01700D                                          332   2e-104   
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   332   2e-104   Brassica rapa
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              331   3e-104   Brassica rapa
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              325   3e-104   
emb|CDX69174.1|  BnaC01g02790D                                          331   5e-104   
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    332   5e-104   Brachypodium distachyon [annual false brome]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   330   6e-104   Citrus sinensis [apfelsine]
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              325   7e-104   
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    327   7e-104   Cucumis melo var. conomon [snake cucumber]
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    328   8e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          332   8e-104   Sorghum bicolor [broomcorn]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    332   9e-104   Zea mays [maize]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    332   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    332   1e-103   Camelina sativa [gold-of-pleasure]
ref|NP_195308.1|  aconitate hydratase 1                                 330   1e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CAA58046.1|  aconitase                                              330   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    319   2e-103   
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   329   2e-103   Citrus sinensis [apfelsine]
emb|CDY66424.1|  BnaAnng22230D                                          330   3e-103   Brassica napus [oilseed rape]
ref|NP_567763.2|  aconitase 2                                           330   3e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    330   3e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14291.1|  BnaA08g14220D                                          330   4e-103   Brassica napus [oilseed rape]
dbj|BAJ92965.1|  predicted protein                                      330   6e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACR36825.1|  unknown                                                 318   1e-102   Zea mays [maize]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    328   2e-102   Brassica rapa
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             326   4e-102   
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    327   4e-102   Arabis alpina [alpine rockcress]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    327   7e-102   Zea mays [maize]
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        326   1e-101   Prunus mume [ume]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             326   1e-101   Capsella rubella
ref|NP_001159229.1|  uncharacterized protein LOC100304315               319   1e-101   
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             324   2e-101   
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              324   2e-101   Tarenaya hassleriana [spider flower]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               332   2e-101   
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          325   2e-101   Sorghum bicolor [broomcorn]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             325   4e-101   Eutrema salsugineum [saltwater cress]
gb|AAL13084.1|  putative aconitase                                      322   8e-101   Prunus avium [gean]
gb|KEH38306.1|  cytoplasmic-like aconitate hydratase                    320   3e-100   Medicago truncatula
ref|XP_001779205.1|  predicted protein                                  319   2e-99    
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    319   2e-99    Zea mays [maize]
gb|AFA36529.1|  aconitate hydratase 2                                   301   4e-99    Lolium perenne [perennial ryegrass]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    319   4e-99    
ref|NP_001147431.1|  aconitase2                                         318   5e-99    Zea mays [maize]
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   318   9e-99    
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    318   9e-99    Zea mays [maize]
gb|KJB17578.1|  hypothetical protein B456_003G006000                    316   1e-98    Gossypium raimondii
ref|XP_007020807.1|  Aconitase 3                                        315   2e-98    
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   313   2e-98    
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              315   3e-98    Eucalyptus grandis [rose gum]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             316   4e-98    
gb|EEE65577.1|  hypothetical protein OsJ_21080                          310   6e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     315   8e-98    Eucalyptus grandis [rose gum]
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             315   1e-97    
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             315   2e-97    
dbj|BAD62409.1|  putative aconitate hydratase                           310   3e-97    Oryza sativa Japonica Group [Japonica rice]
emb|CAB36543.1|  putative aconitase                                     313   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001780674.1|  predicted protein                                  310   1e-96    
gb|KJB62827.1|  hypothetical protein B456_009G438900                    301   2e-96    Gossypium raimondii
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     308   4e-96    Gossypium arboreum [tree cotton]
ref|XP_010100637.1|  Aconitate hydratase                                309   1e-95    
gb|KCW81855.1|  hypothetical protein EUGRSUZ_C03206                     293   2e-94    Eucalyptus grandis [rose gum]
emb|CDY56501.1|  BnaAnng14360D                                          306   3e-94    Brassica napus [oilseed rape]
ref|XP_008666591.1|  PREDICTED: putative aconitate hydratase, cyt...    285   2e-93    
gb|AFW61052.1|  hypothetical protein ZEAMMB73_482448                    289   3e-93    
gb|ACP19662.1|  aconitase                                               281   5e-93    Glycine max [soybeans]
ref|NP_001057461.2|  Os06g0303400                                       298   7e-93    
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    299   3e-92    Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                300   3e-92    
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               295   4e-90    
ref|XP_010046442.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    272   6e-90    
tpg|DAA49009.1|  TPA: hypothetical protein ZEAMMB73_412021              286   8e-90    
ref|XP_001770969.1|  predicted protein                                  293   1e-89    
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               291   2e-88    Triticum urartu
gb|ACN31879.1|  unknown                                                 268   2e-87    Zea mays [maize]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     260   2e-80    
ref|XP_001462506.1|  hypothetical protein                               259   2e-79    
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   262   1e-78    
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    256   9e-77    
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    256   2e-76    
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    257   3e-76    
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    256   6e-76    
ref|XP_007020811.1|  Aconitase 3                                        256   8e-76    
ref|XP_006810593.1|  PREDICTED: cytoplasmic aconitate hydratase-like    244   2e-75    
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    251   2e-74    
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    251   2e-74    
ref|XP_001637006.1|  predicted protein                                  250   4e-74    
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    251   5e-74    
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  246   5e-73    
ref|XP_008317436.1|  PREDICTED: cytoplasmic aconitate hydratase         245   3e-72    
ref|XP_010787893.1|  PREDICTED: cytoplasmic aconitate hydratase         241   3e-72    
gb|AFI44047.1|  iron regulatory protein                                 245   3e-72    
gb|AGC69746.1|  putative iron regulatory protein                        244   5e-72    
ref|XP_006823332.1|  PREDICTED: cytoplasmic aconitate hydratase         242   6e-72    
ref|XP_007543966.1|  PREDICTED: cytoplasmic aconitate hydratase i...    244   7e-72    
ref|XP_004575994.1|  PREDICTED: cytoplasmic aconitate hydratase-like    244   8e-72    
ref|XP_005754206.1|  PREDICTED: cytoplasmic aconitate hydratase-like    244   8e-72    
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase         244   9e-72    
ref|XP_008433053.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-71    
ref|XP_009306687.1|  putative aconitase                                 243   2e-71    
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         239   3e-71    
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         237   4e-71    
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   4e-71    
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         237   4e-71    
ref|XP_009495769.1|  cytoplasmic aconitate hydratase                    241   9e-71    
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         238   9e-71    
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         238   1e-70    
emb|CDW88502.1|  aconitate hydratase 1 family protein                   241   1e-70    
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      238   1e-70    
ref|XP_002111662.1|  hypothetical protein TRIADDRAFT_63287              240   2e-70    
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         239   4e-70    
ref|XP_001451848.1|  hypothetical protein                               239   4e-70    
ref|XP_003727326.1|  PREDICTED: cytoplasmic aconitate hydratase i...    239   4e-70    
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         238   5e-70    
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         238   6e-70    
gb|EJY70620.1|  Aconitate hydratase 1 family protein                    239   6e-70    
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         239   6e-70    
ref|XP_005433002.1|  PREDICTED: cytoplasmic aconitate hydratase         239   7e-70    
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         236   7e-70    
ref|XP_005234855.1|  PREDICTED: cytoplasmic aconitate hydratase         239   8e-70    
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    238   8e-70    
ref|XP_791082.2|  PREDICTED: cytoplasmic aconitate hydratase isof...    239   1e-69    
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         238   1e-69    
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         238   2e-69    
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         237   2e-69    
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         237   2e-69    
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         234   2e-69    
emb|CEF64620.1|  Cytoplasmic aconitate hydratase                        237   2e-69    
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         234   3e-69    
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         234   3e-69    
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         237   3e-69    
ref|NP_001030155.1|  cytoplasmic aconitate hydratase                    237   3e-69    
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    233   3e-69    
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...    237   3e-69    
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         237   3e-69    
ref|XP_010288384.1|  PREDICTED: cytoplasmic aconitate hydratase         234   3e-69    
ref|XP_011312352.1|  PREDICTED: cytoplasmic aconitate hydratase-like    237   3e-69    
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         235   3e-69    
ref|XP_009044065.1|  hypothetical protein LOTGIDRAFT_181349             237   4e-69    
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         235   4e-69    
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         236   4e-69    
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         236   5e-69    
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase         236   5e-69    
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         236   5e-69    
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         236   5e-69    
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         236   5e-69    
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               236   5e-69    
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         236   6e-69    
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         236   7e-69    
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         236   7e-69    
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         236   7e-69    
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         236   7e-69    
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         236   8e-69    
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         236   8e-69    
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         236   9e-69    
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
ref|XP_002194651.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    235   1e-68    
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         235   1e-68    
gb|EFZ14973.1|  hypothetical protein SINV_01110                         235   1e-68    
gb|KFW89360.1|  Cytoplasmic aconitate hydratase                         235   1e-68    
ref|XP_009499933.1|  PREDICTED: cytoplasmic aconitate hydratase         235   2e-68    
emb|CAB41634.1|  iron regulatory protein 1-like protein                 235   2e-68    
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    235   2e-68    
ref|XP_011192810.1|  PREDICTED: cytoplasmic aconitate hydratase-like    235   2e-68    
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    235   2e-68    
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      235   2e-68    
gb|KFM82338.1|  hypothetical protein X975_14216                         235   2e-68    
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         234   2e-68    
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         234   2e-68    
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    234   2e-68    
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         234   2e-68    
emb|CAF93695.1|  unnamed protein product                                234   2e-68    
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                    234   3e-68    
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    234   3e-68    
ref|NP_001135643.1|  cytoplasmic aconitate hydratase                    234   3e-68    
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    234   3e-68    
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    234   3e-68    
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    234   3e-68    
ref|XP_011198599.1|  PREDICTED: cytoplasmic aconitate hydratase-like    234   3e-68    
ref|XP_010307150.1|  PREDICTED: cytoplasmic aconitate hydratase         234   3e-68    
ref|XP_006014028.1|  PREDICTED: cytoplasmic aconitate hydratase-like    229   4e-68    
ref|XP_977148.1|  aconitate hydratase 1 family protein                  234   4e-68    
dbj|BAF33290.1|  soluble aconitase 1                                    220   5e-68    
ref|XP_009030486.1|  hypothetical protein HELRODRAFT_189761             234   5e-68    
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase         233   5e-68    
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         233   5e-68    
gb|AFW74638.1|  putative AP2/EREBP transcription factor superfami...    230   6e-68    
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein           233   6e-68    
ref|NP_509898.1|  Protein ACO-1                                         233   6e-68    
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    233   6e-68    
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase         233   6e-68    
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         233   8e-68    
ref|XP_007440358.1|  PREDICTED: cytoplasmic aconitate hydratase-like    232   8e-68    
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         233   8e-68    
ref|XP_005184263.1|  PREDICTED: cytoplasmic aconitate hydratase         233   8e-68    
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         233   9e-68    
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         233   9e-68    
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         233   9e-68    
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         233   1e-67    
ref|XP_004530707.1|  PREDICTED: cytoplasmic aconitate hydratase-like    233   1e-67    
ref|XP_007904798.1|  PREDICTED: cytoplasmic aconitate hydratase         233   1e-67    
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         231   1e-67    
gb|EFA77648.1|  putative iron regulatory protein                        232   2e-67    
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         232   2e-67    
ref|XP_002429734.1|  aconitase, putative                                232   2e-67    
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         231   3e-67    
ref|XP_003966778.1|  PREDICTED: cytoplasmic aconitate hydratase-like    231   3e-67    
emb|CBY22746.1|  unnamed protein product                                231   3e-67    
gb|EMP30789.1|  Cytoplasmic aconitate hydratase                         231   3e-67    
ref|XP_007255248.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    231   3e-67    
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              231   3e-67    
gb|EGI63266.1|  Cytoplasmic aconitate hydratase                         231   3e-67    
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase         231   3e-67    
gb|EGT30572.1|  CBN-ACO-1 protein                                       231   4e-67    
ref|XP_011058028.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    231   4e-67    
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like    231   4e-67    
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         231   4e-67    
gb|AAF29446.1|AF127456_1  aconitase                                     230   5e-67    
ref|XP_001365420.1|  PREDICTED: cytoplasmic aconitate hydratase         231   6e-67    
ref|XP_003109738.1|  CRE-ACO-1 protein                                  230   7e-67    
emb|CBH16617.1|  aconitase, putative                                    230   7e-67    
ref|XP_827883.1|  aconitase                                             230   7e-67    
ref|XP_010177495.1|  PREDICTED: cytoplasmic aconitate hydratase         230   9e-67    
gb|AAH05454.1|  Aconitase 1                                             230   9e-67    
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   9e-67    
gb|AAR15297.1|  iron regulatory protein                                 230   1e-66    
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   1e-66    
ref|XP_001659032.1|  AAEL008216-PA                                      230   1e-66    
ref|XP_641837.1|  hypothetical protein DDB_G0279159                     230   1e-66    
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    229   1e-66    
dbj|BAN16539.1|  ADB0003847                                             229   1e-66    
ref|XP_008545838.1|  PREDICTED: cytoplasmic aconitate hydratase-like    229   1e-66    
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         229   1e-66    
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    229   1e-66    
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     229   1e-66    
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         229   1e-66    
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         229   2e-66    
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         229   2e-66    
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         229   2e-66    
ref|XP_003487432.1|  PREDICTED: cytoplasmic aconitate hydratase-like    229   2e-66    
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    229   2e-66    
gb|EPY75099.1|  cytoplasmic aconitate hydratase                         229   2e-66    
gb|EFN64547.1|  Cytoplasmic aconitate hydratase                         231   2e-66    
gb|KDR18766.1|  Cytoplasmic aconitate hydratase                         229   2e-66    
gb|KFB40343.1|  AGAP007258-PA-like protein                              229   2e-66    
emb|CCW61236.1|  unnamed protein product                                229   2e-66    
ref|XP_001843386.1|  iron-responsive element-binding protein 1          229   2e-66    
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       229   2e-66    
ref|XP_008953722.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   2e-66    
ref|XP_003401470.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    229   2e-66    
ref|XP_002126781.1|  PREDICTED: cytoplasmic aconitate hydratase         229   2e-66    
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         229   2e-66    
emb|CDW89012.1|  aconitate hydratase 1 family protein                   229   3e-66    
emb|CAD20353.1|  cytoplasmic aconitase                                  229   3e-66    
emb|CDQ69390.1|  unnamed protein product                                229   3e-66    
gb|AJQ30117.1|  aconitate hydratase 1                                   229   3e-66    
ref|XP_004712473.1|  PREDICTED: cytoplasmic aconitate hydratase         228   3e-66    
ref|NP_001133702.1|  Iron-responsive element-binding protein 1          229   3e-66    
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         229   3e-66    
dbj|BAD92717.1|  aconitase 1 variant                                    228   3e-66    
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    228   3e-66    
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         228   3e-66    
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   4e-66    
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         228   4e-66    
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    228   4e-66    
ref|XP_002071941.1|  GK22582                                            228   4e-66    
ref|XP_011261917.1|  PREDICTED: cytoplasmic aconitate hydratase-like    231   4e-66    
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            228   4e-66    
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         228   4e-66    
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       228   4e-66    
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   4e-66    
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      228   4e-66    
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   4e-66    
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         228   4e-66    
ref|XP_821896.1|  aconitase                                             228   4e-66    
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         228   4e-66    
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         228   4e-66    
emb|CAP35039.2|  Protein CBR-ACO-1                                      228   4e-66    
ref|XP_005581618.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   5e-66    
gb|EKF31280.1|  aconitase, putative                                     228   5e-66    
emb|CAA43455.1|  iron response element binding protein                  228   5e-66    
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    228   5e-66    
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         228   5e-66    
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    228   5e-66    
ref|NP_001080577.1|  aconitase 1, soluble                               228   5e-66    
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   5e-66    
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   6e-66    
gb|EKG02789.1|  aconitase, putative                                     228   6e-66    
ref|NP_001126764.1|  cytoplasmic aconitate hydratase                    228   6e-66    
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    228   6e-66    
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         228   6e-66    



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+ LDNKVGFKGFA
Sbjct  66   VDYNEPQQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHALLDNKVGFKGFA  125

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  126  VPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  185

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  186  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  245

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  246  NDIVAAAVLSGNR  258



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   381 bits (978),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  439  VDYNEPQQERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  498

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAK+A ELGL V
Sbjct  499  IPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKRACELGLQV  558

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  559  KPWVKTSLAPGSGVVTKYLLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISE  618

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  619  NDIVAAAVLSGNR  631



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   380 bits (977),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  439  VDYNEPQQERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  498

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  499  IPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  558

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ YLNQQGF+IVGYGCTTCIGNSGDLDESVS+AISD
Sbjct  559  KPWVKTSLAPGSGVVTKYLLKSGLQPYLNQQGFNIVGYGCTTCIGNSGDLDESVSAAISD  618

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  619  NDIVAAAVLSGNR  631



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQE+VYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  348  VDYKEPQQEKVYSSYLQLDLTDVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQE VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEAQENVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESVS+AISD
Sbjct  468  KPWVKTSLAPGSGVVTKYLLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISD  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   375 bits (964),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  245  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  305  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+D
Sbjct  365  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITD  424

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  425  NDIVAAAVLSGNR  437



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   380 bits (976),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  447  VDYNEPQQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  506

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  507  VPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  566

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  567  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  626

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  627  NDIVAAAVLSGNR  639



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  348  VDYKEPQQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  408  VPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  468  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  333  VDYNEPQQERVYSSYLELNLAEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  392

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  393  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  452

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  453  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGELDESVASAISE  512

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  513  NDVVAAAVLSGNR  525



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  450  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  509

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  510  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  569

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  570  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITD  629

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  630  NDIVAAAVLSGNR  642



>gb|KCW88792.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=708

 Score =   372 bits (956),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DY+EPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  245  IDYDEPQQERVYSSYLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  305  VPKESQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+
Sbjct  365  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISE  424

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  425  NDIIAAAVLSGNR  437



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  VDYNEPQQERVYSSYLQLDLGEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE QEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  IPKEVQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  566  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISE  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  439  VDYNEPQQERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  498

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  499  IPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  558

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ YLNQQGF+IVGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  559  KPWVKTSLAPGSGVVTKYLLKSGLQPYLNQQGFNIVGYGCTTCIGNSGDLDESVSAAISE  618

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  619  NDIVAAAVLSGNR  631



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  348  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  408  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  468  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITD  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  348  VDYKEPQQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVA+FSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  408  VPKEVQDKVAEFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  468  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+D
Sbjct  566  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITD  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+D
Sbjct  566  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITD  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+D
Sbjct  566  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITD  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   378 bits (970),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  445  VDYKEPQQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  505  VPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  565  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  624

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  625  NDIVAAAVLSGNR  637



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   373 bits (957),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DY+EPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  245  IDYDEPQQERVYSSYLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  305  VPKESQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+
Sbjct  365  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISE  424

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  425  NDIIAAAVLSGNR  437



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   377 bits (969),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  450  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  509

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  510  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  569

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  570  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITD  629

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  630  NDIVAAAVLSGNR  642



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   377 bits (969),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQE+VYSS L LDLV+VEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  447  VDYNEPQQEKVYSSYLDLDLVNVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  506

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  507  VPKEVQDKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  566

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  567  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  626

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  627  NDIVAAAVLSGNR  639



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   377 bits (968),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ E+VYSS L LDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  445  VDYNEPQTEKVYSSYLNLDLADVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  505  VPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  565  KPWVKTSLAPGSGVVTKYLLRSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  624

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  625  NDIVAAAVLSGNR  637



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   377 bits (968),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQE+VYSS L LDLV+VEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  446  VDYNEPQQEKVYSSYLDLDLVNVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV
Sbjct  506  VPKEVQDKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  566  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISE  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+D
Sbjct  566  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITD  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  VDYNEPQQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  VPKETQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+D
Sbjct  566  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITD  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  441  VDYNEPQKERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  500

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK++QEKVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  501  VPKDSQEKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACQLGLQV  560

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESV++AISD
Sbjct  561  KPWVKTSLAPGSGVVTKYLLKSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVAAAISD  620

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  621  NDIVAAAVLSGNR  633



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   375 bits (964),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS LQL+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCL+NKVGFKGFA
Sbjct  448  VDYNEPQQERVYSSYLQLNLADVEPCISGPKRPHDRVPLKEMKADWHSCLNNKVGFKGFA  507

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VP E+Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  508  VPNESQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  567

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG+LDE+V+SAISD
Sbjct  568  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGELDETVASAISD  627

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  628  NDIIAAAVLSGNR  640



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   374 bits (961),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ E+VYS+SL LDL DVEPC+SGPKRPHDRVPLKEMK DWHSCLDNKVGFKGFA
Sbjct  435  VDYNEPQHEKVYSASLHLDLADVEPCVSGPKRPHDRVPLKEMKPDWHSCLDNKVGFKGFA  494

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+AQEKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+
Sbjct  495  VPKDAQEKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHI  554

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  555  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISE  614

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  615  NDIVAAAVLSGNR  627



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   374 bits (959),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQ+RVYSS L+LDL DVEPC+SGPKRPHDRVPLK+MK+DWHSCLDNKVGFKGFA
Sbjct  461  VDYSEPQQDRVYSSYLELDLADVEPCISGPKRPHDRVPLKDMKADWHSCLDNKVGFKGFA  520

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QEKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  521  VPKEQQEKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  580

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  581  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAIAD  640

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  641  NDLVAAAVLSGNR  653



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   372 bits (955),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  429  VDYNEPQQDRVYSSYLELNLSEVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  488

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL +
Sbjct  489  IPKEAQEKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLRI  548

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSGDLDESV+SAIS+
Sbjct  549  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGDLDESVASAISE  608

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  609  NDIVAAAVLSGNR  621



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   361 bits (926),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP  ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  13   VDYNEPPTERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  72

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  73   VPKEQQDKVVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  132

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++
Sbjct  133  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITE  192

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  193  NDVVAAAVLSGNR  205



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   372 bits (956),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DY+EPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  446  IDYDEPQQERVYSSYLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  506  VPKESQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+
Sbjct  566  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISE  625

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  626  NDIIAAAVLSGNR  638



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DW SCLDNKVGFKGF+
Sbjct  447  VDYNEPQQERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWRSCLDNKVGFKGFS  506

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  507  VPKESQNKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEV  566

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  567  KPWIKTSLAPGSGVVTKYLFQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDESVASAISE  626

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  627  NDIIAAAVLSGNR  639



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ E+VYSS L LDL  VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA
Sbjct  348  VDYDEPQHEKVYSSCLHLDLAGVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+AQEKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+
Sbjct  408  VPKDAQEKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHI  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  468  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   372 bits (956),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS LQL+L DVEPC+SGPKRPHDRVPLKEMK+DW +CLDNKVGFKGFA
Sbjct  459  VDYNEPQVERFYSSYLQLNLEDVEPCMSGPKRPHDRVPLKEMKTDWKACLDNKVGFKGFA  518

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKASELGL V
Sbjct  519  VPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASELGLEV  578

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  579  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISE  638

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  639  NDIIAAAVLSGNR  651



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   372 bits (955),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK DWHSCL++KVGFKGFA
Sbjct  465  VDYNEPQQERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKDDWHSCLNSKVGFKGFA  524

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE QEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  525  IPKEEQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLEV  584

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YL+QQGF+IVGYGCTTCIGNSGDLDESVS+AI++
Sbjct  585  KPWVKTSLAPGSGVVTKYLLKSGLQKYLDQQGFNIVGYGCTTCIGNSGDLDESVSAAITE  644

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  645  NDIVAAAVLSGNR  657



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   371 bits (952),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+NEPQQER YSS L+LDLV+VEPC+SGPKRPHDRV LKEMK DWHSCLDNKVGFKGFA
Sbjct  437  VDHNEPQQERAYSSYLELDLVNVEPCVSGPKRPHDRVTLKEMKVDWHSCLDNKVGFKGFA  496

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  497  VPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  556

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSG++DESV+SAI++
Sbjct  557  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGEIDESVASAITE  616

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  617  NDIVAAAVLSGNR  629



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFA
Sbjct  440  VDYNEPQQERVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFA  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  500  VPKEAQDKVAKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  560  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISE  619

Query  543  NDIVAAAVLSGNR  581
            NDIVA+AVLSGNR
Sbjct  620  NDIVASAVLSGNR  632



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFA
Sbjct  440  VDYNEPQQERVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFA  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  500  VPKEAQDKVAKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  560  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISE  619

Query  543  NDIVAAAVLSGNR  581
            NDIVA+AVLSGNR
Sbjct  620  NDIVASAVLSGNR  632



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP  ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  245  VDYNEPPTERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  305  VPKEQQDKVVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++
Sbjct  365  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITE  424

Query  543  NDIVAAAVLSGN  578
            ND+VAAAVLSGN
Sbjct  425  NDVVAAAVLSGN  436



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ E+VYSS L LDL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA
Sbjct  431  VDYNEPQHEKVYSSCLYLDLAEVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  490

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+AQEKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL+V
Sbjct  491  VPKDAQEKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLNV  550

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESVSSAIS+
Sbjct  551  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVSSAISE  610

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  611  NDIVAAAVLSGNR  623



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ E+VYSS L LDL  VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA
Sbjct  439  VDYDEPQHEKVYSSCLHLDLAGVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  498

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+AQEKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+
Sbjct  499  VPKDAQEKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHI  558

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  559  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISE  618

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  619  NDIVAAAVLSGNR  631



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CL+NKVGFKGFA
Sbjct  445  VDYNEPQPERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  505  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV S IS+
Sbjct  565  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVGSVISE  624

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  625  NDILAAAVLSGNR  637



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP+QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFA
Sbjct  245  VDYNEPEQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  305  VPKQEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++
Sbjct  365  KPWVKTSLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITE  424

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  425  NDIVAAAVLSGNR  437



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+LDL  VEPC+SGPKRPHDRVPLKEMK+DWHSCLDN VGFKGFA
Sbjct  108  VDYNEPQQERVYSSYLELDLSGVEPCISGPKRPHDRVPLKEMKADWHSCLDNTVGFKGFA  167

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ+KVAKFSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  168  IPKEAQDKVAKFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKV  227

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQEYLN+QGFHIVGYGCTTCIGNSG+++ESV +AIS+
Sbjct  228  KPWIKTSLAPGSGVVTKYLAKSGLQEYLNEQGFHIVGYGCTTCIGNSGEINESVGAAISE  287

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  288  NDIVAAAVLSGNR  300



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   370 bits (949),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  442  VDYNEPQQERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWHACLDNQVGFKGFA  501

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK++Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  502  VPKDSQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  561

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGL++YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  562  KPWIKTSLAPGSGVVTKYLLQSGLKKYLDQQGFHIVGYGCTTCIGNSGELDESVASAISE  621

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  622  NDIIAAAVLSGNR  634



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   367 bits (942),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+LDL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDN+VGFKGFA
Sbjct  348  VDYNEPQTERVYSSYLELDLNEVEPCISGPKRPHDRVLLKEMKSDWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  468  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDVVAAAVLSGNR  540



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  353  VDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  412

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  413  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKV  472

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+LDESV+SAIS+
Sbjct  473  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELDESVASAISE  532

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  533  NDVVAAAVLSGNR  545



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP+QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFA
Sbjct  452  VDYNEPEQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFA  511

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  512  VPKQEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  571

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++
Sbjct  572  KPWVKTSLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITE  631

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  632  NDIVAAAVLSGNR  644



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   367 bits (943),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+LDL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDN+VGFKGFA
Sbjct  406  VDYNEPQTERVYSSYLELDLNEVEPCISGPKRPHDRVLLKEMKSDWHSCLDNRVGFKGFA  465

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  466  VPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  525

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  526  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISE  585

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  586  NDVVAAAVLSGNR  598



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFA
Sbjct  440  VDYNEPQQERVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFA  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  500  VPKEAQDKVAKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  560  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISE  619

Query  543  NDIVAAAVLSGNR  581
            NDIVA+AVLSGNR
Sbjct  620  NDIVASAVLSGNR  632



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER+YSS L+LDL +VEP +SGPKRPHDRVPLK+MKSDWH+CLDNKVGFKGFA
Sbjct  433  VDYNEPQPERIYSSYLELDLDEVEPSISGPKRPHDRVPLKDMKSDWHACLDNKVGFKGFA  492

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  493  VPKEQQGKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  552

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  553  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISE  612

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  613  NDVVAAAVLSGNR  625



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   367 bits (942),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  429  VDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  488

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  489  IPKEAQGKVAKFDFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  548

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSGDL+ESV+SAIS+
Sbjct  549  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGDLNESVASAISE  608

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  609  NDIVAAAVLSGNR  621



>gb|ADD62592.1| cytosolic aconitase [Triticum aestivum]
Length=456

 Score =   352 bits (904),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L LDL +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA
Sbjct  38   VDYNEPQLERVYSSYLALDLDEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFA  97

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  98   VPKEQQDKVVKFDFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  157

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSG+L ESVS+AI++
Sbjct  158  KPWVKTSLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGELHESVSAAITE  217

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  218  NDVVAAAVLSGNR  230



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   365 bits (937),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+LDL DVEPC+SGPKRPHDRVPL++MK+DWHS LD+KVGFKGFA
Sbjct  348  VDYNEPQQERVYSSYLELDLGDVEPCVSGPKRPHDRVPLRDMKADWHSSLDSKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  408  VPKEEQDKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDL+ESV+SAI+D
Sbjct  468  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLEESVASAIAD  527

Query  543  NDIVAAAVLSGNR  581
            ND++AAAVLSGNR
Sbjct  528  NDLIAAAVLSGNR  540



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   367 bits (942),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  429  VDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  488

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  489  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKV  548

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+LDESV+SAIS+
Sbjct  549  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELDESVASAISE  608

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  609  NDVVAAAVLSGNR  621



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   362 bits (930),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP  ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  245  VDYNEPPTERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  305  VPKEQQDKVVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++
Sbjct  365  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITE  424

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  425  NDVVAAAVLSGNR  437



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   367 bits (942),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS LQLDL DVEPC+SGPKRPHDRVPL+EMK+DWHSCL NKVGFKGFA
Sbjct  449  VDYDEPQAERVYSSYLQLDLADVEPCVSGPKRPHDRVPLREMKADWHSCLSNKVGFKGFA  508

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  509  VPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLKV  568

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+Y N+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  569  KPWIKTSLAPGSGVVTKYLQKSGLQKYFNEQGFHIVGYGCTTCIGNSGDLDESVASAISE  628

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  629  NDILAAAVLSGNR  641



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   363 bits (933),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK DWH+CLDN VGFKGFA
Sbjct  432  VDYNEPQQERVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKDDWHACLDNNVGFKGFA  491

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF+FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  492  IPKEAQGKVAKFNFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  551

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL QSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESVSSAIS+
Sbjct  552  KPWVKTSLAPGSGVVTKYLHQSGLQKYLNEQGFHIVGFGCTTCIGNSGELNESVSSAISE  611

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  612  NDIVAAAVLSGNR  624



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   367 bits (942),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQ+RVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMK+DW+SCL+NKVGFKGFA
Sbjct  446  VDYDEPQQKRVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKADWNSCLNNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  506  VPKEAQGKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  566  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGDLDESVASAISE  625

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  626  NDIIAAAVLSGNR  638



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   367 bits (943),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER YSS L LDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CLDNKVGFKGFA
Sbjct  460  VDYNEPQQERAYSSYLSLDLADVEPCISGPKRPHDRVPLKDMKADWHACLDNKVGFKGFA  519

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q K AKFSFHG+PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKASELGL V
Sbjct  520  IPKEEQGKAAKFSFHGEPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASELGLQV  579

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD++V+SAIS+
Sbjct  580  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDDTVASAISE  639

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  640  NDIVAAAVLSGNR  652



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   367 bits (941),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ E+VYSS L LDL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA
Sbjct  431  VDYNEPQHEKVYSSCLYLDLAEVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  490

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+AQEKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL+V
Sbjct  491  VPKDAQEKVVKFSFHGQHAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLNV  550

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESVSSAIS+
Sbjct  551  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVSSAISE  610

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  611  NDIVAAAVLSGNR  623



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   367 bits (942),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQ+ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA
Sbjct  451  VDYTEPQKERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFA  510

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+QEK+ KF FHGQPAELKHGS+VIAAITSCTNTSNP+VMLGA LVAKKA ELGL V
Sbjct  511  VPKESQEKIVKFDFHGQPAELKHGSLVIAAITSCTNTSNPNVMLGAGLVAKKACELGLQV  570

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSGDLDESV++AISD
Sbjct  571  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGDLDESVAAAISD  630

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  631  NDIVAAAVLSGNR  643



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   365 bits (936),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFA
Sbjct  348  VDYKEPQQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQEKVAKFSFHG+PAELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  408  VPKEAQEKVAKFSFHGKPAELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  528  NDIIAAAVLSGNR  540



>ref|XP_006830449.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
 gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
Length=854

 Score =   363 bits (933),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQ ERVYSS LQLDL DVE CLSGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  326  VDYKEPQTERVYSSYLQLDLADVETCLSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  385

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q+KV KFSFHG+PAE+KHGSVVIAAITSCTNTSNPSVMLGAAL AKKA ELGL V
Sbjct  386  VPKESQDKVVKFSFHGKPAEIKHGSVVIAAITSCTNTSNPSVMLGAALSAKKACELGLEV  445

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAI+D
Sbjct  446  KPWIKTSLAPGSGVVTKYLLQSGLQKYLDQQGFHIVGYGCTTCIGNSGELDESVASAIAD  505

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  506  NDLVASAVLSGNR  518



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   366 bits (940),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFA
Sbjct  445  VDYNEPQQERVYSSYLELNLAEVEPCISGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHG+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  505  VPKEAQDKVAKFSFHGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGF+IVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  565  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFNIVGYGCTTCIGNSGELDESVASAISE  624

Query  543  NDIVAAAVLSGNR  581
            ND++AAAVLSGNR
Sbjct  625  NDVIAAAVLSGNR  637



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYS+ LQLDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CL+NKVGFKGFA
Sbjct  445  VDYNEPQPERVYSAYLQLDLADVEPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  505  VPKEAQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV + I++
Sbjct  565  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVGAVITE  624

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  625  NDILAAAVLSGNR  637



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  434  VDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  493

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  494  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  553

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
             PWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+
Sbjct  554  NPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISE  613

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  614  NDIVAAAVLSGNR  626



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRVPLK+MK DWH+CLDNKVGFKGFA
Sbjct  446  VDYNEPQSERVYSSYLELNLSEVEPCMSGPKRPHDRVPLKDMKVDWHACLDNKVGFKGFA  505

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  506  IPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQV  565

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+Y +QQGFHIVGYGCTTCIGNSGDLDE+V+SAI++
Sbjct  566  KPWVKTSLAPGSGVVTKYLLKSGLQKYFDQQGFHIVGYGCTTCIGNSGDLDETVASAIAE  625

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  626  NDIVAAAVLSGNR  638



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   364 bits (934),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  348  VDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  408  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
             PWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+
Sbjct  468  NPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+P+QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFA
Sbjct  348  VDYNKPEQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  408  VPKQEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++
Sbjct  468  KPWVKTSLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFA
Sbjct  435  VDYKEPQQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFA  494

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQEKVAKFSFHG+PAELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  495  VPKEAQEKVAKFSFHGKPAELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLV  554

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  555  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISE  614

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  615  NDIIAAAVLSGNR  627



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP+QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFA
Sbjct  452  VDYNEPEQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFA  511

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  512  VPKQEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  571

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++
Sbjct  572  KPWVKTSLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITE  631

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  632  NDIVAAAVLSGNR  644



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+P+QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFA
Sbjct  348  VDYNKPEQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  408  VPKQEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++
Sbjct  468  KPWVKTSLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQER YSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA
Sbjct  443  VDYDEPQQERAYSSYLQLDLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFA  502

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KVAKF+FHG PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  503  VPKEEQNKVAKFTFHGLPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEV  562

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  563  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISE  622

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  623  NDIIAAAVLSGNR  635



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFA
Sbjct  442  VDYKEPQQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFA  501

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQEKVAKFSFHG+PAELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  502  VPKEAQEKVAKFSFHGKPAELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLV  561

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  562  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISE  621

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  622  NDIIAAAVLSGNR  634



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 4/193 (2%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDN+    GFA
Sbjct  75   VDYNEPQTERVYSSYLELDLNEVEPCISGPKRPHDRVPLKEMKSDWHSCLDNR----GFA  130

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  131  VPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  190

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  191  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISE  250

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  251  NDVVAAAVLSGNR  263



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   365 bits (937),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQ ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  458  VDYREPQVERVYSSYLELDLTDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  517

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK++Q+KV KFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA E+GL V
Sbjct  518  VPKDSQDKVVKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACEVGLEV  577

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESV++A+S+
Sbjct  578  KPWIKTSLAPGSGVVTKYLLKSGLQNYLNQQGFHIVGYGCTTCIGNSGDLDESVAAAVSE  637

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  638  NDIVAAAVLSGNR  650



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   364 bits (935),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  434  VDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  493

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  494  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  553

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
             PWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+
Sbjct  554  NPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISE  613

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  614  NDIVAAAVLSGNR  626



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   365 bits (936),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEPQ+E+VYSS L L+L DVEPC+SGPKRPHDRVPLK+MK DWHSCLDNK+GFKGFA
Sbjct  460  IDYNEPQEEKVYSSYLDLELSDVEPCISGPKRPHDRVPLKDMKDDWHSCLDNKIGFKGFA  519

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE QEKV KFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  520  IPKEKQEKVVKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  579

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  580  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAIAD  639

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  640  NDLVAAAVLSGNR  652



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   364 bits (935),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  457  VDYSEPQVERVYSSYLELDLTDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  516

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK++Q+KV KFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  517  VPKDSQDKVVKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  576

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGL+ YLNQQGFH+VGYGCTTCIGNSGDLDESV++AIS+
Sbjct  577  KPWIKTSLAPGSGVVTKYLLKSGLENYLNQQGFHLVGYGCTTCIGNSGDLDESVAAAISE  636

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  637  NDIVAAAVLSGNR  649



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   364 bits (934),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS LQLDL DVEPC+SGPKRPHDRVPL+EMK+DWHSCL NKVGFKGFA
Sbjct  451  VDYDEPQAERVYSSYLQLDLADVEPCVSGPKRPHDRVPLREMKADWHSCLSNKVGFKGFA  510

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ+KVAKFSFHG PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  511  VPKEAQDKVAKFSFHGLPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLKV  570

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+Y N+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+
Sbjct  571  KPWIKTSLAPGSGVVTKYLQKSGLQKYFNEQGFHIVGYGCTTCIGNSGDLDESVASAISE  630

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  631  NDILAAAVLSGNR  643



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   363 bits (933),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP  ER+YSS L+LDL +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  444  VDYNEPPTERIYSSYLELDLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  503

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  504  VPKEQQDKVVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  563

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++
Sbjct  564  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAITE  623

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  624  NDVVAAAVLSGNR  636



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   363 bits (933),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ER Y+S LQLDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGF 
Sbjct  449  VDYNEPQEERAYTSYLQLDLADVEPCVSGPKRPHDRVPLKEMKTDWHSCLDSRVGFKGFG  508

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  509  VPKEEQDKVAKFSFHGQPAELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  568

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD  V+SAISD
Sbjct  569  KPWIKTSLAPGSGVVTKYLEQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDSEVASAISD  628

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  629  NDIIAAAVLSGNR  641



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS+L LDL DVEPC+SGPKRPHDRV LKEMKSDWH+CLDNKVGFKGFA
Sbjct  432  VDYNEPQAERVYSSNLALDLDDVEPCISGPKRPHDRVTLKEMKSDWHACLDNKVGFKGFA  491

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  492  VPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  551

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSGDLDESVS+ I++
Sbjct  552  KPWVKTSLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGDLDESVSAVITE  611

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  612  NDVVAAAVLSGNR  624



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA
Sbjct  429  VDYNEPQQDRAYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  488

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  489  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLKV  548

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVG+GCTTCIGNSGDLDESV+SAIS+
Sbjct  549  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGFGCTTCIGNSGDLDESVASAISE  608

Query  543  NDIVAAAVLSGNR  581
            NDIVA+AVLSGNR
Sbjct  609  NDIVASAVLSGNR  621



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L LDL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDNKVGFKGFA
Sbjct  435  VDYNEPQLERVYSSYLALDLDEVEPCISGPKRPHDRVTLKEMKSDWHSCLDNKVGFKGFA  494

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  495  VPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  554

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSGDLDESVS+AI++
Sbjct  555  KPWVKTSLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGDLDESVSAAITE  614

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  615  NDVVAAAVLSGNR  627



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP  ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA
Sbjct  435  VDYNEPPTERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFA  494

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  495  VPKEQQDKVVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  554

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++
Sbjct  555  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITE  614

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  615  NDVVAAAVLSGNR  627



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   362 bits (929),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER+YSS LQL+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  425  VDYNEPQTERIYSSYLQLNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  484

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +FSFHG PA+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  485  VPKESQNKVVEFSFHGAPAQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  544

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQQGFHIVGYGCTTCIGNSGD+DE+V+S ISD
Sbjct  545  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQQGFHIVGYGCTTCIGNSGDIDETVASVISD  604

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  605  NDIVAAAVLSGNR  617



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   362 bits (930),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER YSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA
Sbjct  443  VDYNEPQQERAYSSYLQLDLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFA  502

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV+KF+FHG PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  503  VPKEEQNKVSKFTFHGLPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEV  562

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  563  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISE  622

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  623  NDIIAAAVLSGNR  635



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   362 bits (930),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQER YSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA
Sbjct  443  VDYDEPQQERAYSSYLQLDLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFA  502

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KVAKF+FHG PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  503  VPKEEQNKVAKFTFHGLPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEV  562

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+
Sbjct  563  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISE  622

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  623  NDIIAAAVLSGNR  635



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   361 bits (926),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA
Sbjct  441  VDYSEPQQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFA  500

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVAKFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL V
Sbjct  501  IPKEAQEKVAKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQV  560

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLN QGFHIVGYGCTTCIGNSG+++ESV +AI++
Sbjct  561  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNHQGFHIVGYGCTTCIGNSGEINESVGAAITE  620

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  621  NDIVAAAVLSGNR  633



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   361 bits (927),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+LDL  VEPC+SGPKRPHDRVPLKEMK+DWHSCLDN VGFKGFA
Sbjct  448  VDYNEPQQERVYSSYLELDLSGVEPCISGPKRPHDRVPLKEMKADWHSCLDNTVGFKGFA  507

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ+KVAKFSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  508  IPKEAQDKVAKFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKV  567

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQEYLN+QGFHIVGYGCTTCIGNSG+++ESV +AIS+
Sbjct  568  KPWIKTSLAPGSGVVTKYLAKSGLQEYLNEQGFHIVGYGCTTCIGNSGEINESVGAAISE  627

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  628  NDIVAAAVLSGNR  640



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA
Sbjct  430  VDYSEPQQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFA  489

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVAKFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  490  IPKEAQEKVAKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  549

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW KTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSG++DESV +AI++
Sbjct  550  KPWTKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITE  609

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  610  NDIVAAAVLSGNR  622



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+E+VY+S LQLDL DVEPC+SGPKRPHDRVPLKEMK+DW  CLDN+ GFKGF 
Sbjct  440  VDYNEPQEEQVYTSYLQLDLADVEPCVSGPKRPHDRVPLKEMKADWQKCLDNRAGFKGFG  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  500  VPKEEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ YLN+ GFHIVGYGCTTCIGNSG+LD SV+SAISD
Sbjct  560  KPWIKTSLAPGSGVVTKYLLQSGLQRYLNELGFHIVGYGCTTCIGNSGELDPSVASAISD  619

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  620  NDIIAAAVLSGNR  632



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ++R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA
Sbjct  435  VDYDEPQKDRAYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFA  494

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  495  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  554

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVG+GCTTCIGNSGDLDESV+SAI++
Sbjct  555  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGFGCTTCIGNSGDLDESVASAITE  614

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  615  NDILAAAVLSGNR  627



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ E+VYSS LQL L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQIEKVYSSYLQLKLEEVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q+KVAKFSFHG PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKESQDKVAKFSFHGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQRYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDMVAAAVLSGNR  540



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   358 bits (918),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP+ ERVYSS L+LDL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDNKVGFKGFA
Sbjct  440  VDYNEPESERVYSSYLELDLSQVEPCISGPKRPHDRVTLKDMKADWHACLDNKVGFKGFA  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q+K  KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  500  IPKEVQDKEVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLRV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV+SAI++
Sbjct  560  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVASAITE  619

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  620  NDIVAAAVLSGNR  632



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA
Sbjct  444  VDYNEPQSERVYSSYLELNLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFA  503

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVAKF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  504  IPKEVQNKVAKFQFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLEV  563

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+
Sbjct  564  KPWVKTSLAPGSGVVTKYLLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISE  623

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  624  NDIVAAAVLSGNR  636



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   357 bits (916),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWH CLD+KVGFKGFA
Sbjct  431  VDYSEPQQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHYCLDSKVGFKGFA  490

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVAKFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  491  IPKEAQEKVAKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  550

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW KTSLAPGSGVVTKYLL+SGLQ++LNQQGF+IVGYGCTTCIGNSG++DESV +AI++
Sbjct  551  KPWTKTSLAPGSGVVTKYLLKSGLQKFLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITE  610

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  611  NDIVAAAVLSGNR  623



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   356 bits (914),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA
Sbjct  445  VDYNEPQQDRVYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  505  IPKEAQEKVANFSFNGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLEV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  565  KPWIKTSLAPGSGVVTKYLLQSGLQEYLNKQGFNIVGYGCTTCIGNSGEINESVGAAITE  624

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  625  NDIVAAAVLSGNR  637



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   357 bits (915),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQERVYSS L+LDL  VEPC+SGPKRPHDRVPL++MK DWHSCLDNK+GFKGF 
Sbjct  461  VDYSEPQQERVYSSYLELDLAGVEPCVSGPKRPHDRVPLRQMKDDWHSCLDNKIGFKGFG  520

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KVAKFSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  521  VPKEEQSKVAKFSFSGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  580

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDL ESV+SAI++
Sbjct  581  KPWIKTSLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLQESVASAITE  640

Query  543  NDIVAAAVLSGNR  581
            +D++AAAVLSGNR
Sbjct  641  HDLIAAAVLSGNR  653



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   355 bits (912),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+ VGFKGFA
Sbjct  427  VDYSEPQQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSNVGFKGFA  486

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKV KFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  487  IPKEAQEKVVKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQV  546

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW KTSLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSG++DESV +AI++
Sbjct  547  KPWTKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITE  606

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  607  NDIVAAAVLSGNR  619



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA
Sbjct  436  VDYNEPQQERVYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFA  495

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAEL HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  496  IPKEAQEKVANFSFNGKPAELHHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  555

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  556  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  615

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  616  NDIVAAAVLSGNR  628



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA
Sbjct  442  VDYNEPQTERAYSSYLELNLSEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFA  501

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVAKF F GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  502  IPKEVQNKVAKFQFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQV  561

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+Y +QQGF+IVGYGCTTCIGNSGDL ESV+SAIS+
Sbjct  562  KPWVKTSLAPGSGVVTKYLLQSGLQKYFDQQGFNIVGYGCTTCIGNSGDLHESVASAISE  621

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  622  NDIVAAAVLSGNR  634



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   353 bits (905),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWHSCLD+KVGFKGFA
Sbjct  348  VDYNEPQQDRVYSSYLELNLDDVEPCISGPKRPHDRVTLKEMKADWHSCLDSKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKV  FSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  408  IPKEAQEKVVNFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   353 bits (905),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA
Sbjct  348  VDYNEPQIERAYSSYLELNLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVAKF F GQPAEL HGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  408  IPKEVQNKVAKFQFDGQPAELNHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+
Sbjct  468  KPWVKTSLAPGSGVVTKYLLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ERVYSS   LDL DVEPC+SGPKRP+DRV LK+MK+DWH+CLDNK GFKGFA
Sbjct  467  VDYNEPQEERVYSSYSGLDLADVEPCISGPKRPNDRVALKDMKADWHACLDNKHGFKGFA  526

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKF+FHG PAELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  527  VPKQEQDKVAKFTFHGLPAELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  586

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSG VTKYL +SGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  587  KPWIKTSLAPGSGAVTKYLHKSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITD  646

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  647  NDIVAAAVLSGNR  659



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ +RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA
Sbjct  441  VDYNEPQIDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFA  500

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL V
Sbjct  501  IPKEAQEKVANFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQV  560

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGFHIVGYGCTTCIGNSG+++ESV +AI++
Sbjct  561  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFHIVGYGCTTCIGNSGEINESVGAAITE  620

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  621  NDIVAAAVLSGNR  633



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   352 bits (903),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +3

Query  18   PQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEA  197
            PQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEA
Sbjct  334  PQQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEA  393

Query  198  QEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVK  377
             EKVAKFSF G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+K
Sbjct  394  LEKVAKFSFDGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIK  453

Query  378  TSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVA  557
            TSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+A
Sbjct  454  TSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIA  513

Query  558  AAVLSGNR  581
            AAVLSGNR
Sbjct  514  AAVLSGNR  521



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   354 bits (908),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPLK MK+DWHSCLDNKVGFKGFA
Sbjct  443  VDYSQPQTERVYSSYLELNLEDVEPCVSGPKRPHDRVPLKVMKADWHSCLDNKVGFKGFA  502

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  503  VPKEAQNKVAEFSFHGTPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  562

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGDLDE+VS+AIS+
Sbjct  563  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDLDETVSAAISE  622

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  623  NDIVAAAVLSGNR  635



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   353 bits (905),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L LDL +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA
Sbjct  385  VDYNEPQLERVYSSYLALDLDEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFA  444

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  445  VPKEQQDKVVKFDFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  504

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSG+L ESVS+AI++
Sbjct  505  KPWVKTSLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGELHESVSAAITE  564

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  565  NDVVAAAVLSGNR  577



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   353 bits (907),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLD+KVGFKGFA
Sbjct  444  VDYNEPQSERVYSSYLELNLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDSKVGFKGFA  503

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KV KF F GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  504  IPKEVQNKVVKFQFEGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQV  563

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+
Sbjct  564  KPWVKTSLAPGSGVVTKYLLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISE  623

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  624  NDIVAAAVLSGNR  636



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   353 bits (906),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEPQ +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  433  IDYNEPQPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  492

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK+ Q KVAKF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  493  IPKDVQGKVAKFDFHGQPAEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKV  552

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+
Sbjct  553  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISE  612

Query  543  NDIVAAAVLSGNR  581
            NDIVA+AVLSGNR
Sbjct  613  NDIVASAVLSGNR  625



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   350 bits (899),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNE QQERVYSS L+LDL  VEPC+SGPKRPHDRVPLK+MK+DWHSCLD+KVGFKGFA
Sbjct  415  IDYNEAQQERVYSSYLELDLTSVEPCISGPKRPHDRVPLKDMKADWHSCLDSKVGFKGFA  474

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            + KE Q K  KFSF+G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  475  ISKEQQNKTVKFSFNGEPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  534

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDL++SV++AI+D
Sbjct  535  KPWVKTSLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLNDSVAAAIAD  594

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  595  NDLVAAAVLSGNR  607



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   353 bits (905),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +3

Query  18   PQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEA  197
            PQQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEA
Sbjct  428  PQQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEA  487

Query  198  QEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVK  377
             EKVAKFSF G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+K
Sbjct  488  LEKVAKFSFDGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIK  547

Query  378  TSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVA  557
            TSLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+A
Sbjct  548  TSLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIA  607

Query  558  AAVLSGNR  581
            AAVLSGNR
Sbjct  608  AAVLSGNR  615



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   353 bits (905),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEPQ +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA
Sbjct  434  IDYNEPQPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFA  493

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK+ Q KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  494  IPKDVQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  553

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+
Sbjct  554  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISE  613

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  614  NDIVAAAVLSGNR  626



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   353 bits (905),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEPQ +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA
Sbjct  434  IDYNEPQPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFA  493

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK+ Q KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  494  IPKDVQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQV  553

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+
Sbjct  554  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISE  613

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  614  NDIVAAAVLSGNR  626



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWHSCLD+KVGFKGFA
Sbjct  440  VDYNEPQQDRVYSSYLELNLDDVEPCISGPKRPHDRVTLKEMKADWHSCLDSKVGFKGFA  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKV  FSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  500  IPKEAQEKVVNFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  560  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITE  619

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  620  NDIVAAAVLSGNR  632



>gb|ACK56135.1| putative aconitase, partial [Dimocarpus longan]
Length=317

 Score =   333 bits (854),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+Q+R YSS L LDL +VEPC+SGPKRPHDRV LK+MK+DWH CLDNKVGFKGFA
Sbjct  136  VDYSEPEQDRAYSSYLLLDLAEVEPCISGPKRPHDRVALKDMKADWHPCLDNKVGFKGFA  195

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  196  VPKQEQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  255

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            K W+KTSLAPGSGVVTKYL QSGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV++AIS+
Sbjct  256  KRWIKTSLAPGSGVVTKYLHQSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVANAISE  315

Query  543  ND  548
            ND
Sbjct  316  ND  317



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC++GPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPQIERVYSSYLELNLEDVEPCIAGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKESQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDLVAAAVLSGNR  540



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ERVYSS L+L+L DVEPC+SGPKRP+DRVPLK+MK+DWH+CLDNK GFKGFA
Sbjct  430  VDYNEPQEERVYSSYLELELADVEPCVSGPKRPNDRVPLKDMKADWHACLDNKQGFKGFA  489

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KVAKF+FHG PAELKHGSVVIAAITSCTNTSNP+VMLGA LVAKKA ELGL V
Sbjct  490  VPKEEQDKVAKFTFHGLPAELKHGSVVIAAITSCTNTSNPNVMLGAGLVAKKACELGLEV  549

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSG VTKYL +SGL++YLNQQGF++VGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  550  KPWIKTSLAPGSGAVTKYLHKSGLEKYLNQQGFNLVGYGCTTCIGNSGDLDESVASAITD  609

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  610  NDIVAAAVLSGNR  622



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  245  VDYNEPQVERTYSSYLELDLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL V
Sbjct  305  VPKESQGKVAEFTFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++
Sbjct  365  KPWIKTSLAPGSGVVTKYLQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITE  424

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  425  NDLVAAAVLSGNR  437



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ +RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA
Sbjct  444  VDYNEPQIDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFA  503

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL V
Sbjct  504  IPKEAQEKVANFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQV  563

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  564  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  623

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  624  NDIVAAAVLSGNR  636



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEPQ +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA
Sbjct  434  IDYNEPQPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFA  493

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK+ Q KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  494  IPKDVQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLQV  553

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+
Sbjct  554  KPWVKTSLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISE  613

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  614  NDIVAAAVLSGNR  626



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   349 bits (895),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ERVYSS L LDL DVEPC+SGPKRP+DRV L +MK+DWH+CLDNK GFKGFA
Sbjct  514  VDYNEPQEERVYSSYLGLDLADVEPCVSGPKRPNDRVALNDMKADWHACLDNKHGFKGFA  573

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVA F+FHG PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  574  VPKQEQDKVATFTFHGLPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  633

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSG VTKYL +SGLQ YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  634  KPWIKTSLAPGSGAVTKYLHKSGLQTYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITD  693

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  694  NDIVAAAVLSGNR  706



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ E+VYS+ L L L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQTEKVYSTYLDLKLEDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KVAKFSF G PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKESQNKVAKFSFRGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDMVAAAVLSGNR  540



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEAQVKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA
Sbjct  443  VDYNEPQQDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFA  502

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  503  IPKEAQEKVANFSFNGEPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  562

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  563  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  622

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  623  NDIVAAAVLSGNR  635



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   349 bits (896),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY EPQ ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYTEPQVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEAQVKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   349 bits (896),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ E+VYSS LQL L +VEPC+SGPKRPHDRVPLKEMK+DW +CLDN+VGFKGFA
Sbjct  348  VDYSEPQIEKVYSSYLQLKLEEVEPCISGPKRPHDRVPLKEMKADWQACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q+K AKFSFHG PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKESQDKAAKFSFHGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDMVAAAVLSGNR  540



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   351 bits (901),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA
Sbjct  438  VDYNEPQQDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFA  497

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEA EKVAKFSF+G+PAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL V
Sbjct  498  IPKEAHEKVAKFSFNGEPAEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQV  557

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQEYLN QGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  558  KPWVKTSLAPGSGVVTKYLLKSGLQEYLNHQGFNIVGYGCTTCIGNSGEINESVGAAITE  617

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  618  NDIVAAAVLSGNR  630



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   350 bits (897),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DY++PQ ERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  440  IDYSQPQTERVYSSYLELNLEEVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  499

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  500  VPKETQNKVAEFSFHGMPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  559

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVT+YL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+
Sbjct  560  KPWIKTSLAPGSGVVTRYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDETVSAAISE  619

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  620  NDIVAAAVLSGNR  632



>dbj|BAE98476.1| aconitase like protein [Arabidopsis thaliana]
Length=325

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  60   VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  119

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL V
Sbjct  120  VPKEKQEEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKV  179

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI  
Sbjct  180  KPWVKTSLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEG  239

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  240  TDIIPAAVLSGNR  252



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS L+LDL  VEPC+SGPKRPHDRV LKEMK+DWHSCLDNKVGFKGFA
Sbjct  13   VDYNEPQIERTYSSYLELDLSSVEPCISGPKRPHDRVTLKEMKADWHSCLDNKVGFKGFA  72

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE QEKV KF+++G PAEL+HG VVIAAITSCTNTSNP+VMLGA LVAKKA ELGL V
Sbjct  73   IPKEKQEKVVKFTYNGTPAELRHGDVVIAAITSCTNTSNPNVMLGAGLVAKKACELGLEV  132

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL +SGL +YL+QQGF +VGYGCTTCIGNSGDL ESVSSAI++
Sbjct  133  KPWVKTSLAPGSGVVTKYLKKSGLDKYLDQQGFQLVGYGCTTCIGNSGDLHESVSSAITE  192

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  193  NDLVASAVLSGNR  205



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ERVYSS   LDL DVEPC+SGPKRP+DRV LK+MK+DWH+CLDNK GFKGFA
Sbjct  467  VDYNEPQEERVYSSYSGLDLADVEPCISGPKRPNDRVALKDMKADWHACLDNKHGFKGFA  526

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVAKF+FHG PAELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  527  VPKQEQDKVAKFTFHGLPAELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  586

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSG VTKYL +SGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  587  KPWIKTSLAPGSGAVTKYLHKSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITD  646

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  647  NDIVAAAVLSGNR  659



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  245  VDYNEPQIERVYSSYLELNLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  305  VPKESQSKVVEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  365  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  424

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  425  NDLVAAAVLSGNR  437



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  346  VDYNEPQVERTYSSYLELDLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  405

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL V
Sbjct  406  VPKESQGKVAEFTFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEV  465

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++
Sbjct  466  KPWIKTSLAPGSGVVTKYLQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITE  525

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  526  NDLVAAAVLSGNR  538



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA
Sbjct  441  VDYNEPQQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFA  500

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  501  IPKEAQEKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  560

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  561  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  620

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  621  NDIVAAAVLSGNR  633



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA
Sbjct  444  VDYNEPQQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFA  503

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  504  IPKEAQEKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  563

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  564  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  623

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  624  NDIVAAAVLSGNR  636



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA
Sbjct  441  VDYNEPQQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFA  500

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  501  IPKEAQEKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  560

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  561  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  620

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  621  NDIVAAAVLSGNR  633



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  13   VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  72

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  73   IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  132

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  133  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  192

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  193  NDIVAAAVLSGNR  205



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   347 bits (889),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER YSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQVERTYSSYLELDLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL V
Sbjct  408  VPKESQGKVAEFTFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDLVAAAVLSGNR  540



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   347 bits (889),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ E+VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  348  VDYSQPQVEKVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KV +FS+HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKESQSKVVEFSYHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDMVAAAVLSGNR  540



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   348 bits (894),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  445  VDYSQPQTERVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA E GL V
Sbjct  505  VPKETQNKVAEFSFHGLPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACEQGLEV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVT+YL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+
Sbjct  565  KPWIKTSLAPGSGVVTRYLERSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDETVSAAISE  624

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  625  NDIVAAAVLSGNR  637



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   348 bits (894),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA
Sbjct  445  VDYNEPQQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  505  IPKEAQEKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  565  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  624

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  625  NDIVAAAVLSGNR  637



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   347 bits (889),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ E+VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA
Sbjct  366  VDYSQPQVEKVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFA  425

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KV +FS+HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  426  IPKESQSKVVEFSYHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  485

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+
Sbjct  486  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISE  545

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  546  NDMVAAAVLSGNR  558



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   348 bits (892),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQER YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLDNKVGFKGFA
Sbjct  436  VDYSEPQQERAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDNKVGFKGFA  495

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK+AQEKVA FSF+G+PAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  496  IPKKAQEKVANFSFNGKPAEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  555

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV  AI++
Sbjct  556  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGVAITE  615

Query  543  NDIVAAAVLSGNR  581
            NDIV AAVLSGNR
Sbjct  616  NDIVVAAVLSGNR  628



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   348 bits (892),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 2/195 (1%)
 Frame = +3

Query  3    VDYNEPQ--QERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKG  176
            VDY++PQ  +ERVYSS L+L+L D EPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKG
Sbjct  444  VDYSQPQTERERVYSSYLELNLEDAEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKG  503

Query  177  FAVPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL  356
            FAVPKEAQ KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL
Sbjct  504  FAVPKEAQNKVAEFSFHGTPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGL  563

Query  357  HVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAI  536
             VKPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGDL E+VS+AI
Sbjct  564  EVKPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDLHETVSAAI  623

Query  537  SDNDIVAAAVLSGNR  581
            S+NDIVAAAVLSGNR
Sbjct  624  SENDIVAAAVLSGNR  638



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   343 bits (881),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  245  VDYNEPQIERVYSSYLELNLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VP+E+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  305  VPEESQSKVVEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  365  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  424

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  425  NDLVAAAVLSGNR  437



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQVERVYSSYLELNLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKESQNKVVEFTFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQVERVYSSYLELNLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKESQNKVVEFTFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   347 bits (891),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA
Sbjct  445  VDYDEPQQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQEKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  505  IPKEAQEKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++
Sbjct  565  KPWIKTSLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITE  624

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  625  NDIVAAAVLSGNR  637



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ+ERVYSS L LDL DVEPC+SGPKRP+DRV L +MK+DWH+CLDNK GFKGFA
Sbjct  514  VDYNEPQEERVYSSYLGLDLADVEPCVSGPKRPNDRVALNDMKADWHACLDNKHGFKGFA  573

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q+KVA F+FHG PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  574  VPKQEQDKVATFTFHGLPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  633

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSG VTKYL +SGLQ YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+D
Sbjct  634  KPWIKTSLAPGSGAVTKYLHKSGLQTYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITD  693

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  694  NDIVAAAVLSGNR  706



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ +RVYSS + L+L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDNKVGFKGFA
Sbjct  347  VDYSEPQIDRVYSSYIALNLRDVEPCISGPKRPHDRVPLREMKADWHACLDNKVGFKGFA  406

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLG+ALVAKKA ELGL V
Sbjct  407  IPKESQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGSALVAKKACELGLEV  466

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKY+ +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++
Sbjct  467  KPWIKTSLAPGSGVVTKYMEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITE  526

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  527  NDVVAAAVLSGNR  539



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   345 bits (884),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ER+YSS L L+L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDN+VGFKGFA
Sbjct  347  VDYSEPQIERMYSSYLALNLEDVEPCISGPKRPHDRVPLREMKADWHACLDNRVGFKGFA  406

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KVA+FSF G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  407  IPKESQSKVAEFSFRGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  466

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++
Sbjct  467  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITE  526

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  527  NDLVAAAVLSGNR  539



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVY+S L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFA
Sbjct  348  VDYSEPQIERVYTSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KV +F+FHG PA+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKESQSKVVEFNFHGTPAQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKAFELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL +SGLQ+YLN  GFHIVGYGCTTCIGNSGD+DE+V+SAI++
Sbjct  468  KPWVKTSLAPGSGVVTKYLEKSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDEAVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDLVAAAVLSGNR  540



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  150  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  209

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  210  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  269

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  270  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  329

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  330  NDIVAAAVLSGNR  342



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   345 bits (884),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DW SCLDNKVGFKGFA
Sbjct  425  VDYSQPQTERVYSSYLELNLGDVEPCVSGPKRPHDRVPLKEMKADWQSCLDNKVGFKGFA  484

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q+K+A+FSFHG   ++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  485  VPKESQDKIAEFSFHGTTTQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  544

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+
Sbjct  545  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDEAVSAAISE  604

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  605  NDIVAAAVLSGNR  617



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ ERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK DWH+CLDNKVGFKGFA
Sbjct  348  VDYSQPQTERVYSSYLELNLEEVEPCVSGPKRPHDRVPLKEMKVDWHACLDNKVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK++Q KV +FSFH  PA+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKDSQSKVVEFSFHETPAQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ +LNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQNHLNQLGFHIVGYGCTTCIGNSGDIDESVASAISE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEPQ E VYSS L+L L DVEPC+SGPKRPHDRVP+KEMK+DWH+CLDN+VGFKGFA
Sbjct  348  IDYNEPQSEIVYSSCLELKLEDVEPCISGPKRPHDRVPIKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KV  F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEAQNKVVDFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DE+V+ AI+D
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDEAVALAIAD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDMVAAAVLSGNR  540



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   342 bits (877),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQIERVYSSYLELNLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKESQSKVVEFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDVVAAAVLSGNR  540



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   341 bits (875),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYS+SL+L L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQLERVYSASLELKLEDVEPCISGPKRPHDRVSLKEMKVDWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +FSFHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKESQTKVVEFSFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+D++V+SAI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDDAVASAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   341 bits (875),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ  RVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQIVRVYSSYLELNLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKESQSKVVEFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDLVAAAVLSGNR  540



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   339 bits (869),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  245  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  305  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  365  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  424

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  425  NDIVAAAVLSGNR  437



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   340 bits (873),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  18   PQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEA  197
            PQ ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEA
Sbjct  334  PQVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEA  393

Query  198  QEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVK  377
            Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+K
Sbjct  394  QVKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIK  453

Query  378  TSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVA  557
            TSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++NDIVA
Sbjct  454  TSLAPGSGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDIVA  513

Query  558  AAVLSGNR  581
            AAVLSGNR
Sbjct  514  AAVLSGNR  521



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   341 bits (874),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQIERVYSSYLELNLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKESQSKVVEFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDVVAAAVLSGNR  540



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score =   338 bits (868),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  408  VDYSEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  467

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            V KE+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  468  VAKESQSKVVEFTFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACKLGLEV  527

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYLL+SGLQ+YLN  GF+IVGYGCTTCIGNSGD+DE+V SAI++
Sbjct  528  KPWIKTSLAPGSGVVTKYLLKSGLQKYLNHLGFYIVGYGCTTCIGNSGDIDEAVGSAITE  587

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  588  NDIVAAAVLSGNR  600



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 182/222 (82%), Gaps = 29/222 (13%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ E+VYSS LQL L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYNEPQIEKVYSSYLQLKLEEVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q+KVAKFSFHG PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKESQDKVAKFSFHGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQRYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISE  527

Query  543  N-----------------------------DIVAAAVLSGNR  581
            N                             D+VAAAVLSGNR
Sbjct  528  NGKFFNKNILGYTCIRMLEADRLAVFYMRPDMVAAAVLSGNR  569



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWH+CL+NKVGFKGFA
Sbjct  245  VDYNEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVTLKEMKADWHACLNNKVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q K A+F FH  PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  305  VPKESQTKFAEFKFHETPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  365  KPWIKTSLAPGSGVVTKYLQKSGLQPYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITE  424

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  425  NDIVAAAVLSGNR  437



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFA
Sbjct  349  VDYSEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFA  408

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  409  VPKESQNKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  468

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  469  KPWIKTSLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITE  528

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  529  NDIVAAAVLSGNR  541



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFA
Sbjct  349  VDYSEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFA  408

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  409  VPKESQNKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  468

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  469  KPWIKTSLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITE  528

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  529  NDIVAAAVLSGNR  541



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  18   PQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEA  197
            PQ E+VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE+
Sbjct  306  PQVEKVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKES  365

Query  198  QEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVK  377
            Q KV +FS+HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+K
Sbjct  366  QSKVVEFSYHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIK  425

Query  378  TSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVA  557
            TSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+ND+VA
Sbjct  426  TSLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISENDMVA  485

Query  558  AAVLSGNR  581
            AAVLSGNR
Sbjct  486  AAVLSGNR  493



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   339 bits (870),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+P+ ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFA
Sbjct  357  VDYNQPEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFA  416

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  417  VPKESQGKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  476

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISD
Sbjct  477  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISD  536

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  537  NDIVAAAVLSGNR  549



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   338 bits (868),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  337  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  396

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  397  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  456

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  457  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  516

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  517  NDIVAAAVLSGNR  529



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   339 bits (869),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ER+YSS L L+L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDN+VGFKGFA
Sbjct  347  VDYSEPQIERMYSSYLALNLEDVEPCISGPKRPHDRVPLREMKADWHACLDNRVGFKGFA  406

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE+Q KVA+FSF G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  407  IPKESQSKVAEFSFRGTSAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  466

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DE+V+SAI++
Sbjct  467  KPWIKTSLAPGSGVVTKYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDEAVASAITE  526

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  527  NDLVAAAVLSGNR  539



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   339 bits (869),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   339 bits (869),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   338 bits (868),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   338 bits (868),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSEPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  528  NDIVAAAVLSGNR  540



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   340 bits (873),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY++PQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPLK MKSDW +CLDNKVGFKGFA
Sbjct  434  VDYSQPQTERVYSSYLELNLEDVEPCISGPKRPHDRVPLKGMKSDWQTCLDNKVGFKGFA  493

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q K+A+FSF G PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  494  VPKESQNKIAEFSFRGTPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  553

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDE+VS+AIS+
Sbjct  554  KPWIKTSLAPGSGVVTKYLEKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDEAVSAAISE  613

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  614  NDIVAAAVLSGNR  626



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSNLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQSKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   340 bits (872),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+P+ ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFA
Sbjct  436  VDYNQPEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFA  495

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  496  VPKESQGKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  555

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISD
Sbjct  556  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISD  615

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  616  NDIVAAAVLSGNR  628



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   340 bits (871),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+P+ ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFA
Sbjct  436  VDYNQPEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFA  495

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  496  VPKESQGKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  555

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISD
Sbjct  556  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISD  615

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  616  NDIVAAAVLSGNR  628



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQQERVYSS L LDL DV PC+SGPKRPHDRVPLK+MK+DWHSCLD+KVGFKGFA
Sbjct  445  VDYSEPQQERVYSSYLHLDLGDVVPCVSGPKRPHDRVPLKDMKADWHSCLDSKVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQ-PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLH  359
            VPKE QEKV KF F G+ PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL 
Sbjct  505  VPKETQEKVVKFLFKGEEPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLK  564

Query  360  VKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAIS  539
            VKPWVKTSLAPGSGV TKYL +SGLQ+YLN+QGF+IVGYGCTTCIGNSGDL+++V  AI+
Sbjct  565  VKPWVKTSLAPGSGVATKYLQESGLQKYLNEQGFNIVGYGCTTCIGNSGDLEKTVGDAIT  624

Query  540  DNDIVAAAVLSGNR  581
            +NDIVAAAVLSGNR
Sbjct  625  ENDIVAAAVLSGNR  638



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVE C+SGPKRPHDRVPLKEMK+DW +CL+N+VGFKGFA
Sbjct  349  VDYSEPQVERVYSSYLELNLEDVESCVSGPKRPHDRVPLKEMKADWLACLNNRVGFKGFA  408

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VP E+Q KVA F+FHG PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  409  VPVESQIKVADFTFHGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  468

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++
Sbjct  469  KPWIKTSLAPGSGVVTKYLQRSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITE  528

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  529  NDIVAAAVLSGNR  541



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGF+
Sbjct  348  VDYNEPQIERVYSSYLELNLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFS  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KV +F+F G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKESQSKVVEFNFQGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  468  KPWIKTSLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  527

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  528  NDVVAAAVLSGNR  540



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSSSL+L+L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSSLELNLADVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KV +F F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQSKVVEFDFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWH+CL+NKVGFKGFA
Sbjct  349  VDYNEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVTLKEMKADWHACLNNKVGFKGFA  408

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q K A+F FH  PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  409  VPKESQTKFAEFKFHETPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQV  468

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  469  KPWIKTSLAPGSGVVTKYLQKSGLQPYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITE  528

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  529  NDIVAAAVLSGNR  541



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSNLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KV +F F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKEAQSKVVEFDFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI+D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHETVASAITD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 179/198 (90%), Gaps = 6/198 (3%)
 Frame = +3

Query  3    VDYNEPQQERVYSS-----SLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVG  167
            VDY+E  Q  ++S       L LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVG
Sbjct  447  VDYSE-IQSFLFSKCQXXXXLHLDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVG  505

Query  168  FKGFAVPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASE  347
            FKGFAVPKEAQ+KVA FSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA E
Sbjct  506  FKGFAVPKEAQQKVASFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACE  565

Query  348  LGLHVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS  527
            LGL VKPW+KTSLAPGSGVVTKYL +SGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+
Sbjct  566  LGLQVKPWIKTSLAPGSGVVTKYLQKSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVA  625

Query  528  SAISDNDIVAAAVLSGNR  581
            + IS+NDIVAAAVLSGNR
Sbjct  626  ATISENDIVAAAVLSGNR  643



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   338 bits (867),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+N+ + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDWHSCLDN VGFKGFA
Sbjct  436  VDHNQVEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWHSCLDNDVGFKGFA  495

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  496  VPKESQSKVAEFSFHGAPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  555

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSGDLDESVS+AIS+
Sbjct  556  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGDLDESVSAAISE  615

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  616  NDIVAAAVLSGNR  628



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFA
Sbjct  356  VDYSEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFA  415

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            V KE+Q KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  416  VSKESQNKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  475

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  476  KPWIKTSLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITE  535

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  536  NDIVAAAVLSGNR  548



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFA
Sbjct  349  VDYSEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFA  408

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            V KE+Q KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  409  VSKESQNKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  468

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  469  KPWIKTSLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITE  528

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  529  NDIVAAAVLSGNR  541



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   335 bits (860),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSNLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQSKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   335 bits (860),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CL+NKVGFKGFA
Sbjct  349  VDYSEPQVERVYSSYLELNLEDVEPCVSGPKRPHDRVTLKEMKIDWHACLNNKVGFKGFA  408

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F+F+  PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  409  VPKESQTKVAEFTFNETPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQV  468

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++
Sbjct  469  KPWIKTSLAPGSGVVTKYLQRSGLQKYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITE  528

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  529  NDIVAAAVLSGNR  541



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+P+ ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFA
Sbjct  356  VDYNQPEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFA  415

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  416  VPKESQGKVADFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  475

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AI++
Sbjct  476  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAIAE  535

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  536  NDIVAAAVLSGNR  548



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSSSL+L+L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSSLELNLEDVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KV +F F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKEAQSKVVEFDFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS+L+L+L  VEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSNLELNLEGVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KVA+F+F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQSKVAEFNFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQQYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYS++L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  355  VDYSEPESKTVYSANLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  414

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  415  VPKEAQSKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  474

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF +VGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  475  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSVVGYGCTTCIGNSGDIHEAVASAIVD  534

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  535  NDLVASAVLSGNR  547



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYS++L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  372  VDYSEPESKTVYSANLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  431

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  432  VPKEAQSKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  491

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  492  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  551

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  552  NDLVASAVLSGNR  564



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   334 bits (857),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSSSL+L+L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSSLELNLEDVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ KV +F F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQNKVVEFDFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLN  GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNHLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   335 bits (859),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL V
Sbjct  505  VPKEKQEEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLEV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+EYL +QGF IVGYGCTTCIGNSG+LD  V+SAI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLREYLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEG  624

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  625  TDIIPAAVLSGNR  637



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   330 bits (847),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  245  VDYSEPESKTVYSSCLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  305  VPKEAQSKAVEFNFNGTTAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  365  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  424

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  425  NDLVASAVLSGNR  437



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP  + +YSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFA
Sbjct  375  VDYSEPASKTIYSSTLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFA  434

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  435  VPKEAQSKAVEFNFNGTPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  494

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  495  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  554

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  555  NDLVASAVLSGNR  567



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP  + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFA
Sbjct  348  VDYNEPASKTVYSSKLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQSKAVEFNFNGTPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YL+Q GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLSQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYS++L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSANLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIA ITSCTNTSNP VMLGAALVAKKA ELGL V
Sbjct  408  VPKEAQSKAVEFNFNGTPAQLRHGDVVIAPITSCTNTSNPRVMLGAALVAKKACELGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>tpg|DAA43248.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=664

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+++   ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFA
Sbjct  135  VDHSQVDAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFA  194

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  195  VPKESQGKVAEFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  254

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++
Sbjct  255  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITE  314

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  315  NDIVAAAVLSGNR  327



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   331 bits (848),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP  + VYSS+L+L+L DVEPC+SGPKRPHDR+PLKEMK+DWHSCLD++VGFKGFA
Sbjct  351  VDYSEPASKTVYSSNLELNLEDVEPCVSGPKRPHDRLPLKEMKADWHSCLDSRVGFKGFA  410

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  411  VPKEAQSKAVEFNFNGTPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  470

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  471  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  530

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  531  NDLVASAVLSGNR  543



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   332 bits (852),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYN+ Q ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFA
Sbjct  443  VDYNQVQAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFA  502

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  503  VPKESQGKVADFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  562

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GF+IVGYGCTTCIGNSGDLDESV++AIS+
Sbjct  563  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFNIVGYGCTTCIGNSGDLDESVAAAISE  622

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  623  NDVVAAAVLSGNR  635



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   330 bits (846),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  12   NEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK  191
            + PQ ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PK
Sbjct  332  DTPQSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPK  391

Query  192  EAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPW  371
            E Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW
Sbjct  392  EYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPW  451

Query  372  VKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDI  551
            +KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDI
Sbjct  452  IKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDI  511

Query  552  VAAAVLSGNR  581
            VAAAVLSGNR
Sbjct  512  VAAAVLSGNR  521



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   325 bits (833),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+++   ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFA
Sbjct  135  VDHSQVDAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFA  194

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  195  VPKESQGKVAEFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  254

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++
Sbjct  255  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITE  314

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  315  NDIVAAAVLSGNR  327



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   327 bits (839),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EPQ ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA
Sbjct  214  VDYSEPQVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFA  273

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVA+F+FHG PA+L+HG VVIAAITSCTNTS+ SVMLGAALVAKKA ELGL V
Sbjct  274  IPKEAQVKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSS-SVMLGAALVAKKACELGLEV  332

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KT L    GVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI+ 
Sbjct  333  KPWIKTVLLQALGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITG  392

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  393  NDIVAAAVLSGNR  405



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   328 bits (840),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP QER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFA
Sbjct  245  VDYNEPPQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFA  304

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ V
Sbjct  305  VPKEKQEEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEV  364

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI  
Sbjct  365  KPWVKTSLAPGSRVVEKYLDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEG  424

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  425  TDIIPAAVLSGNR  437



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   332 bits (850),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNE Q ERVYSS L+LDL DVEPC+SGPKRPHDRV LK+MK+DW +CL NKVGFKGF 
Sbjct  425  VDYNETQTERVYSSYLELDLADVEPCVSGPKRPHDRVALKDMKADWRACLRNKVGFKGFG  484

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q+K+ KF+FHGQPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  485  IPKEQQDKLVKFTFHGQPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  544

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
             PW+KTSLAPGSG VTKYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++D
Sbjct  545  NPWIKTSLAPGSGAVTKYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTD  604

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  605  NDIIAAAVLSGNR  617



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   332 bits (850),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNE Q ERVYSS L+LDL DVEPC+SGPKRPHD V LK+MKSDWHSCL NKVGFKGF 
Sbjct  427  VDYNETQTERVYSSYLELDLADVEPCVSGPKRPHDHVALKDMKSDWHSCLGNKVGFKGFG  486

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE  +K  KF+FHGQPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V
Sbjct  487  VPKEQHDKFVKFTFHGQPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEV  546

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
             PW+KTSLAPGSG VTKYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++D
Sbjct  547  NPWIKTSLAPGSGAVTKYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTD  606

Query  543  NDIVAAAVLSGNR  581
            NDI+AAAVLSGNR
Sbjct  607  NDIIAAAVLSGNR  619



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFA
Sbjct  448  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFA  507

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ V
Sbjct  508  VPKEKQEEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEV  567

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI  
Sbjct  568  KPWVKTSLAPGSRVVEKYLDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEG  627

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  628  TDIIPAAVLSGNR  640



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFA
Sbjct  447  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFA  506

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ V
Sbjct  507  VPKEKQEEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEV  566

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI  
Sbjct  567  KPWVKTSLAPGSRVVEKYLDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEG  626

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  627  TDIIPAAVLSGNR  639



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  348  VDYSEPESKTVYSSCLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  407

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  408  VPKEAQSKAVEFNFNGTTAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  467

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  468  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  527

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  528  NDLVASAVLSGNR  540



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+EP+ + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFA
Sbjct  370  VDYSEPESKTVYSSCLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFA  429

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKEAQ K  +F+F+G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL V
Sbjct  430  VPKEAQSKAVEFNFNGTTAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEV  489

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI D
Sbjct  490  KPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVD  549

Query  543  NDIVAAAVLSGNR  581
            ND+VA+AVLSGNR
Sbjct  550  NDLVASAVLSGNR  562



>ref|XP_008355339.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase, cytoplasmic-like 
[Malus domestica]
Length=531

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP+QER Y+S LQLDL DVEPC+S  KRPHDRVPLK++K+DWH+CLD KVGFKGFA
Sbjct  60   VDYNEPRQERAYTSYLQLDLADVEPCVSXXKRPHDRVPLKDVKADWHACLDKKVGFKGFA  119

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KFSFHGQPAEL+HGS VIAAITSCT TSNP+VM+GA LVAKKASELGL V
Sbjct  120  VPKEEQGKVEKFSFHGQPAELRHGSFVIAAITSCTITSNPTVMVGAGLVAKKASELGLEV  179

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            +PW+KTSLAPGS VVT+YLLQSGL +YLNQ GF++VGYGCTTCIGN G+LDESV+SAIS+
Sbjct  180  QPWIKTSLAPGSRVVTEYLLQSGLLKYLNQLGFNVVGYGCTTCIGNLGELDESVASAISE  239

Query  543  NDIVA  557
            NDIVA
Sbjct  240  NDIVA  244



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   329 bits (843),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 176/193 (91%), Gaps = 2/193 (1%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY+E   ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA
Sbjct  348  VDYSE--SERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFA  405

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  406  IPKEYQSKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  465

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++
Sbjct  466  KPWIKTSLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITE  525

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  526  NDIVAAAVLSGNR  538



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   330 bits (847),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL V
Sbjct  505  VPKEKQGEVVKFSYEGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEG  624

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  625  TDIIPAAVLSGNR  637



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   330 bits (847),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL V
Sbjct  505  VPKEKQEEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEG  624

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  625  TDIIPAAVLSGNR  637



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   330 bits (847),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL V
Sbjct  505  VPKEKQEEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEG  624

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  625  TDIIPAAVLSGNR  637



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   330 bits (846),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL V
Sbjct  505  VPKEKQGEVVKFSYDGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEG  624

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  625  TDIIPAAVLSGNR  637



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   330 bits (845),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDY + Q ERVYSS L+LDL +V PCLSGPKRPHDRV LK MKSDW SCLDNKVGFKGFA
Sbjct  448  VDYKQVQAERVYSSYLELDLDEVGPCLSGPKRPHDRVTLKNMKSDWLSCLDNKVGFKGFA  507

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSF G PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA +LGL V
Sbjct  508  VPKESQGKVAEFSFRGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACDLGLEV  567

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDESV++AI+D
Sbjct  568  KPWIKTSLAPGSGVVKKYLDKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDESVAAAITD  627

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  628  NDVVAAAVLSGNR  640



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD +EP+ ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+A
Sbjct  13   VDKHEPETERVFSSYLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYA  72

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL V
Sbjct  73   VPKEQQGKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEV  132

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++
Sbjct  133  KPWVKTSLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITE  192

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLS NR
Sbjct  193  NDIVAAAVLSANR  205



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL V
Sbjct  505  VPKEKQGEVVKFSYDGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEG  624

Query  543  NDIVAAAVLSGNR  581
             +I+ AAVLSGNR
Sbjct  625  TEIIPAAVLSGNR  637



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   326 bits (835),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DYNEP+ E+VYSS L+LDL  V+PC+SGPKRPHDRV LK+MK DWH+CLD+KVGFKGF 
Sbjct  356  IDYNEPETEKVYSSYLELDLDSVQPCVSGPKRPHDRVNLKDMKEDWHNCLDSKVGFKGFG  415

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q  +AKF F G+PAEL+HG VVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL V
Sbjct  416  VPKDEQSAIAKFKFEGKPAELRHGDVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLQV  475

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL QSGL EYL++QGF +VGYGCTTCIGNSG++ E V+SAI+D
Sbjct  476  KPWIKTSLAPGSGVVTKYLKQSGLTEYLDKQGFSLVGYGCTTCIGNSGEIHEDVASAIAD  535

Query  543  NDIVAAAVLSGNR  581
            ND++AAAVLSGNR
Sbjct  536  NDMIAAAVLSGNR  548



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   327 bits (839),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DY EPQQER Y+S LQLDL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFA
Sbjct  449  IDYKEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVALKDMKADWHACLDNPVGFKGFA  508

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+  KFSF GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL V
Sbjct  509  VPKEKQEEFVKFSFKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLEV  568

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+EYL +QGF IVGYGCTTCIGNSGDL++SV++AI  
Sbjct  569  KPWVKTSLAPGSRVVEKYLDRSGLREYLTKQGFEIVGYGCTTCIGNSGDLEKSVAAAIEG  628

Query  543  NDIVAAAVLSGNR  581
            +DI+ AAVLSGNR
Sbjct  629  SDIIPAAVLSGNR  641



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   327 bits (837),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 172/195 (88%), Gaps = 2/195 (1%)
 Frame = +3

Query  3    VDYNE--PQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKG  176
            VDYNE   Q ERVYSS L+LDL DVEPC+SGPKRPHD V LK+MKSDWHSCL NKVGFKG
Sbjct  427  VDYNEFQTQTERVYSSYLELDLADVEPCVSGPKRPHDHVALKDMKSDWHSCLGNKVGFKG  486

Query  177  FAVPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL  356
            F VPKE  +K  KF+FHGQPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL
Sbjct  487  FGVPKEQHDKFVKFTFHGQPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGL  546

Query  357  HVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAI  536
             V PW+KTSLAPGSG VTKYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A+
Sbjct  547  EVNPWIKTSLAPGSGAVTKYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAV  606

Query  537  SDNDIVAAAVLSGNR  581
            +DNDI+AAAVLSGNR
Sbjct  607  TDNDIIAAAVLSGNR  621



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 173/193 (90%), Gaps = 2/193 (1%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNE     ++   L +     +P +SGPKRPHDRVPLK+MK DWH+CLDNKVGFKGFA
Sbjct  446  VDYNEVGAAALFF--LPIFKYQNQPXMSGPKRPHDRVPLKDMKVDWHACLDNKVGFKGFA  503

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKE Q+KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL V
Sbjct  504  IPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQV  563

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYLL+SGLQ+Y +QQGF IVGYGCTTCIGNSGDLDE+V+SAIS+
Sbjct  564  KPWVKTSLAPGSGVVTKYLLKSGLQKYFDQQGFQIVGYGCTTCIGNSGDLDETVASAISE  623

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLSGNR
Sbjct  624  NDIVAAAVLSGNR  636



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFA
Sbjct  445  VDYNEPQPERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFA  504

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE QE+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LG+ V
Sbjct  505  VPKEKQEEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALDLGVEV  564

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDL+  V+SAI  
Sbjct  565  KPWVKTSLAPGSRVVEKYLDRSGLRECLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEG  624

Query  543  NDIVAAAVLSGNR  581
             DI+ AAVLSGNR
Sbjct  625  TDIIPAAVLSGNR  637



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+++ + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFA
Sbjct  135  VDHSQAEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFA  194

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F FHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  195  VPKESQGKVAEFLFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  254

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV +YL +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDESVS+AI++
Sbjct  255  KPWIKTSLAPGSGVVKQYLDKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDESVSAAITE  314

Query  543  NDIVAAAVLSGNR  581
            NDIV+AAVLSGNR
Sbjct  315  NDIVSAAVLSGNR  327



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +DY+EP+ E+VYSS L+LDL  V+PC+SGPKRPHDRV LK+MK DWH+CLD+KVGFKGF 
Sbjct  356  IDYDEPETEKVYSSYLELDLDSVQPCVSGPKRPHDRVNLKDMKEDWHNCLDSKVGFKGFG  415

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPK+ Q  +AKF F G+PAEL+HG VVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL V
Sbjct  416  VPKDEQSAIAKFKFEGKPAELRHGDVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLQV  475

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVVTKYL QSGL EYL++QGF +VGYGCTTCIGNSG++ E V+SAI+D
Sbjct  476  KPWIKTSLAPGSGVVTKYLKQSGLTEYLDKQGFSLVGYGCTTCIGNSGEIHEDVASAIAD  535

Query  543  NDIVAAAVLSGNR  581
            ND++AAAVLSGNR
Sbjct  536  NDMIAAAVLSGNR  548



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEP+ E VYS SL+L L DVEPC+SGPKRPHDRVPL++MK+DW +CL+N++GFKGFA
Sbjct  350  VDYNEPRDEIVYSCSLELKLEDVEPCISGPKRPHDRVPLRDMKADWGTCLNNRLGFKGFA  409

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KV  F F G  A+L+HG+VVIAAITSCTNTSNPSV+LGAALVAKKA ELGL V
Sbjct  410  IPKEAQNKVVNFVFRGTRAQLRHGAVVIAAITSCTNTSNPSVVLGAALVAKKAYELGLEV  469

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGL++YLNQ GFHIV YGCTTCIGNSGD+DESV+SAI++
Sbjct  470  KPWIKTSLAPGSGVVAKYLQKSGLEKYLNQLGFHIVAYGCTTCIGNSGDIDESVASAIAE  529

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  530  NDLVAAAVLSGNR  542



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   332 bits (852),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3     VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
             VDY + Q ERVYSS L+LDL +VEPCLSGPKRPHDRV LK MKSDW SCLDNKVGFKGFA
Sbjct  1416  VDYKQVQAERVYSSYLELDLDEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNKVGFKGFA  1475

Query  183   VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
             VPKE+Q KVA+FSF G PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA +LGL V
Sbjct  1476  VPKESQGKVAEFSFRGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACDLGLEV  1535

Query  363   KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
             KPW+KTSLAPGSGVV KYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDESV++AI+D
Sbjct  1536  KPWIKTSLAPGSGVVKKYLDKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDESVAAAITD  1595

Query  543   NDIVAAAVLSGNR  581
             ND+VAAAVLSGNR
Sbjct  1596  NDVVAAAVLSGNR  1608



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+++ + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFA
Sbjct  441  VDHSQVEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFA  500

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  501  VPKESQGKVAEFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  560

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++
Sbjct  561  KPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITE  620

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  621  NDVVAAAVLSGNR  633



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   325 bits (832),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQER Y+S LQLDL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFA
Sbjct  448  VDYNEPQQERAYTSYLQLDLGHVEPCISGPKRPHDRVLLKDMKADWHACLDNPVGFKGFA  507

Query  183  VPKEAQEKVAKFSFHGQ-PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLH  359
            +PKE QE   KF F  + PAELK+GSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL 
Sbjct  508  IPKEKQEDTVKFLFEEKIPAELKNGSVVIAAITSCTNTSNPSVMLGAALVAKKAYDLGLM  567

Query  360  VKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAIS  539
            VKPWVKTSLAPGSGVVTKYL QSGLQEYL++QGF IVGYGCTTCIGNSG+L +SV SAI 
Sbjct  568  VKPWVKTSLAPGSGVVTKYLDQSGLQEYLDKQGFQIVGYGCTTCIGNSGNLKKSVESAIK  627

Query  540  DNDIVAAAVLSGNR  581
            +ND+V A+VLSGNR
Sbjct  628  NNDVVVASVLSGNR  641



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   322 bits (826),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 174/197 (88%), Gaps = 4/197 (2%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRP----HDRVPLKEMKSDWHSCLDNKVGF  170
            VDYNEPQ ERVYSS L+L+L +VEPC+SGPKRP    HDRV LKEMK DWH+CLDN+VGF
Sbjct  348  VDYNEPQVERVYSSYLELNLNEVEPCISGPKRPTTRPHDRVTLKEMKVDWHACLDNRVGF  407

Query  171  KGFAVPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASEL  350
            KGFAVPKE+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA EL
Sbjct  408  KGFAVPKESQNKVVEFAFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACEL  467

Query  351  GLHVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSS  530
            GL VKPW+KT L    GVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+D++V+S
Sbjct  468  GLEVKPWIKTVLLRVLGVVTKYLQKSGLQQYLNQLGFIIVGYGCTTCIGNSGDIDDAVAS  527

Query  531  AISDNDIVAAAVLSGNR  581
            AI++NDIVAAAVLSGNR
Sbjct  528  AITENDIVAAAVLSGNR  544



>gb|KEH38306.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=865

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 171/193 (89%), Gaps = 6/193 (3%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQQ+  YSS L+L+L +V         PHDRVPLKEMKSDWHSCLDNKVGFKGFA
Sbjct  445  VDYNEPQQDIAYSSYLELNLDEVRTI------PHDRVPLKEMKSDWHSCLDNKVGFKGFA  498

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PKEAQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL V
Sbjct  499  IPKEAQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLKV  558

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLA GSGVVTKYLLQSGLQ+YLN+QGF+ V +GCTTCIGNSGDLDESV+SAIS+
Sbjct  559  KPWVKTSLALGSGVVTKYLLQSGLQKYLNEQGFNFVRFGCTTCIGNSGDLDESVASAISE  618

Query  543  NDIVAAAVLSGNR  581
            NDIVA+AVLS NR
Sbjct  619  NDIVASAVLSRNR  631



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            +D+ +P+++  YS+ L+LDL  VEPC+SGPKRPHDRV +K+MK DW SCLDNKVGFKGFA
Sbjct  347  IDHEKPRKDNTYSAYLELDLDTVEPCISGPKRPHDRVAIKDMKQDWQSCLDNKVGFKGFA  406

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            +PK+ QEKVAKF++ G+PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL V
Sbjct  407  IPKDQQEKVAKFTYEGKPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLEV  466

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSLAPGSGVVTKYL +SGL +YL++QGF +VGYGCTTCIGNSGD+ E+V+ AI+ 
Sbjct  467  KPWVKTSLAPGSGVVTKYLEKSGLNKYLDKQGFSLVGYGCTTCIGNSGDVHEAVAEAIAA  526

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLSGNR
Sbjct  527  NDMVAAAVLSGNR  539



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD +EP+ ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+A
Sbjct  353  VDKHEPETERVFSSYLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYA  412

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL V
Sbjct  413  VPKEQQGKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEV  472

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++
Sbjct  473  KPWVKTSLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITE  532

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLS NR
Sbjct  533  NDIVAAAVLSANR  545



>gb|AFA36529.1| aconitate hydratase 2, partial [Lolium perenne]
Length=306

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VDYNEPQ ERVYSS L+LDL +VEPC+SGPKRPHDRV LKEMKSDWH+CLDNKVGFKGFA
Sbjct  147  VDYNEPQIERVYSSYLELDLNEVEPCISGPKRPHDRVTLKEMKSDWHACLDNKVGFKGFA  206

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q+KV KF FHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL V
Sbjct  207  VPKEQQDKVVKFDFHGQTAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEV  266

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGC  482
            KPWVKTSLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGC
Sbjct  267  KPWVKTSLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGC  306



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   319 bits (818),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD+++ + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFA
Sbjct  439  VDHSQAEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFA  498

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE+Q KVA+F FHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL V
Sbjct  499  VPKESQGKVAEFLFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEV  558

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPW+KTSLAPGSGVV +YL +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDESVS+AI++
Sbjct  559  KPWIKTSLAPGSGVVKQYLDKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDESVSAAITE  618

Query  543  NDIVAAAVLSGNR  581
            NDIV+AAVLSGNR
Sbjct  619  NDIVSAAVLSGNR  631



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   318 bits (814),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD +EP+ ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+A
Sbjct  352  VDKHEPETERVFSSHLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYA  411

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL V
Sbjct  412  VPKEQQGKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEV  471

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++
Sbjct  472  KPWVKTSLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITE  531

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLS NR
Sbjct  532  NDMVAAAVLSANR  544



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score =   318 bits (814),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD +EP+ ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+A
Sbjct  413  VDKHEPETERVFSSHLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYA  472

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL V
Sbjct  473  VPKEQQGKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEV  532

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++
Sbjct  533  KPWVKTSLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITE  592

Query  543  NDIVAAAVLSGNR  581
            ND+VAAAVLS NR
Sbjct  593  NDMVAAAVLSANR  605



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score =   318 bits (815),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    VDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA  182
            VD +EP+ ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+A
Sbjct  423  VDKHEPETERVFSSYLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYA  482

Query  183  VPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHV  362
            VPKE Q KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL V
Sbjct  483  VPKEQQGKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEV  542

Query  363  KPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISD  542
            KPWVKTSL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++
Sbjct  543  KPWVKTSLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITE  602

Query  543  NDIVAAAVLSGNR  581
            NDIVAAAVLS NR
Sbjct  603  NDIVAAAVLSANR  615



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455