BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018E03

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIA61608.1|  catalase                                                358   9e-119   Gynostemma pentaphyllum [jiaogulan]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             355   9e-119   
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 357   1e-118   Cucumis melo [Oriental melon]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             356   2e-118   
ref|NP_001237556.1|  catalase-1/2                                       357   3e-118   Glycine max [soybeans]
ref|NP_001235974.1|  catalase-3                                         357   3e-118   Glycine max [soybeans]
ref|XP_002521709.1|  catalase, putative                                 356   3e-118   Ricinus communis
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             356   3e-118   Populus trichocarpa [western balsam poplar]
gb|KHG25152.1|  Catalase isozyme 1                                      356   3e-118   Gossypium arboreum [tree cotton]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             356   4e-118   Phaseolus vulgaris [French bean]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             356   6e-118   
gb|KJB14250.1|  hypothetical protein B456_002G115900                    355   7e-118   Gossypium raimondii
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      355   7e-118   Fragaria vesca subsp. vesca
gb|ACJ11733.1|  catalase                                                355   8e-118   Gossypium hirsutum [American cotton]
gb|ACJ71244.1|  catalase 2                                              352   1e-117   Vigna unguiculata
gb|ACJ71245.1|  catalase 2                                              351   1e-117   Vigna unguiculata
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         355   1e-117   Tarenaya hassleriana [spider flower]
gb|KEH36313.1|  catalase heme-binding enzyme                            352   2e-117   Medicago truncatula
gb|AAR84577.1|  catalase 1b                                             352   2e-117   Lotus japonicus
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          354   3e-117   Amborella trichopoda
ref|XP_010530333.1|  PREDICTED: catalase-2                              354   3e-117   Tarenaya hassleriana [spider flower]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      354   3e-117   Nicotiana tomentosiformis
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              353   3e-117   Cicer arietinum [garbanzo]
gb|AAR84578.1|  catalase 1a                                             353   3e-117   Lotus japonicus
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      353   3e-117   Nicotiana sylvestris
ref|XP_007018034.1|  Catalase 2                                         353   4e-117   
gb|AAX88799.1|  catalase                                                353   4e-117   Euphorbia characias
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               353   4e-117   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDX72514.1|  BnaC07g45360D                                          353   5e-117   
gb|AAC19397.1|  leaf catalase                                           353   6e-117   Mesembryanthemum crystallinum
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              353   6e-117   Populus euphratica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         353   6e-117   Tarenaya hassleriana [spider flower]
ref|NP_001291326.1|  catalase isozyme 1                                 353   8e-117   Sesamum indicum [beniseed]
gb|KFK30147.1|  catalase                                                353   8e-117   Arabis alpina [alpine rockcress]
ref|XP_009138342.1|  PREDICTED: catalase-2                              352   1e-116   Brassica rapa
gb|AAF71742.1|AF248491_1  catalase                                      352   1e-116   Raphanus sativus
gb|KJB57963.1|  hypothetical protein B456_009G187600                    352   1e-116   Gossypium raimondii
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             353   1e-116   Eutrema salsugineum [saltwater cress]
emb|CAA64220.1|  catalase                                               352   1e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AAD17935.1|  catalase                                                352   1e-116   Brassica juncea [brown mustard]
gb|AAK96854.1|  catalase                                                352   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             352   1e-116   Eutrema salsugineum [saltwater cress]
gb|KEH36312.1|  catalase heme-binding enzyme                            352   1e-116   Medicago truncatula
ref|NP_001237571.1|  catalase-4                                         352   1e-116   Glycine max [soybeans]
dbj|BAJ33995.1|  unnamed protein product                                352   1e-116   Eutrema halophilum
ref|NP_001031791.1|  catalase 2                                         352   1e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AFN81243.1|  catalase 1                                              352   1e-116   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             352   1e-116   
ref|NP_195235.1|  catalase 2                                            352   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      352   1e-116   Nicotiana sylvestris
dbj|BAH19523.1|  AT4G35090                                              352   1e-116   Arabidopsis thaliana [mouse-ear cress]
gb|ACL27272.1|  catalase                                                352   1e-116   Nicotiana benthamiana
gb|AAD17933.1|  catalase                                                352   1e-116   Brassica juncea [brown mustard]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      352   1e-116   Solanum tuberosum [potatoes]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      350   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      352   2e-116   
gb|AET97564.1|  catalase                                                352   2e-116   Ziziphus jujuba [Chinese jujube]
gb|ABF93811.1|  Catalase-1, putative, expressed                         348   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      352   2e-116   Vitis vinifera
emb|CCP37650.1|  catalase-1                                             352   2e-116   Nicotiana tabacum [American tobacco]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         352   2e-116   Jatropha curcas
gb|AAB71764.1|  catalase 1                                              352   2e-116   Nicotiana tabacum [American tobacco]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      351   3e-116   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         351   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              351   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         351   3e-116   Camelina sativa [gold-of-pleasure]
ref|NP_001289779.1|  catalase isozyme 1                                 351   3e-116   Nelumbo nucifera [Indian lotus]
ref|NP_001240021.1|  catalase                                           351   3e-116   Glycine max [soybeans]
gb|ADC95629.1|  catalase                                                351   4e-116   Bruguiera gymnorhiza [Burma mangrove]
gb|ABK24453.1|  unknown                                                 351   4e-116   Picea sitchensis
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      351   4e-116   Nelumbo nucifera [Indian lotus]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 351   4e-116   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY01363.1|  BnaA07g11360D                                          351   5e-116   
ref|XP_009103333.1|  PREDICTED: catalase-1                              351   5e-116   Brassica rapa
ref|XP_007046520.1|  Catalase 2                                         350   5e-116   Theobroma cacao [chocolate]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          350   5e-116   Soldanella alpina
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           350   5e-116   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           350   5e-116   Sesamum indicum [beniseed]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               350   6e-116   Gossypium hirsutum [American cotton]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      350   7e-116   Cucumis melo [Oriental melon]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             350   7e-116   Eutrema salsugineum [saltwater cress]
ref|XP_010094556.1|  Catalase isozyme 1                                 350   8e-116   Morus notabilis
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       350   8e-116   Cucumis sativus [cucumbers]
emb|CDY31877.1|  BnaC07g15270D                                          350   8e-116   Brassica napus [oilseed rape]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                350   8e-116   Erythranthe guttata [common monkey flower]
gb|ACA50528.1|  putative catalase 2                                     350   9e-116   Brassica napus [oilseed rape]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             350   1e-115   Capsella rubella
gb|AFU48609.1|  catalase 1                                              350   1e-115   Nicotiana benthamiana
gb|ADZ45555.1|  catalase                                                350   1e-115   Vigna radiata [mung bean]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    350   1e-115   Arabis alpina [alpine rockcress]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          350   1e-115   Vigna radiata var. radiata [golden gram]
gb|KJB17474.1|  hypothetical protein B456_003G002800                    348   1e-115   Gossypium raimondii
gb|KJB17473.1|  hypothetical protein B456_003G002800                    350   1e-115   Gossypium raimondii
gb|AJE26131.1|  catalase                                                349   1e-115   Salix matsudana [tortured willow]
gb|ADZ45556.1|  catalase                                                349   1e-115   Vigna radiata [mung bean]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      349   1e-115   
gb|ACV92695.1|  catalase                                                349   2e-115   Brassica oleracea
gb|AAD17936.1|  catalase                                                349   2e-115   Brassica juncea [brown mustard]
gb|KHG12976.1|  Catalase isozyme 2                                      349   2e-115   Gossypium arboreum [tree cotton]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               349   2e-115   Gossypium hirsutum [American cotton]
emb|CDP01803.1|  unnamed protein product                                349   2e-115   Coffea canephora [robusta coffee]
gb|EPS69543.1|  catalase                                                349   2e-115   Genlisea aurea
ref|XP_002301920.1|  catalase family protein                            349   2e-115   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               349   3e-115   Populus deltoides
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              348   3e-115   
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 349   3e-115   Populus euphratica
gb|AGV54297.1|  peroxisomal catalase                                    348   3e-115   Phaseolus vulgaris [French bean]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      348   3e-115   Nicotiana tomentosiformis
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             348   3e-115   Phaseolus vulgaris [French bean]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              349   3e-115   Brassica rapa
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      348   4e-115   Populus euphratica
tpg|DAA43177.1|  TPA: catalase2                                         348   4e-115   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             348   4e-115   Selaginella moellendorffii
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 348   4e-115   Solanum tuberosum [potatoes]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             348   4e-115   Prunus persica
emb|CAD42908.1|  catalase                                               348   4e-115   Prunus persica
ref|XP_002306976.2|  catalase family protein                            348   4e-115   
gb|ACB11496.1|  catalase                                                348   5e-115   Pinus sylvestris [Scotch pine]
ref|NP_001234186.1|  catalase isozyme 2                                 348   5e-115   
gb|ADU56199.1|  catalase                                                348   5e-115   Hevea brasiliensis [jebe]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              348   5e-115   
dbj|BAH37035.1|  catalase 1                                             348   6e-115   Pisum sativum [garden pea]
gb|ABY21704.1|  catalase-1 precursor                                    348   6e-115   Panax ginseng [Asiatic ginseng]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      348   7e-115   Solanum lycopersicum
gb|AFD29285.1|  catalase                                                348   7e-115   Vicia faba [broad bean]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      348   8e-115   Prunus mume [ume]
emb|CDX69111.1|  BnaC01g03420D                                          347   8e-115   
tpg|DAA43178.1|  TPA: catalase2                                         349   8e-115   
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      347   8e-115   Elaeis guineensis
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      347   8e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACL35349.1|  catalase                                                347   9e-115   Picea glauca
ref|NP_001048861.1|  Os03g0131200                                       347   1e-114   
gb|AFU90823.1|  catalase                                                346   1e-114   Populus x beijingensis
gb|AAF19965.1|AF207906_1  catalase 1                                    347   1e-114   Zantedeschia aethiopica [arum-lily]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 347   1e-114   Phoenix dactylifera
prf||1906388A  catalase                                                 347   1e-114
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               347   1e-114   Ricinus communis
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      347   1e-114   Phoenix dactylifera
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                347   2e-114   Erythranthe guttata [common monkey flower]
gb|AAM97542.1|  catalase 3                                              347   2e-114   Capsicum annuum
gb|AFU90822.1|  catalase                                                347   2e-114   Populus tomentosa [Chinese white poplar]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         347   2e-114   Oryza brachyantha
ref|XP_009106100.1|  PREDICTED: catalase-2                              347   2e-114   Brassica rapa
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    346   2e-114   
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      346   3e-114   Elaeis guineensis
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             346   3e-114   
gb|AAB86582.2|  catalase                                                346   4e-114   Raphanus sativus
dbj|BAA34714.1|  catalase                                               346   4e-114   Oryza sativa [red rice]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     345   4e-114   Eucalyptus grandis [rose gum]
ref|XP_010692546.1|  PREDICTED: catalase                                345   4e-114   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP07287.1|  unnamed protein product                                345   5e-114   Coffea canephora [robusta coffee]
gb|AAK67359.2|AF390210_1  catalase                                      345   5e-114   Suaeda salsa
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      345   6e-114   Phoenix dactylifera
gb|ACH63223.1|  catalase                                                345   6e-114   Rheum australe [Himalayan rhubarb]
gb|AIP93616.1|  CAT1                                                    345   7e-114   Bassia scoparia [burning bush]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      345   8e-114   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             345   8e-114   Citrus clementina [clementine]
gb|AIS20825.1|  CAT                                                     345   9e-114   Pyrus x bretschneideri [bai li]
gb|AHB72694.1|  catalase                                                345   9e-114   Beta vulgaris subsp. maritima [sea beet]
dbj|BAJ90861.1|  predicted protein                                      345   9e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC17731.1|  catalase 1                                              345   9e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            345   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CAA45564.1|  catalase                                               345   1e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAO17721.1|  catalase                                                345   1e-113   Hypericum perforatum
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          345   1e-113   Helianthus annuus
dbj|BAA34205.1|  catalase                                               344   2e-113   Oryza sativa Japonica Group [Japonica rice]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            344   2e-113   Pisum sativum [garden pea]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       341   3e-113   Cucumis sativus [cucumbers]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              343   4e-113   
gb|AGI65617.1|  catalase                                                342   4e-113   Fragaria x ananassa
emb|CDX76313.1|  BnaA08g10870D                                          343   4e-113   
ref|XP_010061175.1|  PREDICTED: catalase-like                           343   5e-113   Eucalyptus grandis [rose gum]
emb|CDY17510.1|  BnaC03g65530D                                          342   5e-113   Brassica napus [oilseed rape]
gb|AAB07026.1|  catalase 1                                              343   5e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         343   6e-113   Camelina sativa [gold-of-pleasure]
gb|AAB62892.1|  catalase-1                                              343   6e-113   Nicotiana glutinosa
prf||2104177A  catalase                                                 343   6e-113
ref|XP_010477308.1|  PREDICTED: catalase-1                              343   6e-113   Camelina sativa [gold-of-pleasure]
gb|AIZ77475.1|  catalase                                                342   7e-113   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         342   8e-113   Setaria italica
ref|XP_003558892.1|  PREDICTED: catalase-1                              342   1e-112   Brachypodium distachyon [annual false brome]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              342   1e-112   Populus euphratica
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 342   1e-112   Elaeis guineensis
gb|AGE15298.2|  catalase 1                                              342   2e-112   Eriobotrya japonica [loquat]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       342   2e-112   Triticum aestivum [Canadian hard winter wheat]
gb|AGC65520.1|  catalase                                                341   2e-112   Eriobotrya japonica [loquat]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               341   3e-112   Zea mays [maize]
gb|AAF61732.1|AF243517_1  catalase 2                                    341   3e-112   Helianthus annuus
emb|CDY52649.1|  BnaAnng11640D                                          339   4e-112   Brassica napus [oilseed rape]
prf||1803522A  catalase                                                 340   4e-112
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 340   4e-112   Nicotiana sylvestris
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 340   5e-112   Nicotiana tomentosiformis
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     343   7e-112   Eucalyptus grandis [rose gum]
ref|XP_001752315.1|  predicted protein                                  340   7e-112   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         340   7e-112   Camelina sativa [gold-of-pleasure]
gb|AHA50082.1|  catalase                                                340   8e-112   Eleutherococcus senticosus
emb|CAG23920.1|  catalase                                               340   8e-112   Festuca arundinacea [tall fescue]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               339   1e-111   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAC84138.1|  catalase                                                328   2e-111   Cichorium intybus [radicchio]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               338   3e-111   Cucurbita pepo
ref|XP_001784759.1|  predicted protein                                  338   3e-111   
gb|ABM47415.1|  catalase                                                338   4e-111   Prunus avium [gean]
gb|AAM97541.1|  catalase 2                                              338   5e-111   Capsicum annuum
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 350   6e-111   
ref|NP_001105310.1|  catalase isozyme 2                                 337   8e-111   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          336   2e-110   
gb|AAG43363.1|AF151368_1  catalase                                      336   3e-110   Hevea brasiliensis [jebe]
gb|AIU99488.1|  catalase                                                336   3e-110   Saccharum hybrid cultivar ROC22
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               336   3e-110   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 335   4e-110   Zea mays [maize]
ref|NP_001105415.1|  catalase isozyme 1                                 335   4e-110   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 335   5e-110   Oryza brachyantha
gb|AIM43584.1|  catalase                                                335   5e-110   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99486.1|  catalase                                                335   6e-110   Saccharum spontaneum [fodder cane]
gb|AIU99480.1|  catalase                                                335   8e-110   Saccharum spontaneum [fodder cane]
gb|AIU99481.1|  catalase                                                334   1e-109   Saccharum spontaneum [fodder cane]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      335   1e-109   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    334   1e-109   Oryza sativa Indica Group [Indian rice]
emb|CDY29518.1|  BnaA06g14520D                                          334   1e-109   Brassica napus [oilseed rape]
ref|NP_001058635.1|  Os06g0727200                                       334   1e-109   
gb|AIU99479.1|  catalase                                                334   1e-109   Saccharum arundinaceum
emb|CDY31490.1|  BnaC05g15990D                                          334   1e-109   Brassica napus [oilseed rape]
ref|XP_009149540.1|  PREDICTED: catalase-1                              334   1e-109   Brassica rapa
emb|CAA42720.1|  catalase-1                                             334   1e-109   Zea mays [maize]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 334   2e-109   Eucalyptus grandis [rose gum]
gb|AIU99487.1|  catalase                                                334   2e-109   Saccharum hybrid cultivar ROC22
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 336   2e-109   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             334   2e-109   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 332   2e-109   
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 333   2e-109   Vitis vinifera
dbj|BAJ88747.1|  predicted protein                                      335   3e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001268098.1|  catalase                                           333   3e-109   Vitis vinifera
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 332   3e-109   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 333   3e-109   Prunus mume [ume]
gb|AIX10947.1|  putative catalase                                       333   4e-109   Gardenia jasminoides
emb|CAD42909.1|  catalase                                               333   4e-109   Prunus persica
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             333   4e-109   Prunus persica
gb|AAB70006.1|  catalase                                                333   4e-109   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                                333   5e-109   Chlamydomonas reinhardtii
dbj|BAA34204.1|  catalase                                               333   5e-109   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99483.1|  catalase                                                332   1e-108   Saccharum hybrid cultivar ROC22
gb|AAY59707.1|  catalase                                                332   1e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          331   2e-108   Amborella trichopoda
ref|XP_002950455.1|  catalase                                           332   2e-108   Volvox carteri f. nagariensis
emb|CDY40645.1|  BnaA03g53180D                                          331   2e-108   Brassica napus [oilseed rape]
emb|CDP07288.1|  unnamed protein product                                331   2e-108   Coffea canephora [robusta coffee]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     328   2e-108   Eucalyptus grandis [rose gum]
gb|AIU99484.1|  catalase                                                331   2e-108   Saccharum arundinaceum
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      331   2e-108   Brachypodium distachyon [annual false brome]
gb|AIU99482.1|  catalase                                                331   2e-108   Saccharum hybrid cultivar ROC22
gb|AAF61734.1|AF243519_1  catalase 4                                    330   7e-108   Helianthus annuus
gb|AHF21552.1|  catalase                                                329   1e-107   Hylocereus undatus [dragon fruit]
dbj|BAA05494.1|  catalase                                               329   1e-107   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99485.1|  catalase                                                329   1e-107   Saccharum spontaneum [fodder cane]
gb|ABK41476.1|  catalase                                                329   1e-107   Haematococcus lacustris
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      329   2e-107   Eucalyptus grandis [rose gum]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               329   2e-107   Hordeum vulgare [barley]
emb|CAA73663.1|  catalase                                               328   2e-107   Chlamydomonas reinhardtii
gb|AAP80622.1|AF475100_1  catalase isozyme                              321   2e-107   Triticum aestivum [Canadian hard winter wheat]
emb|CAE82295.1|  catalase                                               328   3e-107   Homogyne alpina
dbj|BAC79443.1|  catalase                                               328   3e-107   Acacia ampliceps
gb|AAF61733.1|AF243518_1  catalase 3                                    328   4e-107   Helianthus annuus
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      328   5e-107   
gb|AII23739.1|  catalase                                                327   8e-107   Zostera marina
gb|ADB03784.1|  catalase                                                327   8e-107   Ipomoea batatas [batate]
gb|ACJ22771.1|  catalase 1                                              327   9e-107   Jatropha curcas
ref|XP_005645077.1|  catalase                                           327   1e-106   Coccomyxa subellipsoidea C-169
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         326   2e-106   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002510677.1|  catalase, putative                                 338   2e-106   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          326   3e-106   Ipomoea batatas [batate]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             325   3e-106   
ref|XP_011396830.1|  Catalase isozyme 2                                 325   4e-106   Auxenochlorella protothecoides
gb|ADN94253.1|  catalase                                                324   1e-105   Puccinellia chinampoensis
gb|EMS61345.1|  Catalase isozyme 1                                      328   1e-105   Triticum urartu
gb|AAR14052.2|  catalase                                                323   1e-105   Solanum tuberosum [potatoes]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 324   2e-105   Manihot esculenta [manioc]
gb|AAF79625.1|AC027665_26  F5M15.5                                      337   2e-105   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05040.1|  Catalase-1                                              323   5e-105   
ref|XP_002890395.1|  F5M15.5                                            335   6e-105   
gb|ACJ76836.3|  catalase                                                322   7e-105   
gb|ABK24543.1|  unknown                                                 320   4e-104   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      320   5e-104   
gb|ABV55108.1|  catalase 2                                              320   5e-104   
gb|ABK24449.1|  unknown                                                 319   1e-103   
gb|ACL81498.1|  catalase                                                318   2e-103   
gb|AAC19398.1|  root catalase                                           318   3e-103   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      317   6e-103   
dbj|BAQ21275.1|  catalase                                               316   8e-103   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 316   1e-102   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               316   2e-102   
gb|AFR53082.1|  CAT                                                     316   2e-102   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 315   2e-102   
gb|AHF27433.1|  catalase                                                316   2e-102   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             313   2e-102   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      315   3e-102   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      316   3e-102   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      315   3e-102   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             313   4e-102   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 315   4e-102   
gb|ABB51561.1|  truncated catalase 2                                    313   5e-102   
gb|ADM96039.1|  catalase                                                315   5e-102   
gb|ABB88582.1|  catalase                                                315   6e-102   
gb|AHF27430.1|  catalase                                                314   7e-102   
ref|NP_973873.1|  catalase 3                                            312   8e-102   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      314   1e-101   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         313   1e-101   
emb|CDY29519.1|  BnaA06g14510D                                          313   2e-101   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             313   2e-101   
gb|AAD30291.2|AF139538_1  catalase 2                                    313   2e-101   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             313   2e-101   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          313   2e-101   
gb|AAD30292.1|AF139539_1  catalase 3                                    313   3e-101   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               313   3e-101   
ref|NP_564120.1|  catalase 3                                            313   3e-101   
ref|XP_009149539.1|  PREDICTED: catalase-3                              314   3e-101   
gb|ADU56198.1|  catalase                                                313   3e-101   
ref|NP_001031073.1|  catalase 3                                         312   3e-101   
gb|AAM65021.1|  unknown                                                 313   4e-101   
ref|XP_009110221.1|  PREDICTED: catalase-3                              313   4e-101   
emb|CDY33636.1|  BnaC08g19360D                                          312   4e-101   
emb|CDY31878.1|  BnaC07g15280D                                          312   4e-101   
dbj|BAH56915.1|  AT1G20620                                              312   4e-101   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         312   4e-101   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    312   7e-101   
emb|CDY01364.1|  BnaA07g11370D                                          313   2e-100   
gb|KDD77132.1|  catalase                                                311   2e-100   
gb|ADQ28492.1|  catalase                                                311   2e-100   
gb|AEQ30070.1|  catalase                                                310   2e-100   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               310   4e-100   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               310   4e-100   
gb|AAG61140.2|AF332973_1  catalase 2                                    310   5e-100   
ref|XP_010692544.1|  PREDICTED: catalase-like                           308   2e-99    
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          307   4e-99    
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          307   5e-99 
gb|AGT16310.1|  catalase                                                307   6e-99    
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               307   6e-99    
ref|NP_001274863.1|  catalase isozyme 1                                 307   6e-99    
ref|NP_001234827.1|  catalase isozyme 1                                 307   6e-99    
ref|XP_010498496.1|  PREDICTED: catalase-3                              306   7e-99    
gb|AAC49807.1|  catalase 3                                              306   9e-99    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               306   9e-99    
gb|AFW66787.1|  catalase3                                               306   1e-98    
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      306   1e-98    
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      306   1e-98    
gb|ABC01913.1|  catalase isozyme 1-like protein                         306   2e-98    
gb|AHZ13843.1|  catalase                                                306   2e-98    
gb|AFW66788.1|  catalase3                                               305   2e-98    
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    305   2e-98    
emb|CBI29557.3|  unnamed protein product                                293   3e-98    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    305   3e-98    
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    305   3e-98    
gb|AAR97905.1|  catalase                                                305   3e-98    
ref|XP_001779509.1|  predicted protein                                  305   3e-98    
emb|CAA85470.1|  catalase                                               305   4e-98    
gb|AAC48918.1|  salicylic acid binding catalase                         304   7e-98    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      304   1e-97    
gb|ABN71233.2|  catalase                                                303   2e-97    
ref|NP_001045673.1|  Os02g0115700                                       303   2e-97    
emb|CDY31488.1|  BnaC05g15970D                                          303   2e-97    
dbj|BAF91369.1|  catalase                                               303   2e-97    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           303   2e-97 
gb|AFW66785.1|  catalase3 isoform 1                                     308   3e-97    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      302   3e-97    
gb|ABB72796.1|  catalase isozyme 1-like protein                         302   4e-97    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      302   5e-97    
dbj|BAJ92414.1|  predicted protein                                      301   6e-97    
gb|ADY02963.1|  catalase                                                301   8e-97    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               301   8e-97    
emb|CAH61266.1|  catalase                                               301   8e-97    
gb|AGT16054.1|  catalase                                                300   2e-96    
gb|AGT16188.1|  catalase                                                300   2e-96    
emb|CAA43814.1|  catalase                                               300   2e-96    
gb|AGT16203.1|  catalase                                                300   3e-96    
gb|AGT15888.1|  catalase                                                298   2e-95    
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               298   2e-95    
gb|AJF34884.1|  catalase                                                297   4e-95    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          296   2e-94    
gb|EMS51034.1|  Catalase isozyme 2                                      296   2e-94    
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 293   9e-94    
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                292   2e-93    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              291   4e-93    
gb|EMT06167.1|  Catalase isozyme 2                                      296   6e-93    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        291   1e-92    
ref|NP_001105416.1|  catalase isozyme 3                                 291   1e-92    
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     291   1e-92    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   293   2e-92    
gb|AHG98056.1|  catalase                                                281   2e-91    
gb|ADI58890.1|  catalase                                                272   7e-90    
ref|XP_011022275.1|  PREDICTED: catalase-like                           278   7e-88    
ref|XP_005708279.1|  catalase                                           278   1e-87    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          274   3e-86    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          264   1e-82    
gb|ADU56189.1|  catalase 1                                              252   5e-82    
ref|XP_005536240.1|  catalase                                           262   1e-81    
gb|AHF27432.1|  catalase                                                261   2e-81    
gb|ADR01107.1|  catalase 3                                              257   5e-81    
gb|AEB22071.1|  catalase 2                                              249   5e-81    
gb|AHF27429.1|  catalase                                                259   1e-80    
dbj|BAH20307.1|  AT1G20620                                              258   2e-80    
gb|AAL38024.1|AF443179_1  catalase                                      250   3e-80    
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             246   3e-79    
gb|ABR16304.1|  unknown                                                 254   1e-78    
gb|ACJ71242.1|  catalase 1                                              240   2e-76    
gb|AIR77003.1|  catalase                                                239   3e-75    
gb|AII80275.1|  catalase                                                238   2e-74    
gb|AAD37788.1|AF149283_1  catalase 1                                    242   2e-74    
ref|XP_005642928.1|  catalase                                           241   2e-73    
gb|AEG89525.1|  catalase                                                235   6e-73    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    238   7e-73    
ref|XP_005647994.1|  catalase-domain-containing protein                 239   2e-72    
gb|KHG11966.1|  Catalase isozyme 2                                      232   4e-72    
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             231   6e-72    
ref|XP_005644653.1|  catalase-domain-containing protein                 237   2e-71    
emb|CAB16750.1|  catalase                                               225   9e-70    
gb|ACJ71243.1|  catalase 2                                              223   1e-69    
dbj|GAE06714.1|  catalase                                               222   1e-68    
gb|AIM05077.1|  catalase                                                218   2e-68    
gb|EJF09706.1|  catalase                                                227   5e-68    
ref|WP_040574212.1|  catalase                                           227   5e-68    
ref|WP_035405433.1|  catalase                                           226   7e-68    
ref|WP_036667842.1|  catalase                                           226   9e-68    
ref|WP_036612802.1|  catalase                                           225   2e-67    
ref|WP_024632816.1|  MULTISPECIES: catalase                             225   2e-67    
ref|WP_015737807.1|  catalase                                           225   3e-67    
ref|WP_036662024.1|  catalase                                           224   3e-67    
ref|WP_009590324.1|  catalase                                           224   3e-67    
ref|WP_006207005.1|  catalase                                           224   5e-67    
ref|WP_036640075.1|  catalase                                           224   5e-67    
ref|WP_017691823.1|  catalase                                           224   6e-67    
ref|WP_032086373.1|  catalase                                           224   6e-67    
ref|XP_005712277.1|  unnamed protein product                            224   6e-67    
emb|CAC37634.1|  catalase 1                                             218   7e-67    
ref|WP_025606320.1|  catalase                                           224   1e-66    
ref|WP_044186614.1|  catalase                                           224   1e-66    
ref|WP_028402967.1|  catalase                                           223   1e-66    
ref|WP_034700019.1|  catalase                                           223   2e-66    
ref|WP_002617638.1|  catalase                                           223   2e-66    
ref|WP_036709507.1|  catalase                                           223   2e-66    
ref|WP_016090862.1|  catalase                                           213   2e-66    
ref|WP_018976489.1|  catalase                                           223   2e-66    
ref|WP_043068684.1|  catalase                                           222   3e-66    
ref|WP_025027035.1|  catalase                                           222   3e-66    
ref|WP_011983963.1|  catalase                                           222   3e-66    
ref|WP_027091399.1|  catalase                                           222   4e-66    
ref|WP_007128851.1|  catalase                                           221   6e-66    
ref|WP_036273058.1|  catalase                                           222   6e-66    
ref|WP_037289104.1|  catalase                                           221   9e-66    
ref|WP_028404102.1|  catalase                                           221   1e-65    
ref|WP_002162341.1|  catalase                                           221   1e-65    
ref|WP_026975362.1|  catalase                                           220   1e-65    
ref|WP_043072359.1|  catalase                                           220   1e-65    
gb|AAS40190.1|  catalase                                                219   2e-65    
ref|WP_001069185.1|  catalase                                           220   2e-65    
ref|WP_035435964.1|  catalase                                           220   2e-65    
ref|WP_001069175.1|  catalase                                           220   2e-65    
ref|WP_002978792.1|  catalase                                           220   3e-65    
ref|WP_001069181.1|  MULTISPECIES: catalase                             219   3e-65    
ref|WP_001069182.1|  MULTISPECIES: catalase                             219   3e-65    
ref|WP_018669668.1|  catalase                                           219   3e-65    
ref|WP_016088914.1|  catalase                                           219   3e-65    
ref|WP_001069174.1|  catalase                                           219   3e-65    
ref|WP_002194469.1|  catalase                                           219   3e-65    
ref|WP_001069173.1|  catalase                                           219   3e-65    
ref|WP_001069170.1|  catalase                                           219   3e-65    
ref|WP_000184218.1|  catalase                                           219   3e-65    
ref|WP_001069180.1|  MULTISPECIES: catalase                             219   3e-65    
ref|WP_001069172.1|  catalase                                           219   3e-65    
ref|WP_042982436.1|  catalase                                           219   3e-65    
ref|WP_016122096.1|  catalase                                           219   3e-65    
ref|WP_001069169.1|  MULTISPECIES: catalase                             219   3e-65    
ref|WP_000184219.1|  catalase                                           219   3e-65    
ref|WP_038413367.1|  catalase                                           219   3e-65    
ref|WP_043936623.1|  MULTISPECIES: catalase                             219   3e-65    
ref|WP_001069171.1|  catalase                                           219   4e-65    
ref|WP_001069184.1|  MULTISPECIES: catalase                             219   4e-65    
ref|WP_017674668.1|  catalase                                           219   4e-65    
ref|WP_017673056.1|  catalase                                           219   4e-65    
ref|WP_001069176.1|  MULTISPECIES: catalase                             219   4e-65    
ref|WP_001069179.1|  MULTISPECIES: catalase                             219   4e-65    
ref|WP_001069178.1|  catalase                                           219   4e-65    
ref|WP_001069183.1|  catalase                                           219   4e-65    
ref|WP_023521416.1|  catalase                                           219   4e-65    
ref|WP_001069177.1|  MULTISPECIES: catalase                             219   4e-65    
ref|WP_008359888.1|  catalase                                           219   4e-65    
ref|WP_034663722.1|  catalase                                           219   4e-65    
ref|WP_004919270.1|  catalase                                           219   4e-65    
ref|WP_002130360.1|  catalase                                           219   5e-65    
ref|WP_001069158.1|  MULTISPECIES: catalase                             219   5e-65    
ref|WP_020060313.1|  catalase                                           219   5e-65    
ref|WP_044333630.1|  catalase                                           219   5e-65    
ref|WP_001069155.1|  catalase                                           219   5e-65    
ref|WP_003211348.1|  catalase                                           219   5e-65    
ref|WP_002638677.1|  catalase                                           219   5e-65    
ref|WP_001069157.1|  MULTISPECIES: catalase                             219   5e-65    
ref|WP_001069156.1|  catalase                                           219   5e-65    
ref|WP_024425295.1|  MULTISPECIES: catalase                             219   5e-65    
ref|WP_012009409.1|  catalase                                           219   5e-65    
ref|WP_002201400.1|  catalase                                           219   5e-65    
ref|WP_001069154.1|  MULTISPECIES: catalase                             219   5e-65    
ref|WP_034637475.1|  catalase                                           219   5e-65    



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKNRPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT+LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   355 bits (912),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYN+PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKNRPSSA+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKNRPSSA+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPFFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTH+I+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+ILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKNRPS+A+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   356 bits (914),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   355 bits (912),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   355 bits (912),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAY+SPF+TTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+H+TCADFLRAPGVQTP+ILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   352 bits (902),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+ DGM FPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   352 bits (904),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+N PFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNNFPVFF+RDGMKFPDMVH+LKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSH  178



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS++NSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+ DGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNS FFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFF+VTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSP+FTTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHE GSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHER SPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   353 bits (905),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSH  178



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   353 bits (905),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+ DGM FPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL NFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF++TNSGAPVWNNNSSLTVG+RGPI+LEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSP++TTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSH  178



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFE THDI++LTCADFLRAPGVQTP+ILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPFFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSH  178



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFP FF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPS+A++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+T NSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLT+GSRGPILLEDYHLVEK+  FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCAD LRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSH  178



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF++TNSGAPVWNNNSSLTVG+RGPI+LEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS YNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPII+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   351 bits (900),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   351 bits (900),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPV+NNNSSL+VG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK R SSA+N+PF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPS A+NSPF TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPS A+NSPF TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RG  LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   350 bits (899),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   350 bits (898),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSSA++SPFFTTNSGAPVWNNNSSL+VG+RGPILLEDYHL+EK+ NFDRERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   350 bits (898),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPFFTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSH  178



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   350 bits (898),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT+L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   350 bits (898),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   350 bits (898),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   350 bits (898),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVK YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  47   DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPE  226
            DPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL NFDRER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  227  RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRG  406
            RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  407  FAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            FAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  177



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA +SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EK+ NFDRERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+++P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFP FF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENW VLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSH  178



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTN GAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNS FFTTNSGAPVWNNNSSLTVGSRGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSH  178



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLT ADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNP+SHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSH  178



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+++P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NS F TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSH  178



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSP++TTNSGA VWNNNSSLTVGSRGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSH
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSH  178



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNS  FTTN+GAPVWNNN+SLTVGSRGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNNFPVFF+RDGMKFPDMVHALKPNP++HIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQENWRIMDFFSH  178



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSH  178



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSH  178



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSP++TTNSGA VWNNNSSLTVGSRGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+TTN+GAPVWNNNSSLT+GSRGPILLEDYHLVEK+  FDRER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRA GVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSH  178



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL NFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NS FFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGAS+KGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSH  178



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   348 bits (893),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSH  178



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSSA+NS ++TTNSGAPVWNNNSSLTVG+RGPILLEDY LVEK+ NFDRERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSH  178



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   348 bits (892),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EK+ NFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   348 bits (892),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSH  178



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   348 bits (892),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSH  178



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   347 bits (890),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVK YT EGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSH
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSH  178



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYH++EKL  FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS YNSPF+TTNSGAPVWNNN+S+TVGSRGPILLEDYHLVEK+  FDRERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLT+GSRGPILLEDYHLVEK+  FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCAD LRAPGVQTP+I+RFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSH  178



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSH  178



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  47   DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPE  226
            DPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  227  RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRG  406
            RVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  407  FAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            FAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  177



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSH  178



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL  FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVT+D++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>prf||1906388A catalase
Length=492

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSH  178



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+NRPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHA KPNPKSH+QENWR+ DF SH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSH  178



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGP+ LEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPII+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPKSH+QENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSH  178



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLR PGVQTP+I+RFSTVIHERGSPE++RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA NSP++TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  47   DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPE  226
            DPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  227  RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRG  406
            RVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  407  FAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            FAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  177



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFS  574
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWRV+DFFS
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFS  177



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP+K RPSSA+N+ F+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYH++EKL  FDRERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/172 (95%), Positives = 171/172 (99%), Gaps = 0/172 (0%)
 Frame = +2

Query  62   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHA  241
            RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIPERVVHA
Sbjct  5    RPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHA  64

Query  242  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  421
            RGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  65   RGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  124

Query  422  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  125  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  176



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   346 bits (887),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 1/178 (1%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFT NSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  177



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   346 bits (887),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDF SH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSH  178



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP+K RPSSA+N+ F+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA N+P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADF+RAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRV+DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSH  178



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP K RPSSA+NSPF+TTNSGA VWNNNSSLTVG+RGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSP+FT NSGAPVWNNN+SLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLR+PGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSH  178



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL  FDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++SP++TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAK FFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   345 bits (885),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSP FTTNSGAPVWN+NSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFE THDI+HLTCADFLR+PGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSH  178



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   345 bits (885),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD+++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   345 bits (885),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD+++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   345 bits (885),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPV NNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHE GSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   345 bits (885),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA N+P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADF+RAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRV+DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSH  178



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS++NSP ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+ +FDRERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRVLDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSH  178



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIH RGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSH  178



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTNSGAPV++N+ SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSH  178



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK R SSAYN+PF+TTNSGAPV+NNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQE+WR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSH  178



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
             FA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDFFSH
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSH  178



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFF  571
            GFAVKFYTREGN+D+VGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWR+LDFF
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFF  176



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   341 bits (874),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +2

Query  59   NRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVH  238
             RPSSA+++PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL NFDRERIPERVVH
Sbjct  5    QRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVH  64

Query  239  ARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVK  418
            ARGASAKGFFEVTHDITHLTCADFLRAPG QTP+I+RFSTVIHERGSPETLRDPRGFAVK
Sbjct  65   ARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGFAVK  124

Query  419  FYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            FYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  125  FYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  177



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  56   KNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVV  235
            ++RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  236  HARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAV  415
            HARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  416  KFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            KFYTREGNFD+VGNNFPVFF+ DGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  179



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +2

Query  65   PSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHAR  244
            PSSAY+SPF+TTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEKL NFDRERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  245  GASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  424
            GASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFY
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  425  TREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            TREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  TREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  171



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = +2

Query  62   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHA  241
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIPERVVHA
Sbjct  4    RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  63

Query  242  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  421
            RGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  64   RGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  123

Query  422  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  124  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  175



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   343 bits (880),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGP+LLEDYHL+EK+ NFDRERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   342 bits (878),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = +2

Query  62   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHA  241
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIPERVVHA
Sbjct  4    RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  63

Query  242  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  421
            RGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  64   RGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  123

Query  422  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  124  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  175



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   343 bits (879),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+R STVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKVVPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSH  178



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF TTNSGAP  NNNS LTVG+RG +LLEDYHLVEKL NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>prf||2104177A catalase
Length=492

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK R SSAYN+PF+TTNSGAPV+NNN+SLTVGSRGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT LTCADFLRAPGVQTP+I+R STVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQE+WR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSH  178



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSH  178



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+ +FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSH  178



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   342 bits (878),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+N P ++TNSGAPVW+N+ SLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  178



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS++N P ++TNSGAPVWNN++SLTVG RGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSH  178



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = +2

Query  62   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHA  241
            RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL NFDRERIPERVVHA
Sbjct  26   RPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHA  85

Query  242  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  421
            RGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHE GSPETLRDPRGFAVKF
Sbjct  86   RGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAVKF  145

Query  422  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  146  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  197



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL  FDRERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFL APGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSH  178



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTN+GAPVWNNNSSLTVGSRGP+LLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSH  178



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+ +FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSH  178



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTN+GAPVWNNNSSLTVGSRGP+LLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSH  178



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 175/178 (98%), Gaps = 1/178 (1%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSH
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSH  177



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYN+PF+TTN GAPV+NN+SSLTVG+RGPILLEDYH VEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVH+LKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHSLKPNPKSHIQEDWRILDFFSH  178



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = +2

Query  62   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHA  241
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIPERVVHA
Sbjct  44   RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  103

Query  242  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  421
            RGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  104  RGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKF  163

Query  422  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            YTREGNFD+VGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWRV+DFFSH
Sbjct  164  YTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSH  215



>prf||1803522A catalase
Length=491

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 175/178 (98%), Gaps = 1/178 (1%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSH
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSH  177



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKNRPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLR+PGVQTP+I+RFSTV +ERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH LK NPKS+IQE+WR LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHCLKSNPKSNIQESWRSLDFFSH  178



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKNRPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLR+PGVQTP+I+RFSTV +ERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH LK NPKS+IQE+WR LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHCLKSNPKSNIQESWRSLDFFSH  178



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGP+LLEDYHL+EK+ NFDRERIP
Sbjct  93   MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  152

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  153  ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  212

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  213  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  270



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS Y++PF+TTN GAPVWNNN+SLTVG RGP+LLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNN PVFFIRDG+KFPDM+HALKPNPKSHIQE WR++DFFSH
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSH  178



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTH I+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHGISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSH  178



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSP++TTNSGAP WNNNSSLTVG+RGPILLEDY LVE + NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFS VIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLRAPGVQTPVIVRFSIVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKP+PKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPSPKSHIQENWRILDFFSH  178



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS++N P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+ +FDRERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA+KFYTREGN+D+ GNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRVLDFFSH
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSH  178



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +2

Query  65   PSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHAR  244
            PSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL NFDRER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  245  GASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  424
            GASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFY
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  425  TREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            TREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  171



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   328 bits (840),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF+TTN+G PV+NN +SLTVG+RGPILLEDYHL+EKL NF RERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ER+VHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA KFYTREGNFD+VGNNFPVFF RD M FPD++HA KPNPKSHIQE WR+LDF SH
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEXWRILDFLSH  178



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSSA+N+PF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT+L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKF   VH LKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFTRHVHPLKPNPKSHIQENWRILDFFSH  178



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSS YN+PF+TTN G+PVWNNN+SLTVG RGP+LLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPE +RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNN PVFFIRDG+KFPDM+HALKPNPKSHIQE WR++DFFSH
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSH  178



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+++PF+TTNSGAPVWNN+SSLTVGSRGP+LLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD + A KPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSH  178



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  68   SSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHARG  247
            SSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL NFDRERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  248  ASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYT  427
            ASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  428  REGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            REGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRVLDFFSH
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSH  170



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   350 bits (899),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDIT+L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178


 Score =   343 bits (879),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +2

Query  59   NRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVH  238
            NRPSSA+++PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL NFDRERIPERVVH
Sbjct  487  NRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVH  546

Query  239  ARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVK  418
            ARGASAKGFFEVTHDITHLTCADFLRAPG QTP+I+RFSTVIHERGSPETLRDPRGFAVK
Sbjct  547  ARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGFAVK  606

Query  419  FYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            FYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  607  FYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  659



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 173/178 (97%), Gaps = 1/178 (1%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+N P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAV FYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSH
Sbjct  120  GFAVNFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSH  177



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYKN PS+AYN  F+TTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTH+++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHA KPNPKSHIQE+WR+ DF SH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHIQESWRIFDFLSH  178



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   335 bits (859),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSASNSSFWTTNSGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSH  178



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   335 bits (859),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDG+KFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGLKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQ P+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQAPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = +2

Query  62   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVVHA  241
            RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL NFDRERIPERVVHA
Sbjct  27   RPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIPERVVHA  86

Query  242  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  421
            RGASAKGFFEVTHD+++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  87   RGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  146

Query  422  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            YTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSH
Sbjct  147  YTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH  198



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSH  178



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++L+CADFLR  GVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN D+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSH  178



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PV FIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVLFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++L+CADFLR  GVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN D+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++L+CADFLR  GVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN D+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSH  178



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVH  KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHVFKPNPKTNLQENWRIVDFFSH  178



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAY+S F+TTN GAPVWNN+SSLTVG+RGPILLEDYHL+EKL NF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD +HA KPNPKS+IQE WR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFFSH  178



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVK YTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKLYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +2

Query  38   PLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRER  217
            P MDPY++RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRER
Sbjct  54   PAMDPYRHRPSSGNNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRER  113

Query  218  IPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRD  397
            IPERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRD
Sbjct  114  IPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRD  173

Query  398  PRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            PRGFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  174  PRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  233



>ref|XP_002961779.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
 ref|XP_002964850.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ33688.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ37039.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
Length=492

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+ PSSA+NS FFTTNSG PVWNNNSSLTVGSRGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHTPSSAFNSSFFTTNSGTPVWNNNSSLTVGSRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKG+FEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGYFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RDG+KFPDM+HALKPNPK+H+QE WR++D FSH
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFVRDGIKFPDMIHALKPNPKTHVQEPWRIMDHFSH  178



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SH
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSH  178



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNNFPVFFIRD MKFPD++HA KPNPKSHIQE WRV+DF S+
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSY  178



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  56   KNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIPERVV  235
            ++RPSS++NSP ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+ +FDRERIPERVV
Sbjct  46   QHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIPERVV  105

Query  236  HARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAV  415
            HARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFA+
Sbjct  106  HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAI  165

Query  416  KFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRVLDFFSH
Sbjct  166  KFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSH  219



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNNFPVFFIRD MKFPD++HA KPNPKSHIQE WRV+DF S+
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSY  178



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+NSPF+TTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SH
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSH  178



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD + A KPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSH  178



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSA+N+PF+TTN+G PVWNN+S+LTVG+RGPILLEDYHLVEKL N+ RERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFF+RD MKFPD +HALKPNPKSHIQE+WR+LDFFSH
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVRDAMKFPDSIHALKPNPKSHIQESWRILDFFSH  178



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD + A KPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSH  178



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL  FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD + A KPNPKSHIQE WR+LDFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSH  178



>gb|AAB70006.1| catalase [Chlamydomonas reinhardtii]
Length=493

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP K RPSSAYN+P++TTNSGAPVWNNN+S+TVG+RGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGA+AKGFFEVTHDI+ LT ADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNN PVFFIRDGMKFPDMVHA KPNPKSHIQE WR++DF SH
Sbjct  121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSH  178



>ref|XP_001696763.1| catalase/peroxidase [Chlamydomonas reinhardtii]
 gb|EDP00871.1| catalase/peroxidase [Chlamydomonas reinhardtii]
Length=493

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP K RPSSAYN+P++TTNSGAPVWNNN+S+TVG+RGPILLEDYHLVEKL  FDRERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGA+AKGFFEVTHDI+ LT ADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFDMVGNN PVFFIRDGMKFPDMVHA KPNPKSHIQE WR++DF SH
Sbjct  121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSH  178



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLR+PR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLREPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSH  178



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLED+HL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDHHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERV HARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVAHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGS ETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSSETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSH  178



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAYNSPF TTN+GAPVWN++SSLTVGSRGPILLEDYHL+EKL +F RER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ER+VHARGASAKGFFEVTHDI+HLTCAD LRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+D+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQENWR+LDF SH
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDPMKFPDVIHAFKPNPKSHIQENWRILDFLSH  178



>ref|XP_002950455.1| catalase [Volvox carteri f. nagariensis]
 gb|EFJ48656.1| catalase [Volvox carteri f. nagariensis]
Length=498

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDP K RPSSAYNSP++TTNSGAPVWNNN+S+TVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPSKVRPSSAYNSPYWTTNSGAPVWNNNNSMTVGPRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGA+AKGFFEVTH+++HLT ADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHNVSHLTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGN+DMVGNN PVFFIRDGMKFPDMVHA KPNPKSHIQE WR++DF SH
Sbjct  121  GFAVKFYTREGNYDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSH  178



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 7/178 (4%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFA       GNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH
Sbjct  121  GFA-------GNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  171



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSSA+NSPF+TT+SGAPVW+NNSSLTVG+RGP+LLEDYHLVEKL NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRD R
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDIR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFF+RD MKFPD +HALKPNPK+HIQE WR+LDFFS+
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFVRDAMKFPDSIHALKPNPKTHIQEYWRILDFFSY  178



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK RPSSAY+S F+TTN GAPVWNN+SSLTVG+RGPILLEDYHL+EKL NF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VG NFPVFFIRD MKFPD +HA KPNPKS+IQE WR++DF SH
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSH  178



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RP S  NS  +TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPPSGSNSILWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  N+ F++TNSGAPVWNNN++LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGANAGFWSTNSGAPVWNNNNALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSH  178



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  44   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL*NFDRERIP  223
            MDPYK+RPSS  NS F+TTNSGA VWNNNS+LTVG RGPILLEDYHL+EKL  FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGASVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  224  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  403
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  404  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  577
            GFAVKFYTREGNFD+VGNN PV FIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVLFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985