BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018D16

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770880.1|  PREDICTED: endoglucanase 25-like                   305   1e-96   Nicotiana sylvestris
ref|XP_006358489.1|  PREDICTED: endoglucanase 25-like                   301   3e-95   Solanum tuberosum [potatoes]
ref|NP_001233943.1|  endo-1,4-beta-glucanase                            301   5e-95   Solanum lycopersicum
gb|AIE16186.1|  endo-1,4-beta-glucanase                                 300   1e-94   Nicotiana tabacum [American tobacco]
gb|KJB70737.1|  hypothetical protein B456_011G089500                    296   1e-94   Gossypium raimondii
ref|XP_009600540.1|  PREDICTED: endoglucanase 25-like                   300   1e-94   Nicotiana tomentosiformis
gb|KJB70736.1|  hypothetical protein B456_011G089500                    297   2e-93   Gossypium raimondii
gb|AID55380.1|  glycoside hydrolase family 9 A2                         296   5e-93   Gossypium hirsutum [American cotton]
ref|XP_006431347.1|  hypothetical protein CICLE_v10000600mg             295   1e-92   Citrus clementina [clementine]
gb|KDO53875.1|  hypothetical protein CISIN_1g007014mg                   295   1e-92   Citrus sinensis [apfelsine]
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        295   1e-92   Tarenaya hassleriana [spider flower]
ref|XP_009765308.1|  PREDICTED: endoglucanase 25-like                   293   3e-92   Nicotiana sylvestris
ref|XP_009595607.1|  PREDICTED: endoglucanase 25-like                   291   2e-91   Nicotiana tomentosiformis
ref|XP_011092233.1|  PREDICTED: endoglucanase 25-like                   290   9e-91   Sesamum indicum [beniseed]
gb|KDP32467.1|  hypothetical protein JCGZ_13392                         289   1e-90   Jatropha curcas
ref|XP_004133745.1|  PREDICTED: endoglucanase 25-like                   289   2e-90   Cucumis sativus [cucumbers]
ref|NP_001284449.1|  endoglucanase 25-like                              289   2e-90   Cucumis melo [Oriental melon]
emb|CAN68337.1|  hypothetical protein VITISV_025978                     289   2e-90   Vitis vinifera
ref|XP_010088712.1|  Endoglucanase 25                                   288   5e-90   Morus notabilis
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             296   6e-90   
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   287   9e-90   Solanum tuberosum [potatoes]
gb|KJB66549.1|  hypothetical protein B456_010G143300                    284   9e-90   Gossypium raimondii
emb|CDP17765.1|  unnamed protein product                                287   1e-89   Coffea canephora [robusta coffee]
ref|XP_002519394.1|  endo-1,4-beta-glucanase, putative                  286   2e-89   Ricinus communis
ref|XP_004171003.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    285   5e-89   
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   285   5e-89   
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   285   6e-89   Tarenaya hassleriana [spider flower]
gb|AAP83128.1|  endo-1,4-beta-glucanase                                 285   9e-89   Gossypium hirsutum [American cotton]
gb|AEN70809.1|  endo-1,4-beta-glucanase                                 285   9e-89   Gossypium hirsutum subsp. latifolium
gb|KJB66548.1|  hypothetical protein B456_010G143300                    285   9e-89   Gossypium raimondii
gb|AEN70810.1|  endo-1,4-beta-glucanase                                 285   9e-89   Gossypium hirsutum subsp. latifolium
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 285   1e-88   Gossypium schwendimanii
gb|AEN70798.1|  endo-1,4-beta-glucanase                                 285   1e-88   Gossypium turneri
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 285   1e-88   Gossypium gossypioides
gb|ADY68791.1|  membrane-anchored endo-1,4-beta-glucanase               285   1e-88   Gossypium barbadense [Egyptian cotton]
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               284   1e-88   Gossypium hirsutum [American cotton]
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 284   1e-88   Gossypium hirsutum [American cotton]
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               284   1e-88   Gossypium hirsutum [American cotton]
emb|CAB51903.1|  cellulase                                              284   1e-88   Brassica napus [oilseed rape]
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               284   2e-88   Gossypium herbaceum subsp. africanum
emb|CDX83181.1|  BnaA03g23250D                                          284   2e-88   
ref|XP_009134026.1|  PREDICTED: endoglucanase 25                        284   2e-88   Brassica rapa
gb|AGV22123.1|  endo-1,4-beta-glucanase 1                               284   2e-88   Betula luminifera [liang ye hua]
emb|CDY21449.1|  BnaC03g27480D                                          284   2e-88   Brassica napus [oilseed rape]
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        289   2e-87   
ref|XP_011022354.1|  PREDICTED: endoglucanase 25-like                   281   3e-87   Populus euphratica
gb|KFK26611.1|  hypothetical protein AALP_AA8G271400                    281   3e-87   Arabis alpina [alpine rockcress]
dbj|BAH57006.1|  AT5G49720                                              279   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222007.1|  hypothetical protein PRUPE_ppa002911mg             280   5e-87   Prunus persica
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             280   7e-87   Phaseolus vulgaris [French bean]
gb|AEO97184.1|  endo-1,4-beta-glucanase                                 279   8e-87   Populus trichocarpa [western balsam poplar]
ref|NP_199783.1|  endo-1,4-beta-D-glucanase                             280   8e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385837.1|  endo-1 family protein                              279   9e-87   Populus trichocarpa [western balsam poplar]
ref|XP_003594425.1|  Endoglucanase                                      279   1e-86   Medicago truncatula
ref|XP_010441020.1|  PREDICTED: endoglucanase 25                        279   1e-86   Camelina sativa [gold-of-pleasure]
gb|AAN72232.1|  At5g49720/K2I5_8                                        279   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442441.1|  PREDICTED: endoglucanase 25                        279   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_002865753.1|  hypothetical protein ARALYDRAFT_495032             279   1e-86   Arabidopsis lyrata subsp. lyrata
ref|XP_006402246.1|  hypothetical protein EUTSA_v10012932mg             279   1e-86   Eutrema salsugineum [saltwater cress]
gb|AEO97265.1|  endo-1,4-beta-glucanase                                 278   2e-86   Populus tomentosa [Chinese white poplar]
gb|AHA41508.1|  endo-1,4 -beta-glucanase                                278   2e-86   Populus deltoides
gb|AEO97182.1|  endo-1,4-beta-glucanase                                 278   2e-86   Populus tomentosa [Chinese white poplar]
gb|AEO97238.1|  endo-1,4-beta-glucanase                                 278   2e-86   Populus tomentosa [Chinese white poplar]
gb|AEO97239.1|  endo-1,4-beta-glucanase                                 278   2e-86   Populus tomentosa [Chinese white poplar]
ref|XP_006402245.1|  hypothetical protein EUTSA_v10012932mg             279   2e-86   
gb|AEO97252.1|  endo-1,4-beta-glucanase                                 278   3e-86   Populus tomentosa [Chinese white poplar]
gb|AAT75041.1|  Cel9A                                                   278   3e-86   Populus tremula x Populus tremuloides
dbj|BAC22690.1|  endo-1,4-beta-D-glucanase                              278   3e-86   Pyrus communis
ref|XP_010482263.1|  PREDICTED: endoglucanase 25-like                   278   4e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006281810.1|  hypothetical protein CARUB_v10027986mg             277   6e-86   Capsella rubella
ref|XP_009123553.1|  PREDICTED: endoglucanase 25                        277   6e-86   Brassica rapa
emb|CDY37768.1|  BnaA10g05530D                                          277   7e-86   Brassica napus [oilseed rape]
dbj|BAF42036.1|  cellulase1                                             277   7e-86   Pyrus communis
ref|XP_008339246.1|  PREDICTED: endoglucanase 25-like                   276   1e-85   Malus domestica [apple tree]
gb|ABD62083.1|  endo-1,4-beta-glucancase precursor                      275   2e-85   Glycine max [soybeans]
ref|XP_010266669.1|  PREDICTED: endoglucanase 9-like                    276   2e-85   Nelumbo nucifera [Indian lotus]
emb|CDX71601.1|  BnaC09g26420D                                          275   3e-85   
ref|XP_003535026.1|  PREDICTED: endoglucanase 25                        275   3e-85   
gb|AAM63370.1|  cellulase homolog OR16pep precursor                     275   4e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59818.1|  AT5g49720/K2I5_8                                        275   4e-85   Arabidopsis thaliana [mouse-ear cress]
gb|ADB82903.1|  membrane-bound endo-beta-1,4-glucanase                  275   6e-85   Populus alba x Populus grandidentata
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        282   1e-84   
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        282   1e-84   Populus euphratica
ref|XP_003546229.1|  PREDICTED: endoglucanase 25-like                   274   1e-84   Glycine max [soybeans]
gb|AAS45400.1|  endo-1,4-beta-glucanase                                 273   2e-84   Populus tremuloides
ref|XP_006858422.1|  hypothetical protein AMTR_s00071p00064260          273   2e-84   Amborella trichopoda
ref|XP_002299405.1|  endo-1 family protein                              273   2e-84   
gb|AEO97183.1|  endo-1,4-beta-glucanase                                 273   2e-84   Populus tomentosa [Chinese white poplar]
gb|AEO97185.1|  endo-1,4-beta-glucanase                                 273   2e-84   Populus trichocarpa [western balsam poplar]
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                273   3e-84   Erythranthe guttata [common monkey flower]
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   272   5e-84   Cicer arietinum [garbanzo]
gb|AEO97283.1|  endo-1,4-beta-glucanase                                 271   7e-84   Populus tomentosa [Chinese white poplar]
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        278   3e-83   Fragaria vesca subsp. vesca
ref|XP_010529892.1|  PREDICTED: endoglucanase 25-like                   270   3e-83   Tarenaya hassleriana [spider flower]
gb|ABR15471.1|  endoglucanase                                           270   4e-83   Pinus taeda
ref|XP_009355455.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    276   1e-82   
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    275   2e-82   
ref|XP_006413454.1|  hypothetical protein EUTSA_v10024681mg             267   7e-82   
ref|XP_009340771.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    266   9e-82   
gb|KCW62543.1|  hypothetical protein EUGRSUZ_G00035                     263   1e-81   Eucalyptus grandis [rose gum]
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  266   1e-81   Picea glauca
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        265   4e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|AFD33696.1|  korrigan                                                265   5e-81   Eucalyptus camaldulensis
ref|XP_010065200.1|  PREDICTED: endoglucanase 25-like                   263   2e-80   Eucalyptus grandis [rose gum]
ref|XP_003529689.1|  PREDICTED: endoglucanase 25-like                   263   2e-80   Glycine max [soybeans]
gb|AFY03622.1|  endo-1,4-beta-glucanase                                 263   3e-80   Eucalyptus globulus [blue gum]
gb|ABR16291.1|  unknown                                                 262   3e-80   Picea sitchensis
gb|EPS69180.1|  hypothetical protein M569_05586                         261   6e-80   Genlisea aurea
ref|XP_003550680.1|  PREDICTED: endoglucanase 25-like                   260   2e-79   Glycine max [soybeans]
ref|XP_007154086.1|  hypothetical protein PHAVU_003G089600g             260   3e-79   Phaseolus vulgaris [French bean]
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   259   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14382.1|  Endoglucanase 25                                        259   1e-78   Glycine soja [wild soybean]
ref|XP_010433798.1|  PREDICTED: endoglucanase 21-like                   257   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010439066.1|  PREDICTED: endoglucanase 21                        256   4e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   256   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABP96983.1|  cellulase                                               256   5e-78   Colocasia esculenta [cocoyam]
ref|XP_010448587.1|  PREDICTED: endoglucanase 21-like                   256   1e-77   Camelina sativa [gold-of-pleasure]
gb|KFK22234.1|  hypothetical protein AALP_AAs42893U000400               254   3e-77   Arabis alpina [alpine rockcress]
gb|EPS66085.1|  hypothetical protein M569_08689                         254   3e-77   Genlisea aurea
ref|XP_002867672.1|  predicted protein                                  253   9e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_008782747.1|  PREDICTED: endoglucanase 9-like                    253   1e-76   Phoenix dactylifera
ref|XP_010921267.1|  PREDICTED: endoglucanase 9-like                    253   1e-76   Elaeis guineensis
ref|XP_008793381.1|  PREDICTED: endoglucanase 9-like                    253   2e-76   Phoenix dactylifera
ref|XP_010909007.1|  PREDICTED: endoglucanase 10-like                   251   4e-76   Elaeis guineensis
ref|XP_009417855.1|  PREDICTED: endoglucanase 9-like                    251   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_194157.1|  endoglucanase 21                                      251   9e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088109.1|  PREDICTED: endoglucanase 25-like                   250   1e-75   
ref|XP_006283336.1|  hypothetical protein CARUB_v10004382mg             250   1e-75   Capsella rubella
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          249   2e-75   Sorghum bicolor [broomcorn]
ref|XP_008803421.1|  PREDICTED: endoglucanase 10-like                   249   3e-75   Phoenix dactylifera
ref|XP_004984503.1|  PREDICTED: endoglucanase 9-like                    249   4e-75   Setaria italica
ref|NP_001183308.1|  hypothetical protein                               248   1e-74   Zea mays [maize]
ref|XP_009406859.1|  PREDICTED: endoglucanase 9-like                    247   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938102.1|  PREDICTED: endoglucanase 9-like                    246   5e-74   Elaeis guineensis
ref|NP_001050004.1|  Os03g0329500                                       246   7e-74   
ref|NP_001147537.1|  endo-1,4-beta-glucanase                            246   8e-74   Zea mays [maize]
ref|XP_006650027.1|  PREDICTED: endoglucanase 9-like                    244   2e-73   Oryza brachyantha
emb|CDX92628.1|  BnaC07g38860D                                          241   3e-72   
gb|EEE58992.1|  hypothetical protein OsJ_10702                          241   4e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399913.1|  PREDICTED: endoglucanase 9-like                    242   6e-72   
ref|XP_003557996.1|  PREDICTED: endoglucanase 9                         238   5e-71   Brachypodium distachyon [annual false brome]
ref|XP_009137436.1|  PREDICTED: endoglucanase 21-like                   237   2e-70   Brassica rapa
emb|CDY03467.1|  BnaC01g16150D                                          234   7e-70   
emb|CDY34271.1|  BnaA01g13740D                                          231   6e-69   Brassica napus [oilseed rape]
dbj|BAK04500.1|  predicted protein                                      233   7e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009137865.1|  PREDICTED: endoglucanase 21                        231   2e-68   Brassica rapa
gb|AGK26802.1|  endo-beta-1,4-glucanase                                 229   2e-67   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26803.1|  endo-beta-1,4-glucanase                                 228   4e-67   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26798.1|  endo-beta-1,4-glucanase                                 228   4e-67   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26801.1|  endo-beta-1,4-glucanase                                 228   4e-67   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA51201.1|  TPA: endo-1,4-beta-glucanase Cel1                      214   8e-62   
emb|CDI66528.1|  Endoglucanase 10                                       213   1e-61   Saccharum hybrid cultivar R570
ref|NP_001151770.1|  endo-1,4-beta-glucanase Cel1                       213   1e-61   
emb|CDI66566.1|  Endoglucanase 10                                       213   1e-61   Saccharum hybrid cultivar R570
gb|ACN28577.1|  unknown                                                 213   1e-61   Zea mays [maize]
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          213   1e-61   Sorghum bicolor [broomcorn]
ref|NP_001051192.1|  Os03g0736300                                       210   2e-60   
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   208   8e-60   Setaria italica
emb|CBB36505.1|  Hordeum vulgare protein similar to endo-1,4-b-gl...    207   3e-59   Saccharum hybrid cultivar R570
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   205   1e-58   Oryza brachyantha
emb|CDI66602.1|  Endoglucanase 10                                       203   7e-58   Saccharum hybrid cultivar R570
ref|XP_010277803.1|  PREDICTED: endoglucanase 12-like                   202   2e-57   Nelumbo nucifera [Indian lotus]
gb|ACZ82300.1|  beta-1,4 glycosidase                                    202   2e-57   Phyllostachys edulis [kikko-chiku]
ref|XP_009385674.1|  PREDICTED: endoglucanase 12-like                   201   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94336.1|  predicted protein                                      200   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           199   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP21162.1|  unnamed protein product                                198   4e-56   Coffea canephora [robusta coffee]
ref|XP_006858738.1|  hypothetical protein AMTR_s00066p00128970          197   9e-56   Amborella trichopoda
gb|EYU39502.1|  hypothetical protein MIMGU_mgv1a002977mg                196   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        196   2e-55   Brachypodium distachyon [annual false brome]
gb|ACT54547.1|  endo-1,4-beta-glucanase                                 193   3e-54   Dimocarpus longan [longan]
gb|EMT18790.1|  Endoglucanase 9                                         192   5e-54   
ref|XP_010930303.1|  PREDICTED: endoglucanase 12-like                   192   1e-53   Elaeis guineensis
ref|XP_002983992.1|  hypothetical protein SELMODRAFT_268803             192   1e-53   
ref|XP_002960146.1|  hypothetical protein SELMODRAFT_266522             192   1e-53   
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 191   2e-53   Triticum aestivum [Canadian hard winter wheat]
gb|KDP32490.1|  hypothetical protein JCGZ_13415                         190   5e-53   Jatropha curcas
ref|NP_001147970.1|  glycoside transferase, six-hairpin, subgroup       189   8e-53   Zea mays [maize]
ref|NP_001288466.1|  endoglucanase 12-like                              189   9e-53   Zea mays [maize]
sp|Q7XUK4.2|GUN12_ORYSJ  RecName: Full=Endoglucanase 12; AltName:...    189   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652472.1|  PREDICTED: endoglucanase 12-like                   188   2e-52   Oryza brachyantha
ref|XP_004976098.1|  PREDICTED: endoglucanase 12-like                   188   3e-52   Setaria italica
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   186   2e-51   Phoenix dactylifera
ref|XP_002961082.1|  hypothetical protein SELMODRAFT_75214              185   2e-51   
ref|XP_004976099.1|  PREDICTED: endoglucanase 12-like                   185   3e-51   Setaria italica
ref|XP_011077092.1|  PREDICTED: endoglucanase 12                        185   3e-51   Sesamum indicum [beniseed]
ref|XP_009602898.1|  PREDICTED: endoglucanase 12                        185   3e-51   Nicotiana tomentosiformis
ref|XP_002966925.1|  hypothetical protein SELMODRAFT_408186             185   3e-51   
ref|XP_006353239.1|  PREDICTED: endoglucanase 12-like                   185   4e-51   Solanum tuberosum [potatoes]
ref|XP_009782313.1|  PREDICTED: endoglucanase 12                        184   6e-51   Nicotiana sylvestris
ref|XP_011010912.1|  PREDICTED: endoglucanase 12                        182   2e-50   Populus euphratica
ref|XP_003580066.1|  PREDICTED: endoglucanase 12                        182   2e-50   Brachypodium distachyon [annual false brome]
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   182   4e-50   Phoenix dactylifera
ref|XP_010065082.1|  PREDICTED: endoglucanase 12                        182   6e-50   Eucalyptus grandis [rose gum]
gb|AEO97186.1|  endo-1,4-beta-glucanase                                 181   7e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002514768.1|  endo-1,4-beta-glucanase, putative                  181   8e-50   Ricinus communis
gb|AFZ78628.1|  korrigan                                                182   8e-50   Populus tomentosa [Chinese white poplar]
ref|XP_010929679.1|  PREDICTED: endoglucanase 12-like                   181   1e-49   Elaeis guineensis
gb|AGG19084.1|  cellulase                                               180   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002446733.1|  hypothetical protein SORBIDRAFT_06g021440          179   4e-49   Sorghum bicolor [broomcorn]
gb|AFZ78629.1|  korrigan                                                179   6e-49   Populus tomentosa [Chinese white poplar]
ref|XP_002312211.1|  endo-1 family protein                              179   7e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011014603.1|  PREDICTED: endoglucanase 12-like isoform X1        178   1e-48   Populus euphratica
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   177   2e-48   Tarenaya hassleriana [spider flower]
gb|EAY94707.1|  hypothetical protein OsI_16485                          177   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006468640.1|  PREDICTED: endoglucanase 12-like                   176   1e-47   Citrus sinensis [apfelsine]
ref|XP_007028162.1|  Six-hairpin glycosidases superfamily protein       175   2e-47   
ref|XP_006448516.1|  hypothetical protein CICLE_v10014583mg             173   6e-47   Citrus clementina [clementine]
gb|EMT15171.1|  Endoglucanase 12                                        172   2e-46   
ref|XP_010673846.1|  PREDICTED: endoglucanase 12-like                   172   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004250089.1|  PREDICTED: endoglucanase 12                        172   2e-46   Solanum lycopersicum
ref|NP_001288520.1|  uncharacterized protein LOC103641803               170   7e-46   Zea mays [maize]
ref|XP_001772986.1|  predicted protein                                  168   4e-45   
ref|XP_003601506.1|  Endoglucanase                                      168   4e-45   Medicago truncatula
ref|NP_176738.1|  glycosyl hydrolase 9A2                                167   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791029.1|  PREDICTED: endoglucanase 12-like                   166   2e-44   Phoenix dactylifera
ref|XP_010528623.1|  PREDICTED: endoglucanase 7                         166   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_010415102.1|  PREDICTED: endoglucanase 7-like                    164   9e-44   Camelina sativa [gold-of-pleasure]
gb|KHN09941.1|  Endoglucanase 7                                         163   2e-43   Glycine soja [wild soybean]
ref|XP_003556773.1|  PREDICTED: endoglucanase 12-like                   163   2e-43   Glycine max [soybeans]
ref|XP_004152840.1|  PREDICTED: endoglucanase 7-like                    162   8e-43   Cucumis sativus [cucumbers]
ref|XP_004169320.1|  PREDICTED: endoglucanase 7-like                    162   9e-43   
ref|XP_002888427.1|  hypothetical protein ARALYDRAFT_894138             161   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_010496067.1|  PREDICTED: endoglucanase 7                         161   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008441913.1|  PREDICTED: endoglucanase 7                         160   3e-42   Cucumis melo [Oriental melon]
ref|XP_004502103.1|  PREDICTED: endoglucanase 12-like                   160   4e-42   Cicer arietinum [garbanzo]
ref|XP_009127411.1|  PREDICTED: endoglucanase 7                         157   4e-41   Brassica rapa
ref|XP_001775325.1|  predicted protein                                  156   9e-41   
ref|XP_006300882.1|  hypothetical protein CARUB_v10019972mg             155   1e-40   Capsella rubella
ref|XP_009403795.1|  PREDICTED: endoglucanase 12-like                   155   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK41003.1|  hypothetical protein AALP_AA2G072700                    154   5e-40   Arabis alpina [alpine rockcress]
ref|XP_006391540.1|  hypothetical protein EUTSA_v10018270mg             153   7e-40   Eutrema salsugineum [saltwater cress]
ref|XP_001759056.1|  predicted protein                                  149   3e-38   
gb|EMS51342.1|  Endoglucanase 9                                         149   5e-38   Triticum urartu
gb|EPS58029.1|  endo-1,4-beta-glucanase                                 147   9e-38   Genlisea aurea
gb|AFR40441.1|  cellulase                                               137   1e-37   Populus nigra [black poplar]
gb|AFR40406.1|  cellulase                                               137   1e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40402.1|  cellulase                                               137   1e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40405.1|  cellulase                                               137   1e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40409.1|  cellulase                                               137   1e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40430.1|  cellulase                                               136   2e-37   Populus fremontii
gb|AFR40426.1|  cellulase                                               135   7e-37   Populus fremontii
gb|AFR40424.1|  cellulase                                               134   8e-37   Populus fremontii
gb|AFR40432.1|  cellulase                                               134   8e-37   Populus fremontii
gb|AFR40428.1|  cellulase                                               134   1e-36   Populus fremontii
ref|XP_008370239.1|  PREDICTED: endoglucanase 9-like                    140   2e-36   
gb|AFR40408.1|  cellulase                                               132   4e-36   Populus trichocarpa [western balsam poplar]
gb|AFR40412.1|  cellulase                                               133   5e-36   Populus trichocarpa [western balsam poplar]
gb|EMT00674.1|  Endoglucanase 10                                        140   3e-35   
emb|CBI29606.3|  unnamed protein product                                137   2e-34   Vitis vinifera
ref|XP_004503186.1|  PREDICTED: endoglucanase 25-like                   132   2e-34   
gb|EMS52550.1|  Endoglucanase 10                                        137   3e-34   Triticum urartu
ref|XP_002515321.1|  endo-1,4-beta-glucanase, putative                  135   3e-33   Ricinus communis
ref|XP_009339798.1|  PREDICTED: endoglucanase 9-like                    135   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_007216021.1|  hypothetical protein PRUPE_ppa014845mg             134   5e-33   
ref|XP_008243721.1|  PREDICTED: endoglucanase 9-like                    132   2e-32   Prunus mume [ume]
emb|CDY45056.1|  BnaA08g02190D                                          128   3e-31   Brassica napus [oilseed rape]
ref|XP_008235173.1|  PREDICTED: endoglucanase 9-like                    129   4e-31   Prunus mume [ume]
ref|XP_007199407.1|  hypothetical protein PRUPE_ppa026228mg             128   6e-31   Prunus persica
emb|CDP09829.1|  unnamed protein product                                127   8e-31   Coffea canephora [robusta coffee]
gb|EYU33243.1|  hypothetical protein MIMGU_mgv1a024415mg                121   8e-31   Erythranthe guttata [common monkey flower]
gb|EYU33248.1|  hypothetical protein MIMGU_mgv1a018124mg                119   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_006444448.1|  hypothetical protein CICLE_v10024241mg             124   2e-29   Citrus clementina [clementine]
ref|XP_001763929.1|  predicted protein                                  124   2e-29   
ref|XP_006480121.1|  PREDICTED: endoglucanase 25-like                   124   3e-29   Citrus sinensis [apfelsine]
ref|XP_009141938.1|  PREDICTED: endoglucanase 21-like                   123   3e-29   Brassica rapa
ref|XP_003635672.1|  PREDICTED: endoglucanase 12-like                   120   5e-29   Vitis vinifera
ref|XP_001754846.1|  predicted protein                                  122   1e-28   
gb|AID55392.1|  glycoside hydrolase family 9 A6                         121   3e-28   Gossypium hirsutum [American cotton]
gb|KJB49856.1|  hypothetical protein B456_008G141900                    121   3e-28   Gossypium raimondii
gb|KDO87072.1|  hypothetical protein CISIN_1g046335mg                   117   7e-27   Citrus sinensis [apfelsine]
gb|EMT22659.1|  Endoglucanase 12                                        116   1e-26   
emb|CDY06962.1|  BnaA04g23530D                                          108   6e-26   
gb|AFR40403.1|  cellulase                                             99.8    1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010673848.1|  PREDICTED: endoglucanase 12-like                   107   2e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU33249.1|  hypothetical protein MIMGU_mgv1a018926mg                105   2e-23   Erythranthe guttata [common monkey flower]
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       106   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                   105   6e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010646848.1|  PREDICTED: endoglucanase 12                        104   2e-22   
gb|EYU33247.1|  hypothetical protein MIMGU_mgv1a0268391mg             96.7    5e-22   
gb|AAD28258.1|AF128404_1  cellulase homolog                             102   6e-22   
gb|ABC94541.1|  endo-1,4-beta-glucanase                               97.1    7e-22   
ref|XP_009771552.1|  PREDICTED: endoglucanase 13-like                   101   1e-21   
ref|XP_009607784.1|  PREDICTED: endoglucanase 12-like                   101   1e-21   
ref|XP_008342152.1|  PREDICTED: endoglucanase 9-like                    101   2e-21   
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                   102   2e-21   
emb|CDP14001.1|  unnamed protein product                                100   2e-21   
ref|XP_008232281.1|  PREDICTED: endoglucanase 14-like                 99.4    2e-21   
ref|NP_001053204.2|  Os04g0497200                                     95.9    3e-21   
emb|CBI25462.3|  unnamed protein product                                100   3e-21   
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    100   4e-21   
ref|XP_002272408.1|  PREDICTED: endoglucanase 13                        100   4e-21   
ref|XP_002269618.1|  PREDICTED: endoglucanase 14-like                   100   5e-21   
ref|XP_002122707.2|  PREDICTED: endoglucanase 13                        101   5e-21   
ref|XP_007220712.1|  hypothetical protein PRUPE_ppa021556mg           99.8    5e-21   
emb|CBI25463.3|  unnamed protein product                              99.8    5e-21   
ref|XP_004308724.1|  PREDICTED: endoglucanase 14-like                 99.8    6e-21   
ref|XP_002509954.1|  endo-1,4-beta-glucanase, putative                97.1    7e-21   
ref|XP_002448844.1|  hypothetical protein SORBIDRAFT_06g034260        94.7    7e-21   
gb|AAP38171.1|  endo-1,4-beta-glucanase                               99.8    7e-21   
ref|XP_008232258.1|  PREDICTED: endoglucanase 14-like                 99.4    8e-21   
gb|ABR10607.1|  endo-beta-1,4-glucanase                                 100   1e-20   
ref|XP_001768193.1|  predicted protein                                99.4    1e-20   
emb|CDP12150.1|  unnamed protein product                              99.4    2e-20   
ref|XP_006843620.1|  hypothetical protein AMTR_s00007p00146230        95.5    2e-20   
ref|XP_006476392.1|  PREDICTED: endoglucanase 6-like                  99.0    3e-20   
ref|XP_002454930.1|  hypothetical protein SORBIDRAFT_03g001560        99.0    3e-20   
ref|XP_010058567.1|  PREDICTED: endoglucanase 13-like                 97.8    3e-20   
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                 97.8    3e-20   
gb|KEH21214.1|  endo-1,4-beta-glucanase                               98.2    3e-20   
ref|XP_002303645.1|  endo-glucanase 2 family protein                  98.6    3e-20   
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                  98.6    3e-20   
ref|XP_011026902.1|  PREDICTED: endoglucanase 6-like                  98.6    3e-20   
ref|XP_010413050.1|  PREDICTED: endoglucanase 14-like                 97.8    3e-20   
gb|ABC70312.1|  endo-1,4-beta-glucanase precursor                     92.4    3e-20   
gb|KCW73253.1|  hypothetical protein EUGRSUZ_E01715                   97.4    3e-20   
gb|EMT30809.1|  Endoglucanase 4                                       96.3    3e-20   
gb|EMT30810.1|  Endoglucanase 4                                       97.1    3e-20   
ref|XP_006375102.1|  hypothetical protein POPTR_0014s04390g           94.4    3e-20   
ref|XP_009383659.1|  PREDICTED: endoglucanase 13                      98.6    3e-20   
gb|KEH21213.1|  endo-1,4-beta-glucanase                               98.6    3e-20   
gb|AGE09591.1|  CEL2-like protein                                     92.8    3e-20   
emb|CDY66787.1|  BnaC06g43770D                                        97.4    4e-20   
ref|XP_009105806.1|  PREDICTED: endoglucanase 9                       97.4    4e-20   
gb|KJB24218.1|  hypothetical protein B456_004G133700                  97.8    4e-20   
emb|CDX96319.1|  BnaA07g29300D                                        97.4    4e-20   
ref|XP_010096825.1|  Endoglucanase 6                                  97.4    4e-20   
gb|KJB19011.1|  hypothetical protein B456_003G080800                  97.4    4e-20   
ref|XP_007040357.1|  Glycosyl hydrolase 9B14                          97.8    4e-20   
gb|AGG19087.1|  cellulase                                             97.4    4e-20   
ref|XP_003611061.1|  Cellulase                                        97.8    4e-20   
gb|ETT50503.1|  hypothetical protein C170_16175                       99.0    4e-20   
dbj|BAL46914.1|  beta-glucan hydrolase                                99.0    4e-20   
gb|AID55382.1|  glycoside hydrolase family 9 C4                       98.2    4e-20   
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg              97.4    4e-20   
gb|AAN04496.2|  endo-1,4-beta-glucanase                               98.2    4e-20   
ref|NP_001042867.2|  Os01g0312800                                     97.4    4e-20   
ref|WP_036611626.1|  glycoside hydrolase                              99.0    4e-20   
gb|AFR40414.1|  cellulase                                             90.1    4e-20   
ref|XP_009346446.1|  PREDICTED: endoglucanase 6-like                  98.2    4e-20   
ref|NP_001042421.1|  Os01g0219600                                     98.2    4e-20   
gb|KJB19010.1|  hypothetical protein B456_003G080800                  98.2    4e-20   
gb|AAA96135.1|  endo-1,4-beta-glucanase                               97.4    4e-20   
gb|KJB19013.1|  hypothetical protein B456_003G080800                  97.8    5e-20   
ref|XP_007219796.1|  hypothetical protein PRUPE_ppa026537mg           97.4    5e-20   
ref|WP_036669167.1|  glycoside hydrolase                              99.0    5e-20   
ref|XP_008341511.1|  PREDICTED: endoglucanase 6                       98.2    5e-20   
gb|EMS60956.1|  Endoglucanase 11                                      95.9    5e-20   
gb|KJB24217.1|  hypothetical protein B456_004G133700                  98.2    5e-20   
ref|XP_009348798.1|  PREDICTED: endoglucanase 8-like                  97.1    5e-20   
ref|XP_010534895.1|  PREDICTED: endoglucanase 3-like                  97.1    5e-20   
ref|XP_010261581.1|  PREDICTED: endoglucanase 19-like                 98.2    5e-20   
ref|XP_004240228.2|  PREDICTED: endoglucanase 13-like                 97.1    5e-20   
gb|EPS71030.1|  hypothetical protein M569_03731                       98.2    5e-20   
gb|KJB19012.1|  hypothetical protein B456_003G080800                  97.4    5e-20   
ref|XP_009127870.1|  PREDICTED: endoglucanase 9-like                  97.1    5e-20   
gb|KJB24219.1|  hypothetical protein B456_004G133700                  97.8    5e-20   
gb|KHG13636.1|  hypothetical protein F383_04399                       98.2    5e-20   
ref|XP_010915660.1|  PREDICTED: endoglucanase 19-like                 98.2    5e-20   
ref|XP_010053128.1|  PREDICTED: endoglucanase 6-like                  97.8    5e-20   
ref|XP_008379667.1|  PREDICTED: endoglucanase 11-like isoform X3      95.5    5e-20   
emb|CDY03687.1|  BnaA02g15500D                                        97.1    5e-20   
gb|KJB52283.1|  hypothetical protein B456_008G254000                  97.4    5e-20   
gb|EMS55138.1|  Endoglucanase 14                                      97.1    5e-20   
emb|CDY41954.1|  BnaA01g05260D                                        97.1    6e-20   
ref|XP_006654154.1|  PREDICTED: endoglucanase 15-like                 97.8    6e-20   
ref|XP_008460200.1|  PREDICTED: endoglucanase 13-like                 97.1    6e-20   
ref|XP_011022506.1|  PREDICTED: endoglucanase 6                       97.8    6e-20   
gb|KJB52282.1|  hypothetical protein B456_008G254000                  97.8    6e-20   
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg              96.7    6e-20   
ref|XP_010053064.1|  PREDICTED: endoglucanase 1-like                  97.1    6e-20   
gb|AGG19088.1|  cellulase                                             97.1    6e-20   
gb|EAY73050.1|  hypothetical protein OsI_00924                        97.8    6e-20   
ref|XP_008379666.1|  PREDICTED: endoglucanase 11-like isoform X2      95.5    6e-20   
ref|XP_008362024.1|  PREDICTED: endoglucanase 8-like                  96.7    7e-20   
ref|XP_004511554.1|  PREDICTED: endoglucanase-like                    97.4    7e-20   
ref|XP_008451938.1|  PREDICTED: endoglucanase 6-like                  97.8    7e-20   
ref|XP_006858456.1|  hypothetical protein AMTR_s00071p00095020        97.8    7e-20   
ref|XP_011101037.1|  PREDICTED: endoglucanase 6                       97.8    7e-20   
gb|KGN46280.1|  hypothetical protein Csa_6G079740                     96.7    7e-20   
gb|KDP22411.1|  hypothetical protein JCGZ_26242                       97.1    7e-20   
ref|XP_008232400.1|  PREDICTED: endoglucanase 4-like                  97.1    7e-20   
ref|XP_009101910.1|  PREDICTED: endoglucanase 23-like                 96.7    7e-20   
gb|ABD62089.1|  endo-1,4-beta-glucancase precursor                    92.0    8e-20   
gb|AFZ78641.1|  korrigan                                              97.4    8e-20   
ref|XP_004168441.1|  PREDICTED: endoglucanase 13-like                 96.7    8e-20   
gb|AFZ78640.1|  korrigan                                              97.4    8e-20   
gb|KDO45465.1|  hypothetical protein CISIN_1g015354mg                 94.7    8e-20   
gb|AEO97206.1|  endo-1,4-beta-glucanase                               97.4    8e-20   
ref|XP_002299478.2|  endo-glucanase 2 family protein                  97.4    8e-20   
ref|NP_001234172.1|  endo-beta-1,4-D-glucanase precursor              97.4    8e-20   
ref|XP_009144504.1|  PREDICTED: endoglucanase 23                      96.7    8e-20   
ref|XP_010314503.1|  PREDICTED: endoglucanase 6-like                  97.4    8e-20   
ref|XP_006439358.1|  hypothetical protein CICLE_v10019301mg           97.4    9e-20   
gb|KDO76512.1|  hypothetical protein CISIN_1g006835mg                 97.4    9e-20   
ref|XP_001774444.1|  predicted protein                                97.4    9e-20   
gb|EAZ21561.1|  hypothetical protein OsJ_05189                        96.7    9e-20   
gb|KCW90827.1|  hypothetical protein EUGRSUZ_A02885                   96.3    9e-20   
ref|XP_002975769.1|  hypothetical protein SELMODRAFT_232575           97.4    9e-20   
ref|XP_008234490.1|  PREDICTED: endoglucanase 8-like                  96.7    9e-20   
ref|XP_010251913.1|  PREDICTED: endoglucanase 1-like isoform X2       96.3    9e-20   
ref|XP_004153697.1|  PREDICTED: endoglucanase 12-like                 96.7    9e-20   
gb|KDO76513.1|  hypothetical protein CISIN_1g006835mg                 96.7    9e-20   
gb|EYU20028.1|  hypothetical protein MIMGU_mgv1a025805mg              96.3    9e-20   
gb|AID55373.1|  glycoside hydrolase family 9 C2                       97.4    1e-19   
ref|XP_003598326.1|  Endoglucanase                                    96.3    1e-19   
ref|XP_006434418.1|  hypothetical protein CICLE_v10003122mg           97.1    1e-19   
ref|NP_001045737.1|  Os02g0123700                                     96.7    1e-19   
ref|XP_010436996.1|  PREDICTED: endoglucanase 23-like                 96.3    1e-19   
gb|EEE56313.1|  hypothetical protein OsJ_05399                        94.7    1e-19   
ref|XP_010062150.1|  PREDICTED: endoglucanase 4-like                  96.7    1e-19   
ref|XP_004503629.1|  PREDICTED: endoglucanase 6-like                  97.1    1e-19   
gb|EAY73719.1|  hypothetical protein OsI_01596                        96.7    1e-19   
ref|NP_001054920.1|  Os05g0212300                                     97.1    1e-19   
ref|XP_008775119.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  96.7    1e-19   
ref|XP_001759537.1|  predicted protein                                97.1    1e-19   
gb|ACT54546.1|  endo-1,4-beta-glucanase                               96.7    1e-19   
gb|EPS60570.1|  hypothetical protein M569_14233                       96.3    1e-19   
gb|KHG00538.1|  hypothetical protein F383_16609                       97.1    1e-19   
ref|XP_010251905.1|  PREDICTED: endoglucanase 1-like isoform X1       96.3    1e-19   
ref|XP_007220152.1|  hypothetical protein PRUPE_ppa019691mg           96.3    1e-19   
ref|XP_006643915.1|  PREDICTED: endoglucanase 1-like                  97.1    1e-19   
ref|XP_007160157.1|  hypothetical protein PHAVU_002G297600g           97.1    1e-19   
ref|XP_008344131.1|  PREDICTED: endoglucanase 4-like                  96.3    1e-19   
gb|EAY96964.1|  hypothetical protein OsI_18884                        97.1    1e-19   
ref|XP_007210281.1|  hypothetical protein PRUPE_ppa002939mg           97.1    1e-19   
gb|ABC94540.1|  endo-1,4-beta-glucanase                               90.9    1e-19   
gb|KHN16746.1|  Endoglucanase 6                                       96.7    1e-19   
ref|XP_003530388.1|  PREDICTED: endoglucanase 6-like                  97.1    1e-19   
ref|XP_009788905.1|  PREDICTED: endoglucanase 17-like                 96.3    1e-19   
gb|KDO83647.1|  hypothetical protein CISIN_1g043321mg                 97.1    1e-19   
gb|EMT30441.1|  Endoglucanase 13                                      95.5    1e-19   
gb|KFK33689.1|  hypothetical protein AALP_AA5G047000                  97.1    1e-19   
ref|XP_008239042.1|  PREDICTED: endoglucanase 6                       97.1    1e-19   
emb|CAI68020.1|  endo-beta-1,4-glucanase                              97.1    1e-19   
gb|ABC94542.1|  endo-1,4-beta-glucanase                               96.7    1e-19   
gb|KDO45464.1|  hypothetical protein CISIN_1g015354mg                 95.1    1e-19   
ref|XP_007038416.1|  Glycosyl hydrolase 9B1 isoform 2                 94.4    1e-19   
ref|XP_002440792.1|  hypothetical protein SORBIDRAFT_09g006670        97.1    1e-19   
ref|XP_003525345.1|  PREDICTED: endoglucanase 6                       96.7    1e-19   
ref|XP_009375400.1|  PREDICTED: endoglucanase 4-like                  96.3    1e-19   
ref|XP_009394546.1|  PREDICTED: endoglucanase 7-like                  96.3    1e-19   
ref|XP_004309054.2|  PREDICTED: endoglucanase 4-like                  96.3    1e-19   
ref|XP_004143869.1|  PREDICTED: endoglucanase 6-like                  96.7    1e-19   
emb|CDX72723.1|  BnaC07g47450D                                        95.9    1e-19   
gb|EYU23364.1|  hypothetical protein MIMGU_mgv1a004112mg              96.3    1e-19   
ref|XP_003611057.1|  Endo-1 4-beta-glucanase                          96.3    1e-19   
ref|XP_009358597.1|  PREDICTED: endoglucanase 6-like                  96.7    1e-19   
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                             95.9    1e-19   
ref|NP_001289239.1|  endoglucanase 6-like precursor                   96.7    1e-19   
gb|AGG19089.1|  cellulase                                             95.9    1e-19   
ref|XP_011074347.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  96.7    2e-19   
gb|KFK30818.1|  hypothetical protein AALP_AA6G030100                  95.9    2e-19   
gb|KJB60129.1|  hypothetical protein B456_009G290800                  95.9    2e-19   
gb|AHB32109.1|  endoglucanase 6-like protein                          96.7    2e-19   
ref|XP_004499718.1|  PREDICTED: endoglucanase 9-like                  95.9    2e-19   
ref|XP_006411695.1|  hypothetical protein EUTSA_v10025010mg           95.9    2e-19   
ref|XP_006300890.1|  hypothetical protein CARUB_v10019981mg           96.7    2e-19   
ref|XP_004967499.1|  PREDICTED: endoglucanase 2-like                  96.7    2e-19   
gb|EEE62738.1|  hypothetical protein OsJ_17541                        97.1    2e-19   
gb|KDO76743.1|  hypothetical protein CISIN_1g010632mg                 94.4    2e-19   
ref|XP_006360711.1|  PREDICTED: endoglucanase 6-like                  96.3    2e-19   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                 95.9    2e-19   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  95.5    2e-19   
ref|XP_006343864.1|  PREDICTED: endoglucanase 6-like                  96.3    2e-19   
gb|KJB52202.1|  hypothetical protein B456_008G250400                  95.9    2e-19   
dbj|BAC22691.1|  endo-1,4-beta-D-glucanase                            96.3    2e-19   
dbj|BAJ96589.1|  predicted protein                                    96.3    2e-19   
ref|XP_002973718.1|  hypothetical protein SELMODRAFT_99802            96.3    2e-19   
gb|KEH40907.1|  glycosyl hydrolase family 9 protein                   95.5    2e-19   
emb|CDX74667.1|  BnaA05g04130D                                        94.7    2e-19   
ref|XP_002510938.1|  endo-1,4-beta-glucanase, putative                95.5    2e-19   
ref|XP_007153086.1|  hypothetical protein PHAVU_003G005700g           95.5    2e-19   
ref|XP_009396277.1|  PREDICTED: endoglucanase 7-like                  95.9    2e-19   
gb|AGG19090.1|  cellulase                                             95.5    2e-19   
gb|EAY84498.1|  hypothetical protein OsI_05874                        94.0    2e-19   
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                 95.5    2e-19   
ref|WP_026081249.1|  glycoside hydrolase                              96.7    2e-19   
ref|WP_044492536.1|  glycosyl hydrolase family 9                      95.1    2e-19   
gb|EPS69947.1|  hypothetical protein M569_04812                       95.1    2e-19   
ref|XP_010094077.1|  Endoglucanase 13                                 95.1    2e-19   
gb|EMT23865.1|  hypothetical protein F775_52481                       95.5    2e-19   
ref|XP_006390777.1|  hypothetical protein EUTSA_v10018465mg           95.1    2e-19   
ref|XP_010431848.1|  PREDICTED: endoglucanase 23                      95.5    2e-19   
ref|XP_009601304.1|  PREDICTED: endoglucanase 6                       96.3    2e-19   
ref|XP_006391621.1|  hypothetical protein EUTSA_v10023353mg           95.9    2e-19   
gb|AAL30454.1|AF362949_1  endo-beta-1,4-glucanase precursor           95.9    2e-19   
ref|XP_008374318.1|  PREDICTED: endoglucanase 6-like                  95.9    2e-19   
ref|XP_008784873.1|  PREDICTED: endoglucanase 1-like                  95.5    3e-19   
ref|XP_009396636.1|  PREDICTED: endoglucanase 6-like                  95.9    3e-19   
ref|XP_009797971.1|  PREDICTED: endoglucanase 6-like isoform X2       95.9    3e-19   
ref|XP_004960623.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  95.9    3e-19   
gb|EAY73052.1|  hypothetical protein OsI_00928                        95.9    3e-19   
ref|NP_001042423.1|  Os01g0220100                                     95.9    3e-19   
ref|XP_006646814.1|  PREDICTED: endoglucanase 4-like                  95.5    3e-19   
ref|XP_009797970.1|  PREDICTED: endoglucanase 6-like isoform X1       95.9    3e-19   
ref|XP_002887890.1|  hypothetical protein ARALYDRAFT_892975           95.9    3e-19   
emb|CDY46529.1|  BnaC09g11040D                                        95.9    3e-19   
gb|EGJ33758.1|  glycosyl hydrolase family 9                           95.5    3e-19   
ref|NP_001142028.1|  uncharacterized protein LOC100274182 precursor   95.5    3e-19   



>ref|XP_009770880.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=619

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEIHA DSATDDDRSRNL D DRAALSR+LDETQQSWLLGPTEQKKK+
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDDRSRNLGDFDRAALSRNLDETQQSWLLGPTEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+FKWTVGS+LAAA+L G I +IVK  PRH   NPPPDNYT+ALHKALM
Sbjct  61   YVDLGCIIVSRKIFKWTVGSILAAALLAGFITMIVKLAPRHKHHNPPPDNYTVALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALT
Sbjct  121  FFNAQKSGKLPKHNNVSWRGNSCLKDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  181  MLSWSVIEYSAK  192



>ref|XP_006358489.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=617

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIH  DSATDDDRSRNLQD DRAA+SRSLDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHTADSATDDDRSRNLQDFDRAAMSRSLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWTVG ++AAA+L G I +IVK VP+H   NPPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCIIAAALLAGFITMIVKLVPKHKHHNPPPDNYTLALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|NP_001233943.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
 gb|AAC49704.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
Length=617

 Score =   301 bits (770),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIH  DSATDDDRSRNLQD DRAA+SRSLDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHTADSATDDDRSRNLQDFDRAAMSRSLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWTVG ++AAA+L G I +IVK VPRH   NPPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCIIAAALLAGFITMIVKLVPRHKHHNPPPDNYTLALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|AIE16186.1| endo-1,4-beta-glucanase [Nicotiana tabacum]
Length=617

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL D DRAALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLGDFDRAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWTVG +LAAA+L G I +IVK  PRH   NPPPDNYT+ALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCILAAALLAGFITMIVKLAPRHKHHNPPPDNYTVALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|KJB70737.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=498

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 178/193 (92%), Gaps = 1/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP+EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPSEQKKKK  60

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVG+++ +AVL GLI LIVKTVPRHH   PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLVVSAVLAGLITLIVKTVPRHHHGKPPPDNYTLALHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPKHNNVSWRGNSC+RDGKSD  T  KDLVGGYYDAGDAIKFNFP SFA+
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDGKSDPGTTMKDLVGGYYDAGDAIKFNFPASFAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>ref|XP_009600540.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=617

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL D DRAALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLGDFDRAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWTVG +LAAA+L G I +IVK  PRH   NPPPDNYT+ALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCILAAALLAGFITMIVKLAPRHKHHNPPPDNYTVALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|KJB70736.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=621

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 178/193 (92%), Gaps = 1/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP+EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPSEQKKKK  60

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVG+++ +AVL GLI LIVKTVPRHH   PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLVVSAVLAGLITLIVKTVPRHHHGKPPPDNYTLALHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPKHNNVSWRGNSC+RDGKSD  T  KDLVGGYYDAGDAIKFNFP SFA+
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDGKSDPGTTMKDLVGGYYDAGDAIKFNFPASFAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>gb|AID55380.1| glycoside hydrolase family 9 A2 [Gossypium hirsutum]
Length=621

 Score =   296 bits (757),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP+EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPSEQKKKK  60

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVG+++ +AVL GLI LIVKTVPRHH    PPDNYTL LHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLVVSAVLAGLITLIVKTVPRHHHGKAPPDNYTLTLHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPKHNNVSWRGNSC+RDGKSD  T  KDLVGGYYDAGDAIKFNFP SFA+
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDGKSDPGTTMKDLVGGYYDAGDAIKFNFPASFAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>ref|XP_006431347.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 ref|XP_006470776.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
 gb|ESR44587.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 gb|KDO53874.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=621

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSM+GRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGPTE+KKK+
Sbjct  1    MSMFGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPTEKKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L +A+L G I LIVKTVPRHH  +  PDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSALLAGFITLIVKTVPRHHHSHARPDNYTLALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC++DGKS  ++I KDLVGG+YDAGDAIKFNFPQSF +T
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCLKDGKSASSSISKDLVGGFYDAGDAIKFNFPQSFTIT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  181  MLSWSVIEYSAK  192



>gb|KDO53875.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=620

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSM+GRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGPTE+KKK+
Sbjct  1    MSMFGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPTEKKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L +A+L G I LIVKTVPRHH  +  PDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSALLAGFITLIVKTVPRHHHSHARPDNYTLALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC++DGKS  ++I KDLVGG+YDAGDAIKFNFPQSF +T
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCLKDGKSASSSISKDLVGGFYDAGDAIKFNFPQSFTIT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  181  MLSWSVIEYSAK  192



>ref|XP_010533226.1| PREDICTED: endoglucanase 25 [Tarenaya hassleriana]
Length=622

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGPTEQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPTEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++LAA  L G I LIVKTVPRHH  +PPPDNYT+ALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTILAAGFLAGFITLIVKTVPRHHHKHPPPDNYTVALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC++DGK    + +KDLVGGYYDAGD IKFNFP SFA+T
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCLQDGKGTSGSFYKDLVGGYYDAGDTIKFNFPMSFAMT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  181  MLSWSVIEYSAK  192



>ref|XP_009765308.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=616

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGG LEI+A DSATDDDRSRNLQD D+AALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRKVFKWT+G ++AAA++ G + LIVKTVP+H + +PPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKVFKWTLGCIIAAALIAGFVTLIVKTVPKHRQRSPPPDNYTLALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRG+S M+DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQRSGKLPKHNNVSWRGSSGMQDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_009595607.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=616

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGG LEI+A DSATDDDRSRNLQD DRAALSR+LDETQQSWLLGPTE+KKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDRAALSRNLDETQQSWLLGPTEKKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRKVFKWT+G ++AAA++ G + LIVKT+P+H   +PPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKVFKWTLGCIIAAALIAGFVTLIVKTLPKHRHRSPPPDNYTLALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRG+S M+DGKSDD+T+FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQRSGKLPKHNNVSWRGSSGMQDGKSDDSTMFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_011092233.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=617

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGG LEI A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGSLEIAA-DSATDDDRSRNLQDYDRAALSRPLDETQQSWLLGPGEQKKKK  59

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++LAA  L G + LIVKTVPRHH   PPPDNYTLAL+KALM
Sbjct  60   YVDLGCIIVSRKIFVWTVGTILAAGFLAGFVTLIVKTVPRHHHRPPPPDNYTLALNKALM  119

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC+ DGKSD +T+FKDL GGYYDAGDAIKFNFPQSFA+T
Sbjct  120  FFNAQRSGKLPKHNNVSWRGNSCLNDGKSDSSTLFKDLTGGYYDAGDAIKFNFPQSFAMT  179

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  180  MLSWSVIEYSAK  191



>gb|KDP32467.1| hypothetical protein JCGZ_13392 [Jatropha curcas]
Length=620

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 171/193 (89%), Gaps = 1/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPAEQKKKK  60

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGALLVSAFLAGFITLIVKTVPRHRHSKPPPDNYTLALHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQ+SGKLPKHNNVSWRGNSC  DGKS    +FKDL GGYYDAGDAIKFNFPQSFAL
Sbjct  121  MFFNAQKSGKLPKHNNVSWRGNSCTHDGKSATDALFKDLSGGYYDAGDAIKFNFPQSFAL  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>ref|XP_004133745.1| PREDICTED: endoglucanase 25-like [Cucumis sativus]
 gb|KGN56301.1| hypothetical protein Csa_3G113920 [Cucumis sativus]
Length=622

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L +  L GLI LIVKTVPRHH P+PPPDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGFLAGLITLIVKTVPRHHHPHPPPDNYTLALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC RDG    +++FKDL GGYYDAGDAIKFNFP SFA+T
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCTRDGDG-SSSLFKDLSGGYYDAGDAIKFNFPASFAMT  179

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  180  MLSWSVIEYSAK  191



>ref|NP_001284449.1| endoglucanase 25-like [Cucumis melo]
 dbj|BAF30815.1| endoglucanase [Cucumis melo]
Length=622

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L +  L GLI LIVKTVPRHH P+PPPDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGFLAGLITLIVKTVPRHHHPHPPPDNYTLALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC RDG    +++FKDL GGYYDAGDAIKFNFP SFA+T
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCTRDGDG-SSSLFKDLSGGYYDAGDAIKFNFPASFAMT  179

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  180  MLSWSVIEYSAK  191



>emb|CAN68337.1| hypothetical protein VITISV_025978 [Vitis vinifera]
Length=616

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVGS+L A  L G I LIVKTVPRHH P+ PPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGSILVAGFLAGFITLIVKTVPRHHHPHAPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRGNS M DGKS+  + +KDLVGGYYDAGDAIKFNFP SFA+TML
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMNDGKSETGSFYKDLVGGYYDAGDAIKFNFPMSFAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_010088712.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36893.1| Endoglucanase 25 [Morus notabilis]
Length=622

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALS R LDETQQSWLLGPT EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSSRPLDETQQSWLLGPTGEQKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG+++ +A+L G I LIVKTVPRH   + PPDNYTLALHKA
Sbjct  61   KKYVDLGCIIVSRKIFIWTVGTLVVSALLAGFITLIVKTVPRHKHGHAPPDNYTLALHKA  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC+ DGKSD +T+FKDL GG+YDAGDAIKFNFP +F+
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCVHDGKSDSSTLFKDLSGGFYDAGDAIKFNFPMAFS  180

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  181  MTMLSWSVIEYSAK  194



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   296 bits (758),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSM+GRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMFGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L + +L G I LIVKTVPRHH  + PPDNYT ALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGLLAGFITLIVKTVPRHHHAHGPPDNYTRALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGK+PKHNNVSWRGNSC++DGKSD +T+ KDLVGGYYDAGDAIKFNFP SFA+T
Sbjct  121  FFNAQRSGKMPKHNNVSWRGNSCLQDGKSDPSTLMKDLVGGYYDAGDAIKFNFPASFAMT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  181  MLSWSVIEYSAK  192



>ref|XP_006356407.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=616

 Score =   287 bits (734),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGG LEI+A DSATDDDRSRNLQD D+AALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRKVFKWTVG ++AAA++ G + LIVKTVP+H   NPPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKVFKWTVGCIIAAALIAGFVTLIVKTVPKHRHHNPPPDNYTLALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRG+S ++DGK+D +T FK+LVGGYYDAGDAIKFNFPQSFALTML
Sbjct  121  NAQRSGKLPKHNNVSWRGSSALQDGKTDGSTTFKNLVGGYYDAGDAIKFNFPQSFALTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEY AK
Sbjct  181  SWSVIEYPAK  190



>gb|KJB66549.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=496

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>emb|CDP17765.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVGS+LAA +LVG I LIVKTVPRHH   PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGSILAAGLLVGFITLIVKTVPRHHHKGPPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRGNSC+ DGKS  ++  K+LVGGYYDAGDAIKFNFP SFA+TML
Sbjct  121  NAQRSGKLPKHNNVSWRGNSCLNDGKSQSSSAIKNLVGGYYDAGDAIKFNFPASFAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYS K
Sbjct  181  SWSVIEYSGK  190



>ref|XP_002519394.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF43011.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=621

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPAEQKKKK  60

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVG+++ +A+L G I LIVKTVPRHH   PPPDNYTL LHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGALVVSALLAGFITLIVKTVPRHHHSKPPPDNYTLGLHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSG+LPKHNNVSWRG+SC+ DGKS   TIFKDL GGYYDAGDAIKF+FP+SFAL
Sbjct  121  MFFNAQRSGRLPKHNNVSWRGSSCVNDGKSATGTIFKDLAGGYYDAGDAIKFHFPKSFAL  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>ref|XP_004171003.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Cucumis 
sativus]
Length=622

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRD WGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDXWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L +  L GLI LIVKTVPRHH P+PPPDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGFLAGLITLIVKTVPRHHHPHPPPDNYTLALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC RDG    +++FKDL GGYYDAGDAIKFNFP SFA+T
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCTRDGDG-SSSLFKDLSGGYYDAGDAIKFNFPASFAMT  179

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  180  MLSWSVIEYSAK  191



>ref|XP_004238641.1| PREDICTED: endoglucanase 25-like [Solanum lycopersicum]
Length=616

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGG LEI+A DSATDDDRSRNLQD D+AALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRKVFKWT+G ++AAA++ G + LIVKTVP+H   NPPPDNYTLAL KA+MFF
Sbjct  61   DLGCIIVSRKVFKWTLGCIIAAALIAGFVTLIVKTVPKHRHHNPPPDNYTLALRKAIMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRG+S ++DGKSD +T FK+LVGGYYDAGDAIKFNFPQSFALT+L
Sbjct  121  NAQRSGKLPKHNNVSWRGSSALQDGKSDGSTTFKNLVGGYYDAGDAIKFNFPQSFALTVL  180

Query  579  SWSVIEYSAK  608
            SWSVIEY AK
Sbjct  181  SWSVIEYPAK  190



>ref|XP_010521418.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=620

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG++LAA  L G I LIVKTVPRHH  +PPPDNYT+ALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGTILAAGFLAGFITLIVKTVPRHHHKHPPPDNYTVALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK    + +KDLVGGYYDAGD IKFNFP SFA+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGTSGSFYKDLVGGYYDAGDTIKFNFPMSFAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|AAP83128.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEN70809.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|KJB66548.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=618

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEN70810.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEN70797.1| endo-1,4-beta-glucanase [Gossypium schwendimanii]
Length=619

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEN70798.1| endo-1,4-beta-glucanase [Gossypium turneri]
 gb|AEN70811.1| endo-1,4-beta-glucanase [Gossypium armourianum]
 gb|AEN70812.1| endo-1,4-beta-glucanase [Gossypium harknessii]
Length=619

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLTGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEN70816.1| endo-1,4-beta-glucanase [Gossypium gossypioides]
Length=619

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|ADY68791.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70802.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70803.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70804.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70806.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70808.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AAS87601.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68790.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70799.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70801.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70805.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70807.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AAQ08018.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68793.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium raimondii]
 gb|ADY68795.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|AEN70795.1| endo-1,4-beta-glucanase [Gossypium thurberi]
 gb|AEN70796.1| endo-1,4-beta-glucanase [Gossypium laxum]
 gb|AEN70800.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70813.1| endo-1,4-beta-glucanase [Gossypium davidsonii]
 gb|AEN70814.1| endo-1,4-beta-glucanase [Gossypium klotzschianum]
 gb|AEN70815.1| endo-1,4-beta-glucanase [Gossypium aridum]
 gb|AEN70817.1| endo-1,4-beta-glucanase [Gossypium lobatum]
 gb|AEN70818.1| endo-1,4-beta-glucanase [Gossypium trilobum]
 gb|AID55374.1| glycoside hydrolase family 9 A1 [Gossypium hirsutum]
 gb|KJB66547.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=619

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|ADY68794.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQEKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>emb|CAB51903.1| cellulase [Brassica napus]
Length=621

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHHR  PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHRKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|ADY68792.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium herbaceum 
subsp. africanum]
Length=619

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIKFNFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWS+IEYSAK
Sbjct  181  LSWSIIEYSAK  191



>emb|CDX83181.1| BnaA03g23250D [Brassica napus]
Length=621

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHHR  PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHRKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_009134026.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHHR  PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHRKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|AGV22123.1| endo-1,4-beta-glucanase 1 [Betula luminifera]
Length=618

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++ +A L G I LIVK VPRHH  +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGTLIVSAFLAGFITLIVKMVPRHHHSHPPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            N QRSGKLPKHNNVSWRG+SC+ DG ++ + I+KDLVGGYYDAGDAIKFNFP SFA+TML
Sbjct  121  NGQRSGKLPKHNNVSWRGSSCLDDGIAEKSPIYKDLVGGYYDAGDAIKFNFPSSFAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEY+AK
Sbjct  181  SWSVIEYTAK  190



>emb|CDY21449.1| BnaC03g27480D [Brassica napus]
Length=621

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH+ NPPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHQKNPPPDNYTVALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVGS+L A  L G I LIVKTVPRHH P+ PPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGSILVAGFLAGFITLIVKTVPRHHHPHAPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRGNS M DGKS+  + +KDLVGGYYDAGDAIKFNFP SFA+TML
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMNDGKSETGSFYKDLVGGYYDAGDAIKFNFPMSFAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_011022354.1| PREDICTED: endoglucanase 25-like [Populus euphratica]
Length=619

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SFA+TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|KFK26611.1| hypothetical protein AALP_AA8G271400 [Arabis alpina]
Length=621

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPR+H  +PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRNHHKHPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLP+HNNVSWRGNS ++DGK    + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQRSGKLPRHNNVSWRGNSGLQDGKGTPGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>dbj|BAH57006.1| AT5G49720 [Arabidopsis thaliana]
Length=555

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_007222007.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
 gb|EMJ23206.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
Length=622

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 177/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRHHR  PPPDNYTLALHK+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHHRGRPPPDNYTLALHKS  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDAGDAIKFNFP+SFA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDASTTFKDLAGGFYDAGDAIKFNFPKSFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>ref|XP_007147545.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
 gb|ESW19539.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
Length=619

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSAT++DRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATEEDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+VL AA L G I LIV T+PRHH  +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGTVLFAAFLAGFIALIVNTIPRHHHKHPPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            NAQRSGKLPKHNNVSWRGNS M+DGKS D ++  KDLVGG+YDAGDAIKFNFP SF++TM
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMQDGKSSDTSSAIKDLVGGFYDAGDAIKFNFPASFSITM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEO97184.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97211.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLGDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|NP_199783.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 sp|Q38890.1|GUN25_ARATH RecName: Full=Endoglucanase 25; AltName: Full=Cellulase homolog 
OR16pep; AltName: Full=Endo-1,4-beta glucanase 25; AltName: 
Full=Protein KORRIGAN; AltName: Full=Protein RADIALLY SWOLLEN 
2 [Arabidopsis thaliana]
 gb|AAB60304.1| cellulase [Arabidopsis thaliana]
 gb|AAC33467.1| cellulase [Arabidopsis thaliana]
 gb|AAC35344.1| cellulase [Arabidopsis thaliana]
 gb|AAC83240.1| endo-1,4-beta-D-glucanase KORRIGAN [Arabidopsis thaliana]
 dbj|BAA98160.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
 gb|AED95850.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
Length=621

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_006385837.1| endo-1 family protein [Populus trichocarpa]
 gb|ERP63634.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLGDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_003594425.1| Endoglucanase [Medicago truncatula]
 gb|ABD32918.1| Glycoside transferase, six-hairpin, subgroup [Medicago truncatula]
 gb|AES64676.1| membrane-anchored endo-1,4-beta-glucanase [Medicago truncatula]
Length=622

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  209
            MSMYGRDPWGGPLEI+A DSATD+DRSRNL +LDRAALSR LDETQQSWLLGPTEQ KKK
Sbjct  1    MSMYGRDPWGGPLEINATDSATDEDRSRNLNELDRAALSRPLDETQQSWLLGPTEQKKKK  60

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            +YVDLGCIIVSRK+F WTVG++L AA + G + LIVKTVPRHH+ +PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTILFAAFVAGFVTLIVKTVPRHHKKHPPPDNYTLALHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDAT-IFKDLVGGYYDAGDAIKFNFPQSFA  566
            MFFNAQ+SGKLPKHNNVSWRGNS M+DGK D  +   KDLVGGYYDAGDAIKFNFPQ+F+
Sbjct  121  MFFNAQKSGKLPKHNNVSWRGNSGMQDGKGDGVSAAIKDLVGGYYDAGDAIKFNFPQAFS  180

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYS K
Sbjct  181  ITMLSWSVIEYSGK  194



>ref|XP_010441020.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHHKTPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SG+LPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|AAN72232.1| At5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_010442441.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHHKTPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SG+LPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_002865753.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42012.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSR++F WTVG+++AAA+L G I LIVKTVPRHH  +PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRQIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKSPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_006402246.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43699.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=620

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPR+H  NPPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRNHHKNPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRGNS ++DGK  DA+ +KDLVGGYYDAGD IKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKG-DASFYKDLVGGYYDAGDTIKFNFPMAYAMTML  179

Query  579  SWSVIEYSAK  608
            SWSVIEYS K
Sbjct  180  SWSVIEYSHK  189



>gb|AEO97265.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AHA41508.1| endo-1,4 -beta-glucanase [Populus deltoides]
Length=619

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGC+IVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCVIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLGDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEO97182.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97209.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97236.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97237.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97242.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97246.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97249.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97253.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97255.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97257.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97260.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97261.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97262.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97264.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97268.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97271.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97273.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97274.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78626.1| korrigan [Populus tomentosa]
Length=610

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEO97238.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEO97239.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97240.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97241.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97243.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97244.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97245.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97247.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97248.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97250.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97251.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97254.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97256.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97258.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97259.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97263.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97266.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97269.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97270.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97272.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_006402245.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43698.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=648

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPR+H  NPPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRNHHKNPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRGNS ++DGK  DA+ +KDLVGGYYDAGD IKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKG-DASFYKDLVGGYYDAGDTIKFNFPMAYAMTML  179

Query  579  SWSVIEYSAK  608
            SWSVIEYS K
Sbjct  180  SWSVIEYSHK  189



>gb|AEO97252.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97267.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHRHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AAT75041.1| Cel9A [Populus tremula x Populus tremuloides]
Length=619

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQVSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>dbj|BAC22690.1| endo-1,4-beta-D-glucanase [Pyrus communis]
Length=621

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 172/193 (89%), Gaps = 2/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPTEQKKK  209
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ ++KK
Sbjct  1    MSMYGRDPWGGPLEINTTDSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            +YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+L
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHSRPPPDNYTLALRKSL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPKHNNVSWRGNSC+RDG +D +T FKDL GG+YDAGDAIKFNFP SFA+
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDG-NDPSTTFKDLAGGFYDAGDAIKFNFPASFAM  179

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  180  TMLSWSVIEYSAK  192



>ref|XP_010482263.1| PREDICTED: endoglucanase 25-like [Camelina sativa]
Length=621

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH  NPPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHHKNPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SG+LPKHNNVSWRGNS ++DG+ +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGRGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_006281810.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
 gb|EOA14708.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
Length=621

 Score =   277 bits (709),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I+LIVKTVPRHH+ +PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFIILIVKTVPRHHKKDPPPDNYTLALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SG+LPKHNNVSWRGNS ++DG+ +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGRGETGSFYKDLVGGYYDAGDAIKFNFPMAYAITML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_009123553.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   277 bits (709),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLNDVDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG V+AAA+L G I LIVKTVPRHH  NP PDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGIVVAAALLAGFITLIVKTVPRHHNKNPAPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRG+S ++DGK D  + +KDLVGGYYDAGD IKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGSSGLQDGKGDSGSFYKDLVGGYYDAGDTIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>emb|CDY37768.1| BnaA10g05530D [Brassica napus]
Length=621

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLNDVDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG V+AAA+L G I LIVKTVPRHH  NP PDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGIVVAAALLAGFITLIVKTVPRHHHKNPAPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRG+S ++DGK D  + +KDLVGGYYDAGD IKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGSSGLQDGKGDSGSFYKDLVGGYYDAGDTIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>dbj|BAF42036.1| cellulase1 [Pyrus communis]
Length=622

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTTDSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHSRPPPDNYTLALRKS  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC+RDG +D +T FKDL GG+YDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLRDG-NDPSTTFKDLAGGFYDAGDAIKFNFPASFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSW VIEYSAK
Sbjct  180  MTMLSWGVIEYSAK  193



>ref|XP_008339246.1| PREDICTED: endoglucanase 25-like [Malus domestica]
Length=622

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRHH   PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHHHARPPPDNYTLALRKS  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDPSTTFKDLAGGFYDAGDAIKFNFPASFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>gb|ABD62083.1| endo-1,4-beta-glucancase precursor [Glycine max]
Length=604

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWT+G+VL AA L GLI LIV TVPRH   +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTLGTVLFAAFLAGLIALIVNTVPRHRHKHPPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            NAQRSGKLPKHNNVSWRGNS M+DGKS D +   KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMQDGKSSDHSAAIKDLVGGYYDAGDAIKFNFPASFSITM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_010266669.1| PREDICTED: endoglucanase 9-like [Nelumbo nucifera]
Length=619

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 173/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAAL-SRSLDETQQSWLLGPTEQKKK  209
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAAL SR LDETQQSWLLGP+EQKKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALNSRPLDETQQSWLLGPSEQKKK  60

Query  210  R-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            + YVDLGCIIVSRK+F WTVG++LAA  + G + LIVKTVPRHH    PPDNYTLALHKA
Sbjct  61   KKYVDLGCIIVSRKLFVWTVGTILAAGFIAGFVTLIVKTVPRHHHSRAPPDNYTLALHKA  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHNNVSWRGNS MRDG SD+ ++ K+LVGGYYDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGPLPKHNNVSWRGNSGMRDGLSDN-SVNKNLVGGYYDAGDAIKFNFPASFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>emb|CDX71601.1| BnaC09g26420D [Brassica napus]
Length=621

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK++V
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLNDVDRAALSRPLDETQQSWLLGPTEQKKKKFV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG V+AAA+L G I LI+KTVPRHH  NP PDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGIVVAAALLAGFITLIIKTVPRHHHKNPAPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNVSWRG+S ++DGK D  + +KDLVGGYYDAGD IKFNFP ++A+TML
Sbjct  121  NAQKSGKLPRHNNVSWRGSSGLQDGKGDSGSFYKDLVGGYYDAGDTIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_003535026.1| PREDICTED: endoglucanase 25 [Glycine max]
 gb|KHN40745.1| Endoglucanase 25 [Glycine soja]
Length=618

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWT+G++L AA L GLI LIV TVPRH   +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTLGTILFAAFLAGLIALIVNTVPRHRHKHPPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            NAQRSGKLPKHNNVSWRGNS M+DGKS D +   KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMQDGKSSDHSAAIKDLVGGYYDAGDAIKFNFPASFSITM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AAM63370.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=621

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDP GGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPSGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|AAK59818.1| AT5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+ V
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKDV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDAGDAIKFNFP ++A+TML
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIKFNFPMAYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|ADB82903.1| membrane-bound endo-beta-1,4-glucanase [Populus alba x Populus 
grandidentata]
Length=619

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLAL KALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALRKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_008218604.1| PREDICTED: endoglucanase 25 [Prunus mume]
Length=1109

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH R  PPPDNYTLALHK+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHPRGRPPPDNYTLALHKS  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDAGDAIKFNFP+SFA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDASTTFKDLAGGFYDAGDAIKFNFPKSFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGG LEI+A DSATDDDRSRNL DLDRA+LSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGSLEINAADSATDDDRSRNLNDLDRASLSRPLDETQQSWLLGPAEQKKKK  60

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVGS++AAA+L GLI +IV+ VPRH   + P DNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGSIVAAALLGGLITVIVEAVPRHRHNHTPADNYTLALHKALM  120

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SFA+T
Sbjct  121  FFNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFAMT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  181  MLSWSVIEYSAK  192



>ref|XP_003546229.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=618

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCIIVSRK+FKWT+G++L AA L GLI LIV TVPRH   +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTLGTLLFAAFLAGLIALIVNTVPRHRHKHPPPDNYTLALHKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            N QRSGKLPKHNNVSWRGNS M+DGKS D +   KDLVGGYYDAGDAIKFNFP SF++TM
Sbjct  121  NGQRSGKLPKHNNVSWRGNSGMQDGKSSDHSAAIKDLVGGYYDAGDAIKFNFPASFSITM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AAS45400.1| endo-1,4-beta-glucanase [Populus tremuloides]
Length=619

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKIY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+  WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKICVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SF++TM
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFSMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEY+AK
Sbjct  181  LSWSVIEYNAK  191



>ref|XP_006858422.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
 gb|ERN19889.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
Length=617

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 171/192 (89%), Gaps = 2/192 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQ+ DRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINA-DSATDDDRSRNLQEFDRAALSRQLDETQQSWLLGPGEQKKKK  59

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+FKWTVGS+L   +L GLI LIVKTVPRHH   PPPDNYT ALHKALM
Sbjct  60   YVDLGCIIVSRKLFKWTVGSILVCGLLAGLITLIVKTVPRHHHAKPPPDNYTQALHKALM  119

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSG LPKHNNVSWRGNS M+DG SD +   K+LVGG+YDAGDAIKFNFP SFA+T
Sbjct  120  FFNAQRSGPLPKHNNVSWRGNSGMKDGLSDPSAR-KNLVGGFYDAGDAIKFNFPASFAMT  178

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  179  MLSWSVIEYSAK  190



>ref|XP_002299405.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE84210.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SFA+TM
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEO97183.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97210.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97275.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97276.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97277.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97278.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97279.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97280.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97281.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97282.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97284.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97285.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97286.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97287.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97289.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97290.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97293.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97295.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97296.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97298.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97301.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97304.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97307.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97311.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97312.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97313.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78627.1| korrigan [Populus tomentosa]
Length=610

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SFA+TM
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|AEO97185.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97212.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SFA+TM
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>gb|EYU35397.1| hypothetical protein MIMGU_mgv1a003033mg [Erythranthe guttata]
Length=613

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 172/190 (91%), Gaps = 4/190 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            M+GRDPWGGPLEI A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MFGRDPWGGPLEIAA-DSATDDDRSRNLQDYDRAALSRPLDETQQSWLLGPGEQKKKKYV  59

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGC+IVSRK+F WTVG+++AA +L GLIVLIVKTVPRHH   PPPDNYTLAL+KALMFF
Sbjct  60   DLGCVIVSRKIFLWTVGTLVAAGLLAGLIVLIVKTVPRHHHRPPPPDNYTLALNKALMFF  119

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSGKLPKHNNVSWRGNSC++DG   +  +FKDL GG+YDAGDAIKFNFPQSFA+TML
Sbjct  120  NAQRSGKLPKHNNVSWRGNSCLKDG---EPGLFKDLTGGFYDAGDAIKFNFPQSFAMTML  176

Query  579  SWSVIEYSAK  608
            SWSVIEY AK
Sbjct  177  SWSVIEYGAK  186



>ref|XP_004486415.1| PREDICTED: endoglucanase 25-like [Cicer arietinum]
Length=620

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 170/192 (89%), Gaps = 2/192 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGGPLEI+A DSATD+DRSRNLQ+LDRAALSR LDETQQSWLLGPTEQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDEDRSRNLQELDRAALSRPLDETQQSWLLGPTEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVG ++ AA + G + LIVKTVPRHH  +PPPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGIIVFAAFVAGFVTLIVKTVPRHHHKHPPPDNYTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDAT-IFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FNAQ+SGKLPKHNNVSWRG S M+DGK D  +   KDLVGGYYDAGDAIKFNFP +F++T
Sbjct  121  FNAQKSGKLPKHNNVSWRGTSGMQDGKGDGVSAAIKDLVGGYYDAGDAIKFNFPAAFSIT  180

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYS K
Sbjct  181  MLSWSVIEYSGK  192



>gb|AEO97283.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97288.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97291.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97292.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97294.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97297.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97299.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97300.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97302.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97303.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97305.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97306.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97308.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97309.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97310.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DN+TLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNFTLALHKALMF  120

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDAGDAIKF+FP SFA+TM
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIKFHFPASFAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_004301591.2| PREDICTED: endoglucanase 25 [Fragaria vesca subsp. vesca]
Length=1115

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 5/192 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKKKR  212
            MYGRDPWGGPLEI A DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKKK+
Sbjct  1    MYGRDPWGGPLEI-AADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKKKK  59

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCIIVSRK+F WTVG++L + +L GLIVLIVKTVPRHH   PPPDNYT+ALHKALM
Sbjct  60   YVDLGCIIVSRKIFLWTVGTLLVSGLLAGLIVLIVKTVPRHHHAKPPPDNYTVALHKALM  119

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQ+SGKLPKHNNVSWRGNSC++DG  +  TIFKDLVGGYYDAGDAIKFNFPQSFA+T
Sbjct  120  FFNAQKSGKLPKHNNVSWRGNSCLKDG--EPGTIFKDLVGGYYDAGDAIKFNFPQSFAMT  177

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  178  MLSWSVIEYSAK  189



>ref|XP_010529892.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 170/193 (88%), Gaps = 1/193 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            M+MY RDPWGGPLEIHA DSATDDDRSRNLQD   AA SR LDETQQSWLLGP+EQKKK+
Sbjct  1    MAMYVRDPWGGPLEIHAADSATDDDRSRNLQDAGHAAYSRPLDETQQSWLLGPSEQKKKK  60

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVG++LAA  L GLI LI+K VPR+H  +PPPDNYT+AL KAL
Sbjct  61   KYVDLGCIIVSRKIFIWTVGTILAAGFLAGLIALIMKFVPRNHHKHPPPDNYTVALGKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPK+NNVSWRGNSC++DGK    + +KDLVGGYYDAGDAIKFNFP SFA+
Sbjct  121  MFFNAQRSGKLPKYNNVSWRGNSCLQDGKGTRGSFYKDLVGGYYDAGDAIKFNFPMSFAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>gb|ABR15471.1| endoglucanase [Pinus taeda]
Length=619

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGG LEI+A DSATDDDRSRNLQD DR+ALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGALEINA-DSATDDDRSRNLQDFDRSALSRQLDETQQSWLLGPGEQKKKK  59

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCI+ SR VFKW V S+L +  + GL+ LIVK VPRH    PPPD+YT ALHKALM
Sbjct  60   YVDLGCIVCSRTVFKWIVISILLSGSIAGLVTLIVKLVPRHKHSAPPPDSYTKALHKALM  119

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSG LPKHNNVSWRGNSCMRDG SD  +   +LVGG+YDAGDAIKFNFP +FA+T
Sbjct  120  FFNAQRSGPLPKHNNVSWRGNSCMRDGLSDPGSNHANLVGGFYDAGDAIKFNFPAAFAMT  179

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYS K
Sbjct  180  MLSWSVIEYSGK  191



>ref|XP_009355455.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Pyrus x bretschneideri]
Length=1064

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A+L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSALLAGFITLIVKTVPRHRHARPPPDNYTLALRKS  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG    AT FKDL GG+YDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDGNDPSAT-FKDLAGGFYDAGDAIKFNFPASFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>ref|XP_008379019.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Malus domestica]
Length=1066

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 173/194 (89%), Gaps = 3/194 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ E+KK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEKKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHARPPPDNYTLALRKS  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDPSTTFKDLAGGFYDAGDAIKFNFPASFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>ref|XP_006413454.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
 gb|ESQ54907.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
Length=624

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DS TDDDRSRNLQ+LDRAA SR LD TQQSWLLGPTE KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSLTDDDRSRNLQELDRAAFSRPLDATQQSWLLGPTEPKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGC++VSRK+F WT+G+ +  A L G I  IVK VPRH    P PDN+TLALHKAL+FF
Sbjct  61   DLGCLLVSRKIFLWTLGTFVLTAFLAGSITTIVKKVPRHKHEPPKPDNFTLALHKALLFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            +AQ+SGKLP+HNNVSWRG+SC++DGK D   ++KDLVGGYYDAGDAIKF+FP S+A+ +L
Sbjct  121  HAQKSGKLPEHNNVSWRGSSCLQDGKGDQGQVYKDLVGGYYDAGDAIKFSFPMSYAMAVL  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>ref|XP_009340771.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Pyrus 
x bretschneideri]
Length=619

 Score =   266 bits (681),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 169/194 (87%), Gaps = 6/194 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  206
            MSMYGRDPWGGP      DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPXTA---DSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  58   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHARPPPDNYTLALRKS  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSGKLPKHNNVSWRGNSC+RDG +D +T FKDL GG+YDAGDAIKFNFP SFA
Sbjct  118  LMFFNAQRSGKLPKHNNVSWRGNSCLRDG-NDPSTTFKDLAGGFYDAGDAIKFNFPASFA  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  177  MTMLSWSVIEYSAK  190



>gb|KCW62543.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=500

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  206
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  207  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            +LMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDAGDAIKFNFP+SF
Sbjct  121  SLMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDTSWTLKDLVGGYYDAGDAIKFNFPKSF  180

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYSAK
Sbjct  181  AMTMLSWSVIEYSAK  195



>gb|AEL88496.1| membrane-bound endo-1,4-beta-glucanase [Picea glauca]
Length=617

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DR+ALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINA-DSATDDDRSRNLQDFDRSALSRQLDETQQSWLLGPGEQKKKKYV  59

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+ SR VFKW V S+L +  + GL+ LIVK VPRH+   PPPD+YT ALHKALMFF
Sbjct  60   DLGCIVCSRTVFKWIVISILLSGSIAGLVTLIVKLVPRHNNSAPPPDSYTKALHKALMFF  119

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSG LPKHNNVSWRGNS MRDG SD       LVGG+YDAGDAIKFNFP +FA+TML
Sbjct  120  NAQRSGPLPKHNNVSWRGNSGMRDGLSDPGAAHASLVGGFYDAGDAIKFNFPGAFAMTML  179

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  180  SWSVIEYSAK  189



>ref|XP_010682188.1| PREDICTED: endoglucanase 25 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 169/193 (88%), Gaps = 4/193 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKKKR  212
            MYGRDPWGGPLEI A DSATDDDRSRNLQD DRAALS  R LDETQQSWLLGP EQKKK+
Sbjct  1    MYGRDPWGGPLEI-AADSATDDDRSRNLQDYDRAALSSSRQLDETQQSWLLGPAEQKKKK  59

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGCIIVSRK+F WTVGS+L A +L GLI LIVK  PRHH+P PPPDNYT  LHKAL
Sbjct  60   KYVDLGCIIVSRKIFFWTVGSILGAGLLAGLIALIVKLAPRHHKPPPPPDNYTQGLHKAL  119

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQ+SGKLPKHNNVSWRGNSC+ DGK +  T +KDL GG+YDAGDAIKFNFP+SFA+
Sbjct  120  MFFNAQKSGKLPKHNNVSWRGNSCLEDGKGESGTFYKDLKGGFYDAGDAIKFNFPKSFAM  179

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  180  TMLSWSVIEYSAK  192



>gb|AFD33696.1| korrigan [Eucalyptus camaldulensis]
Length=623

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  206
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  207  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDAGDAIKFNFP+SF
Sbjct  121  ALMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDSSWTLKDLVGGYYDAGDAIKFNFPKSF  180

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYSAK
Sbjct  181  AMTMLSWSVIEYSAK  195



>ref|XP_010065200.1| PREDICTED: endoglucanase 25-like [Eucalyptus grandis]
 gb|KCW62542.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=623

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  206
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  207  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            +LMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDAGDAIKFNFP+SF
Sbjct  121  SLMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDTSWTLKDLVGGYYDAGDAIKFNFPKSF  180

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYSAK
Sbjct  181  AMTMLSWSVIEYSAK  195



>ref|XP_003529689.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKK--  206
            MSMYGRDPWGGPLEIHA DSATDD+RSRNLQ+LDR AL    DETQQSWLLG  EQKK  
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDERSRNLQELDRGAL----DETQQSWLLGAGEQKKNK  56

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K YVDLGCIIVSRK+F WT+G++   A L   I LIVKTVPRHH   PPPDNYT+ALHKA
Sbjct  57   KTYVDLGCIIVSRKLFIWTLGTLAVFAFLSAFITLIVKTVPRHHHKPPPPDNYTIALHKA  116

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDA-TIFKDLVGGYYDAGDAIKFNFPQSF  563
            L+FFNAQ+SGKLP+HNNVSWRGNSC+ DGK D    + KDLVGGYYDAGDAIKFNFP SF
Sbjct  117  LLFFNAQKSGKLPRHNNVSWRGNSCLHDGKDDGVPPVIKDLVGGYYDAGDAIKFNFPMSF  176

Query  564  ALTMLSWSVIEYSAK  608
            +LTMLSWSVIEYS K
Sbjct  177  SLTMLSWSVIEYSGK  191



>gb|AFY03622.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=623

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  206
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  207  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            +LMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDAGDAIKFNFP+SF
Sbjct  121  SLMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDXSWTLKDLVGGYYDAGDAIKFNFPKSF  180

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYSAK
Sbjct  181  AMTMLSWSVIEYSAK  195



>gb|ABR16291.1| unknown [Picea sitchensis]
 gb|ACN40901.1| unknown [Picea sitchensis]
Length=617

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGG LEI+A DSATDDDRSRNLQD DR+ALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGALEINA-DSATDDDRSRNLQDFDRSALSRQLDETQQSWLLGPGEQKKKKYV  59

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+ SR VFKW V S+L +  + GL+ LIVK VPRH+   PPPD+YT ALHKALMFF
Sbjct  60   DLGCIVCSRTVFKWIVISILLSGSIAGLVTLIVKLVPRHNNSAPPPDSYTKALHKALMFF  119

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQRSG LPKHNNVSWRGNS MRDG SD       LVGG+YDAGDAIKFNFP +FA+TML
Sbjct  120  NAQRSGPLPKHNNVSWRGNSGMRDGLSDPGAAHASLVGGFYDAGDAIKFNFPGAFAMTML  179

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  180  SWSVIEYSAK  189



>gb|EPS69180.1| hypothetical protein M569_05586 [Genlisea aurea]
Length=615

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 168/193 (87%), Gaps = 4/193 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPT-EQKKK  209
            MSMYGRDPWGG LEI A DSATDD+RSRNLQD DRAALSR LDETQQSWLLG T E KKK
Sbjct  1    MSMYGRDPWGGSLEI-AGDSATDDERSRNLQDYDRAALSRPLDETQQSWLLGRTGEMKKK  59

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            +YVDLGCIIVSRK+F WTVGS+LAAA L G I +IVK VPRHH   PP DNYT+ALH AL
Sbjct  60   KYVDLGCIIVSRKIFVWTVGSILAAAFLAGFITMIVKLVPRHHHKPPPEDNYTVALHDAL  119

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPKHNNVSWRGNSC+ DG++   +IF DL GGYYDAGDAIKF+FPQ+F+L
Sbjct  120  MFFNAQRSGKLPKHNNVSWRGNSCVNDGET--GSIFSDLSGGYYDAGDAIKFHFPQAFSL  177

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  178  TMLSWSVIEYSAK  190



>ref|XP_003550680.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 7/195 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ--KK  206
            MSMYGRDPWGGPLEIHA DSATDD+RSRNLQ+LDR A    LDETQQSWLLG  EQ  KK
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDERSRNLQELDRGA----LDETQQSWLLGAGEQKKKK  56

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            KRYVDLGCIIVSRK+F WT+G++   A L G I LIVKTVPRHH   PPPDNYT+ALHKA
Sbjct  57   KRYVDLGCIIVSRKLFIWTLGTLAVCAFLAGFITLIVKTVPRHHHKPPPPDNYTIALHKA  116

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDA-TIFKDLVGGYYDAGDAIKFNFPQSF  563
            L+FFNAQ+SGKLP+HNNVSWRGNS ++DGK D    + KDLVGGYYDAGDAIKFNFP SF
Sbjct  117  LLFFNAQKSGKLPRHNNVSWRGNSGLQDGKGDGVPPVIKDLVGGYYDAGDAIKFNFPMSF  176

Query  564  ALTMLSWSVIEYSAK  608
            ++TMLSWSVIEYS K
Sbjct  177  SMTMLSWSVIEYSGK  191



>ref|XP_007154086.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
 gb|ESW26080.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
Length=620

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 170/196 (87%), Gaps = 8/196 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEIHA DSATDD+RSRNLQ+LDR AL    DETQQSWLLG  EQKKK+
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDERSRNLQELDRPAL----DETQQSWLLGAGEQKKKK  56

Query  213  --YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
              YVDLGCIIVSRK+F WT+G++  +AVL GLI LIVKTVPRHH    PPDNYTLALHKA
Sbjct  57   KKYVDLGCIIVSRKIFIWTLGTLAVSAVLAGLITLIVKTVPRHHHKPSPPDNYTLALHKA  116

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDAT--IFKDLVGGYYDAGDAIKFNFPQS  560
            L+FFNAQ+SGKLP+HNNVSWRGNSCM DGK  + T  + KDL+GGYYDAGDAIKF+FP++
Sbjct  117  LLFFNAQKSGKLPRHNNVSWRGNSCMDDGKKSEGTSGVIKDLIGGYYDAGDAIKFHFPKA  176

Query  561  FALTMLSWSVIEYSAK  608
            FA+TMLSWSVIEYSAK
Sbjct  177  FAMTMLSWSVIEYSAK  192



>ref|XP_009400506.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLG----PTEQKK  206
            M+GRDPWGGPLEI   DSATDDDRSRNLQ+ DRAALSR LDETQQSWLL     P+ +KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRNLQEYDRAALSRQLDETQQSWLLAAPGDPSGKKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            KRYVDLGCI+VSRK+F WT+GSVL   +L+GLI+LIVKTVP  HRP PPPD YTLALHKA
Sbjct  61   KRYVDLGCIVVSRKLFLWTLGSVLGVGLLIGLIMLIVKTVPHRHRPPPPPDEYTLALHKA  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHNNVSWRGNS M+DG SDDA I + LVGGYYDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGPLPKHNNVSWRGNSGMKDGLSDDA-IRRSLVGGYYDAGDAIKFNFPMSFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYS K
Sbjct  180  MTMLSWSVIEYSDK  193



>gb|KHN14382.1| Endoglucanase 25 [Glycine soja]
Length=652

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 170/225 (76%), Gaps = 35/225 (16%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQS--------------  176
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQS              
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKRSR  60

Query  177  --------------------WLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlv  296
                                WLLGP EQKKK+YVDLGCIIVSRK+FKWT+G++L AA L 
Sbjct  61   NLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYVDLGCIIVSRKIFKWTLGTILFAAFLA  120

Query  297  glivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGK  476
            GLI LIV TVPRH   +PPPDNYTLALHKALMFFN QRSGKLPKHNNVSWRGNS M+DGK
Sbjct  121  GLIALIVNTVPRHRHKHPPPDNYTLALHKALMFFNGQRSGKLPKHNNVSWRGNSGMQDGK  180

Query  477  SDD-ATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            S D +   KDLVGGYYDAGDAIKFNFP SF++TMLSWSVIEYSAK
Sbjct  181  SSDHSAAIKDLVGGYYDAGDAIKFNFPASFSITMLSWSVIEYSAK  225



>ref|XP_010433798.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=622

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 3/193 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  215
            MYGRDPWGGPLEI+A DS  D+DR SRNLQDLDRAALSR LDETQQSWLLGP   KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSVIDEDRRSRNLQDLDRAALSRPLDETQQSWLLGPKVLKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCI+VSRK+F WT+G ++  A + G I LIVKTVPRH +  P PDNYTLAL++ALMF
Sbjct  61   VDLGCILVSRKIFLWTLGIIVVTAFISGFITLIVKTVPRHTQKPPSPDNYTLALNEALMF  120

Query  396  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            FNAQ+SGKLPK N  NVSWRG+SC++DGK D    +KDLVGGYYDAGD IKFNFP S+A+
Sbjct  121  FNAQQSGKLPKGNIYNVSWRGDSCLQDGKEDPGQCYKDLVGGYYDAGDTIKFNFPMSYAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>ref|XP_010439066.1| PREDICTED: endoglucanase 21 [Camelina sativa]
Length=618

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 3/193 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  215
            MYGRDPWGGPLEI+A DS  D+DR SRNLQDLDRAALSR LDETQQSWLLGP   KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSVIDEDRRSRNLQDLDRAALSRPLDETQQSWLLGPKVLKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCI+VSRK+F WT+G ++  A + G I LIVKTVPRH    P PDNYTLAL++ALMF
Sbjct  61   VDLGCILVSRKIFLWTLGIIVVTAFISGFITLIVKTVPRHTHKPPSPDNYTLALNQALMF  120

Query  396  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            FNAQ+SGKLPK N  NVSWRG+SC++DGK D    +KDLVGGYYDAGD IKFNFP S+A+
Sbjct  121  FNAQQSGKLPKGNIYNVSWRGDSCLQDGKGDPGQCYKDLVGGYYDAGDTIKFNFPMSYAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>ref|XP_009395086.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLG----PTEQKK  206
            M+GRDPWGG LEI   DSATDDDRSRNLQD DRAALSR LDETQQSWLL     P+ +KK
Sbjct  1    MFGRDPWGGSLEISNADSATDDDRSRNLQDYDRAALSRQLDETQQSWLLAAPGDPSGKKK  60

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            KRYVDLGC++VSRK+F WTVGSVL   +L+G I+LI+KTVP HHRP PPPD YT ALHKA
Sbjct  61   KRYVDLGCVVVSRKLFLWTVGSVLGIGLLIGFIMLIIKTVPHHHRPPPPPDEYTQALHKA  120

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHNNVSWRGNS M+DG SDD ++ K+LVGGYYDAGDAIKFNFP SFA
Sbjct  121  LMFFNAQRSGPLPKHNNVSWRGNSGMKDGLSDD-SVKKNLVGGYYDAGDAIKFNFPMSFA  179

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  180  MTMLSWSVIEYSAK  193



>gb|ABP96983.1| cellulase [Colocasia esculenta]
Length=618

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 171/193 (89%), Gaps = 4/193 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--KKK  209
            M+G +PWGGPLEI   DSATDDDRSRNLQDLDRAALSR LDETQQSWLL GP +Q  KKK
Sbjct  1    MFGHNPWGGPLEISNADSATDDDRSRNLQDLDRAALSRQLDETQQSWLLAGPGDQGKKKK  60

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            RYVDLGC++VSRK F WTVGSVLA  +LVGLI+LI+KTVP HHRP PPPD+YT ALHKAL
Sbjct  61   RYVDLGCMVVSRKHFLWTVGSVLAVGLLVGLIMLIIKTVPHHHRPPPPPDSYTQALHKAL  120

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSG +P+HNNVSWRGNS M+DG SD+AT  K+LVGGYYDAGDAIKFNFP SFA+
Sbjct  121  MFFNAQRSGPIPRHNNVSWRGNSGMKDGISDNATK-KNLVGGYYDAGDAIKFNFPMSFAM  179

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  180  TMLSWSVIEYSAK  192



>ref|XP_010448587.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=620

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 161/193 (83%), Gaps = 3/193 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  215
            MYGRDPWGGPLEI+A DS  D+DR SRNLQDLDRAALSR LDETQQSWLLGP   KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSVIDEDRRSRNLQDLDRAALSRPLDETQQSWLLGPKVLKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCI+VSRK+F WT+G ++  A + G I LI KTVPRH    P PDNYTLAL++ALMF
Sbjct  61   VDLGCILVSRKIFLWTLGIIVVTAFISGFITLIAKTVPRHTHKPPSPDNYTLALNEALMF  120

Query  396  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            FNAQ+SGKLPK N  NVSW+G+SC++DGK D    +KDLVGGYYDAGD IKFNFP S+A+
Sbjct  121  FNAQQSGKLPKGNIYNVSWKGDSCLQDGKGDQGQCYKDLVGGYYDAGDTIKFNFPMSYAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  181  TMLSWSVIEYSAK  193



>gb|KFK22234.1| hypothetical protein AALP_AAs42893U000400 [Arabis alpina]
Length=616

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 162/190 (85%), Gaps = 4/190 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DS TDDDRSRNLQDLDR+   R LDETQQSWLLGPTE KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSTTDDDRSRNLQDLDRSTRPRPLDETQQSWLLGPTEHKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI++SRK+F W++G++L  A L G + LI KT+PR H  NPPPDNYT+ALHKAL FF
Sbjct  61   DLGCILLSRKIFLWSLGTILLTASLAGFVTLITKTLPRPHFKNPPPDNYTIALHKALKFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+ NNVSWRG+SC++DG       +KDLVGGYYDAGDAIKF+FP SFA+TML
Sbjct  121  NAQKSGKLPEGNNVSWRGDSCLKDGDFS----YKDLVGGYYDAGDAIKFHFPMSFAMTML  176

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  177  SWSVIEYSAK  186



>gb|EPS66085.1| hypothetical protein M569_08689 [Genlisea aurea]
Length=615

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 167/193 (87%), Gaps = 4/193 (2%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPT-EQKKK  209
            MS+YGRDPWGGPLEI A DSATDD+RSRN QD DRAALSR+LDETQQSWLLG T E KKK
Sbjct  1    MSIYGRDPWGGPLEIAA-DSATDDERSRNFQDYDRAALSRTLDETQQSWLLGRTGEVKKK  59

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            RYVDLG IIVSRK+F WTVGS+LAA  L G I +IVK VPRHHRP PP DNYT ALH AL
Sbjct  60   RYVDLGFIIVSRKIFIWTVGSLLAAGFLAGFITMIVKLVPRHHRPPPPEDNYTAALHDAL  119

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSG+LPKHNNVSWRGNSCM DG+ +  T F+DL GGYYDAGDAIKF+FPQ+F+L
Sbjct  120  MFFNAQRSGRLPKHNNVSWRGNSCMNDGEPN--TPFQDLSGGYYDAGDAIKFHFPQAFSL  177

Query  570  TMLSWSVIEYSAK  608
            T+LSWSVIEYS K
Sbjct  178  TILSWSVIEYSGK  190



>ref|XP_002867672.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=620

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DS TDDDRSRNLQDLDRA  SR LDETQQSWLLGP   KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSLTDDDRSRNLQDLDRATPSRPLDETQQSWLLGPKVLKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+VSRK+F WT+G ++  A+L G I LIVKT+P H    PP DNYT+AL  AL FF
Sbjct  61   DLGCILVSRKIFLWTLGIIVVTALLSGFITLIVKTLPHHKPKKPPLDNYTIALPIALKFF  120

Query  399  NAQRSGKLPKHNN-VSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            NAQ+SGKLPK+NN V WRG+SC++DGK D    +KDLVGGYYDAGD+IKFNFP S+A+TM
Sbjct  121  NAQQSGKLPKNNNSVKWRGDSCLQDGKGDPGQYYKDLVGGYYDAGDSIKFNFPMSYAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_008782747.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 171/198 (86%), Gaps = 8/198 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  200
            MSMYGRDPWGGPLEI   DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNL-DLDRAALSTSSRPLDETQQSWLLAGPGDQ  59

Query  201  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
              KKK+YVDLGC+IVSRK+F WTVG+++A A L GLI LIVKT+PRHH P PPPDNYTLA
Sbjct  60   GKKKKKYVDLGCLIVSRKIFIWTVGTIVATAALAGLITLIVKTIPRHHHPKPPPDNYTLA  119

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDAGDAIKFNFP
Sbjct  120  LHKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGLS-DTSYGRSLVGGFYDAGDAIKFNFP  178

Query  555  QSFALTMLSWSVIEYSAK  608
             SFA+TMLSWSVIEYSAK
Sbjct  179  ASFAMTMLSWSVIEYSAK  196



>ref|XP_010921267.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 170/198 (86%), Gaps = 8/198 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  200
            MSMYGRDPWGGPLEI   DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNL-DLDRAALSTSSRPLDETQQSWLLAGPGDQ  59

Query  201  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
              KKK+YVDLGC+IVSRK+F WTVG+++A A L G I LIVKTVPRHH P PPPDNYTLA
Sbjct  60   GKKKKKYVDLGCLIVSRKLFIWTVGTIVATAALAGFITLIVKTVPRHHHPKPPPDNYTLA  119

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDAGDAIKFNFP
Sbjct  120  LHKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGIS-DTSYGRSLVGGFYDAGDAIKFNFP  178

Query  555  QSFALTMLSWSVIEYSAK  608
             SFA+TMLSWSVIEYSAK
Sbjct  179  ASFAMTMLSWSVIEYSAK  196



>ref|XP_008793381.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 169/198 (85%), Gaps = 8/198 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  200
            MSMYGRDPWGGPLEI   DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP EQ
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNL-DLDRAALSTSSRPLDETQQSWLLAGPGEQ  59

Query  201  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
               KK+YVDLGC+IVSRK+F WTVG+++A A L G + LIVKTVPRHH P PPPDNYTLA
Sbjct  60   GKTKKKYVDLGCLIVSRKIFIWTVGTIVATAALAGFVTLIVKTVPRHHHPQPPPDNYTLA  119

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDAGDAIKFNFP
Sbjct  120  LHKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGIS-DPSYGRSLVGGFYDAGDAIKFNFP  178

Query  555  QSFALTMLSWSVIEYSAK  608
             SFA+TMLSWSVIEYSAK
Sbjct  179  ASFAMTMLSWSVIEYSAK  196



>ref|XP_010909007.1| PREDICTED: endoglucanase 10-like [Elaeis guineensis]
Length=617

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 168/193 (87%), Gaps = 5/193 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTE--QKKK  209
            M+GRDPWGGPLEI  N+SATDDDRSRNLQDLDRAALSR LDETQQSWLL GP +  +KKK
Sbjct  1    MFGRDPWGGPLEI-TNESATDDDRSRNLQDLDRAALSRPLDETQQSWLLAGPGDAGKKKK  59

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            RY+DLGC++VSRK F WTVGSVL    L+GLI+LIVKTVP HH   PPPD YT ALHKAL
Sbjct  60   RYIDLGCLVVSRKHFLWTVGSVLGVGFLIGLIMLIVKTVPHHHPRPPPPDEYTKALHKAL  119

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSG +PKHNNVSWRGNS M+DG SD+A + K+LVGGYYDAGDAIKF+FP SFA+
Sbjct  120  MFFNAQRSGPIPKHNNVSWRGNSGMKDGISDNA-VRKNLVGGYYDAGDAIKFHFPMSFAM  178

Query  570  TMLSWSVIEYSAK  608
            T+LSWSVIEYSAK
Sbjct  179  TLLSWSVIEYSAK  191



>ref|XP_009417855.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 174/197 (88%), Gaps = 8/197 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  200
            MSMYGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEIHA-DSATDDDRSRNL-DLDRAALSMTSRQLDETQQSWLLAGPGDQ  58

Query  201  -KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLAL  377
             KKK+YVDLGC+IVSRK+F W++G+V+AAA L GLI LIVKTVPRHHRP PPPDNYTLAL
Sbjct  59   GKKKKYVDLGCLIVSRKLFLWSLGAVVAAAALAGLITLIVKTVPRHHRPRPPPDNYTLAL  118

Query  378  HKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQ  557
            HKALMFFNAQRSG +PKHNNVSWRGNS M+DG S D +  K LVGG+YDAGDAIKFNFP 
Sbjct  119  HKALMFFNAQRSGPIPKHNNVSWRGNSGMKDGIS-DPSYGKSLVGGFYDAGDAIKFNFPA  177

Query  558  SFALTMLSWSVIEYSAK  608
            SFA+TMLSWSVIEYSAK
Sbjct  178  SFAMTMLSWSVIEYSAK  194



>ref|NP_194157.1| endoglucanase 21 [Arabidopsis thaliana]
 sp|Q9STW8.1|GUN21_ARATH RecName: Full=Endoglucanase 21; AltName: Full=Endo-1,4-beta glucanase 
21 [Arabidopsis thaliana]
 emb|CAB45061.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 emb|CAB79336.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 gb|AEE84879.1| endoglucanase 21 [Arabidopsis thaliana]
Length=620

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DS TDDDRSRNLQDLDRA  SR LDETQQSWLLGP   KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSMTDDDRSRNLQDLDRATPSRPLDETQQSWLLGPKVLKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+VSRK+F WT+G+++  A+L G I LIVKT+P HH   PPPDNYT+AL  AL FF
Sbjct  61   DLGCILVSRKIFLWTLGTIVVTALLSGFITLIVKTLPHHHHKEPPPDNYTIALRTALKFF  120

Query  399  NAQRSGKLPKH-NNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            NAQ+SGKLPK+  NVSWR +SC++DGK D    +KDLVGGYYDAGD+IKFNFP S+A+TM
Sbjct  121  NAQQSGKLPKNIYNVSWRHDSCLQDGKGDPGQCYKDLVGGYYDAGDSIKFNFPMSYAMTM  180

Query  576  LSWSVIEYSAK  608
            LSWSVIEYSAK
Sbjct  181  LSWSVIEYSAK  191



>ref|XP_011088109.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=596

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 153/192 (80%), Gaps = 22/192 (11%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  212
            MSMYGRDPWGGPLEI A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK 
Sbjct  1    MSMYGRDPWGGPLEI-AADSATDDDRSRNLQDYDRAALSRPLDETQQSWLLGPGEQKKK-  58

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
              +L    ++  +                   LIVKTVPRHH   PPPDNYTLAL+KALM
Sbjct  59   --NLAAGFLAGFI------------------TLIVKTVPRHHHRPPPPDNYTLALNKALM  98

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQRSGKLPKHNNVSWRGNSC+ DG+SD +T+FKDL GGYYDAGDAIKFNFPQSFA+T
Sbjct  99   FFNAQRSGKLPKHNNVSWRGNSCLNDGESDSSTLFKDLTGGYYDAGDAIKFNFPQSFAMT  158

Query  573  MLSWSVIEYSAK  608
            MLSWSVIEYSAK
Sbjct  159  MLSWSVIEYSAK  170



>ref|XP_006283336.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
 gb|EOA16234.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
Length=622

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  215
            MYGRDPWGGPLEI+A D+  DDDR SRNLQDLDRA LSR LDETQQSWLLGP E KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADTLIDDDRRSRNLQDLDRAGLSRPLDETQQSWLLGPKELKKKKY  60

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            VDLGCI+VSRK+F WT+G V+A A L G I LIV+TVP H    P PDNYTLAL +AL F
Sbjct  61   VDLGCILVSRKIFLWTLGIVVATAFLSGFITLIVRTVPHHKHKPPSPDNYTLALRQALNF  120

Query  396  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            FNAQ+SGKLPK N  NV+WRG+SC++DGK D    + DLVGGYYDAGDAIKFNFP S+A+
Sbjct  121  FNAQQSGKLPKKNINNVTWRGDSCLQDGKGDQGQSYTDLVGGYYDAGDAIKFNFPMSYAM  180

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYS K
Sbjct  181  TMLSWSVIEYSTK  193



>ref|XP_002465324.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
 gb|EER92322.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
Length=620

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 168/195 (86%), Gaps = 5/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI   DSATDDDRSRNL D+DR A+SR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEICHPDSATDDDRSRNL-DIDRGAMSRTLDETQQSWLLAGPGDQARK  59

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD+GC++VSRK+F WT+G +LAAAV  G++  I K +PR HRP PPPD+YT+ALHK
Sbjct  60   KKKYVDIGCLVVSRKLFVWTLGVLLAAAVFAGVVAGIAKAIPRRHRPPPPPDDYTVALHK  119

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQRSGKLPKHNN+ WRGNSCM+DG SD A + + LVGGYYDAG A+KFNFP +F
Sbjct  120  ALMFFNAQRSGKLPKHNNIPWRGNSCMKDGLSDPA-VRRSLVGGYYDAGGAVKFNFPAAF  178

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  179  SMTLLSWSVIEYSAK  193



>ref|XP_008803421.1| PREDICTED: endoglucanase 10-like [Phoenix dactylifera]
Length=617

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 165/193 (85%), Gaps = 5/193 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL---GPTEQKKK  209
            M+GRDPWGGPLEI +N+SATDDDRSRNLQD+DRAALSR LDETQQSWLL   G T  KKK
Sbjct  1    MFGRDPWGGPLEI-SNESATDDDRSRNLQDVDRAALSRPLDETQQSWLLAGPGDTSNKKK  59

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            RY+DLGC++VSRK F WTVGSVL    L+GLI+LIVKTVP HH P PP D YT ALHKAL
Sbjct  60   RYIDLGCMVVSRKHFLWTVGSVLGVGFLIGLIMLIVKTVPHHHPPPPPADEYTKALHKAL  119

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSG + KHNNVSWRGNS MRDG SD+A   K+LVGGYYDAGDAIKFNFP SF++
Sbjct  120  MFFNAQRSGPIRKHNNVSWRGNSGMRDGLSDNAAR-KNLVGGYYDAGDAIKFNFPMSFSM  178

Query  570  TMLSWSVIEYSAK  608
            T+LSWSVIEYSAK
Sbjct  179  TLLSWSVIEYSAK  191



>ref|XP_004984503.1| PREDICTED: endoglucanase 9-like [Setaria italica]
Length=619

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 169/195 (87%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI   DSATDDDRSRNL D+DR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CPDSATDDDRSRNL-DIDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD+GC++VSRK+F WT+G +LAAAV  G++  I K +PR HRP PPPD+YT+ALHK
Sbjct  59   KKKYVDIGCLVVSRKLFVWTLGVLLAAAVFAGVVAGIAKAIPRRHRPPPPPDDYTVALHK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQRSGKLPKHNNV WRGNSCM+DG SD A + + LVGGYYDAG+A+KFNFP +F
Sbjct  119  ALMFFNAQRSGKLPKHNNVPWRGNSCMKDGLSDPA-VRRSLVGGYYDAGNAVKFNFPAAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>ref|NP_001183308.1| hypothetical protein [Zea mays]
 gb|ACR36366.1| unknown [Zea mays]
 tpg|DAA45168.1| TPA: hypothetical protein ZEAMMB73_159477 [Zea mays]
Length=619

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 169/195 (87%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTE--QK  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL D+DR ALSR+LDETQQSWLL GP +  +K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DIDRGALSRTLDETQQSWLLAGPGDPGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD+GC++VSRK+F WT+G +LAAAV  G++  I K +PR HRP PPPD+YT+ALHK
Sbjct  59   KKKYVDIGCLVVSRKLFVWTLGVLLAAAVFAGVVAGIAKAIPRRHRPPPPPDDYTVALHK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFN QRSGKLPKHNN+ WRGNSCM+DG SD A + + LVGGYYDAGDA+KFNFP +F
Sbjct  119  ALMFFNGQRSGKLPKHNNIPWRGNSCMKDGLSDPA-VRRSLVGGYYDAGDAVKFNFPAAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>ref|XP_009406859.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=623

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 167/199 (84%), Gaps = 9/199 (5%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLG-PTEQ  200
            MSMYGRDPWGGPLEI   DSATDDDRSRNL D DRAA+S   R LDETQQSWLL  P +Q
Sbjct  1    MSMYGRDPWGGPLEISHADSATDDDRSRNL-DSDRAAMSTTSRQLDETQQSWLLAAPGDQ  59

Query  201  ---KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  371
               KK +YVDLGC+IVSRK+F WTVG+V+A AVL   I LIVKT+PRHHRP PPPDNYTL
Sbjct  60   GTKKKNKYVDLGCLIVSRKLFLWTVGTVVATAVLAAFITLIVKTIPRHHRPRPPPDNYTL  119

Query  372  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNF  551
            ALHKALMFFNAQRSG +PKHNNVSWRGNS MRDG S D +  K LVGGYYDAGDAIKFNF
Sbjct  120  ALHKALMFFNAQRSGPIPKHNNVSWRGNSGMRDGLS-DPSYGKSLVGGYYDAGDAIKFNF  178

Query  552  PQSFALTMLSWSVIEYSAK  608
            P SFA+TMLSWSVIEYSAK
Sbjct  179  PASFAMTMLSWSVIEYSAK  197



>ref|XP_010938102.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 166/198 (84%), Gaps = 8/198 (4%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  200
            MSMYGRDPWGGPLEI   DSATDDDRSRN+ DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNM-DLDRAALSTSSRPLDETQQSWLLAGPGDQ  59

Query  201  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
               KK+YVDLGC+IVSRK+F WTVG ++A A L G I LIVKTVPRHH P  PPDNYTLA
Sbjct  60   GKTKKKYVDLGCLIVSRKLFIWTVGIIVAVAALAGFITLIVKTVPRHHHPQAPPDNYTLA  119

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            L KALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDAGDAIKFNFP
Sbjct  120  LRKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGIS-DPSYGRSLVGGFYDAGDAIKFNFP  178

Query  555  QSFALTMLSWSVIEYSAK  608
             SFA+TMLSWSVIEYSAK
Sbjct  179  ASFAMTMLSWSVIEYSAK  196



>ref|NP_001050004.1| Os03g0329500 [Oryza sativa Japonica Group]
 sp|P0C1U4.1|GUN9_ORYSJ RecName: Full=Endoglucanase 9; AltName: Full=Endo-1,4-beta glucanase 
9; AltName: Full=OsCel9D; AltName: Full=OsGLU1 [Oryza 
sativa Japonica Group]
 gb|ABF95745.1| membrane-anchored endo-1,4-beta-glucanase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11918.1| Os03g0329500 [Oryza sativa Japonica Group]
 dbj|BAF37261.1| endo-beta-1,4-D-glucanase [Oryza sativa]
 gb|EAY89858.1| hypothetical protein OsI_11408 [Oryza sativa Indica Group]
Length=619

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVDLGC++VSRK+F WTVG +LAAAV  GL+  I K +PRHHRP PPPD++T+AL K
Sbjct  59   KKKYVDLGCLVVSRKLFVWTVGVLLAAAVFAGLVAGIAKAIPRHHRPPPPPDDFTVALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPK+NNV WRGNSCM+DG SD A + + LVGGYYDAGDA+KFNFP +F
Sbjct  119  ALMFFNAQKSGKLPKNNNVHWRGNSCMKDGLSDPA-VGRSLVGGYYDAGDAVKFNFPAAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>ref|NP_001147537.1| endo-1,4-beta-glucanase [Zea mays]
 gb|ACG27857.1| endo-1,4-beta-glucanase [Zea mays]
 gb|AFW88475.1| endo-1,4-beta-glucanase [Zea mays]
Length=620

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 167/195 (86%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPT---EQK  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL D+DRAALSR+LDETQQSWLL  T    +K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DIDRAALSRTLDETQQSWLLAGTADQPRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K +YVD+GC++VSRK+F WT+G +LAAAV  G +  I K +PR HRP PPPD+YT+ALHK
Sbjct  59   KNKYVDIGCLLVSRKLFVWTLGVLLAAAVFAGAVAGIAKAIPRRHRPLPPPDDYTVALHK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFF+AQRSGKLPKHNN+ WRGNSCM+DG SD A + + LVGGYYDAGDA+KFNFP +F
Sbjct  119  ALMFFHAQRSGKLPKHNNIHWRGNSCMKDGLSDPA-VRRSLVGGYYDAGDAVKFNFPAAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>ref|XP_006650027.1| PREDICTED: endoglucanase 9-like [Oryza brachyantha]
Length=619

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 168/195 (86%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVDLGC++VSRK F WTVG +LAA +  GL+  I K +PRHHRP PPPD++T+AL K
Sbjct  59   KKKYVDLGCLVVSRKHFVWTVGVLLAAGMFAGLVAGIAKAIPRHHRPPPPPDDFTVALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPKHNNV WRGNSC++DG SD A + + LVGGY+DAGDA+KFNFP +F
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGNSCLKDGLSDPA-VRRSLVGGYFDAGDAVKFNFPAAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>emb|CDX92628.1| BnaC07g38860D [Brassica napus]
Length=619

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DS TDDDRSRNLQ+LDR+AL R LD TQ+SWLLGP  +KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSITDDDRSRNLQELDRSALPRPLDATQRSWLLGPPVRKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+VSRK+F WT+G++L    L G I +IV+ VP H    P  DNYTLAL+K L+FF
Sbjct  61   DLGCILVSRKIFLWTLGTLLVTTFLAGSITMIVRHVPHHKHEKPQQDNYTLALNKTLLFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPK NNVSWRGNSCM+D    +    +D+VGGYYDAGD IKF+FP S+A+TML
Sbjct  121  NAQKSGKLPKKNNVSWRGNSCMKDVDEGEYPP-RDVVGGYYDAGDTIKFSFPMSYAMTML  179

Query  579  SWSVIEYSA  605
            SWSVIEYSA
Sbjct  180  SWSVIEYSA  188



>gb|EEE58992.1| hypothetical protein OsJ_10702 [Oryza sativa Japonica Group]
Length=619

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 169/195 (87%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVDLGC++VSRK+F  TVG +LAAAV  GL+  I K +PRHHRP PPPD++T+AL K
Sbjct  59   KKKYVDLGCLVVSRKLFVVTVGVLLAAAVFAGLVAGIAKAIPRHHRPPPPPDDFTVALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPK+NNV WRGNSCM+DG SD A + + LVGGYYDAGDA+KFNFP +F
Sbjct  119  ALMFFNAQKSGKLPKNNNVHWRGNSCMKDGLSDPA-VGRSLVGGYYDAGDAVKFNFPAAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>ref|XP_009399913.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=691

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 173/198 (87%), Gaps = 9/198 (5%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  200
            MS+YGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP ++
Sbjct  71   MSIYGRDPWGGPLEIHA-DSATDDDRSRNL-DLDRAALSMTSRQLDETQQSWLLAGPGDK  128

Query  201  KKKR--YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
             KK+  YVDLGC+IVSRK+F WTVG+V+AAA L GLI LIVKTVP HHRP PPPDNYTLA
Sbjct  129  GKKKKKYVDLGCLIVSRKIFLWTVGAVVAAAALAGLITLIVKTVPHHHRPRPPPDNYTLA  188

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKALMFFNAQRSG++PKHNNVSWRGNS M+DG S D +  + LVGG+YDAGDAIKFNFP
Sbjct  189  LHKALMFFNAQRSGRIPKHNNVSWRGNSGMKDGFS-DPSYGRSLVGGFYDAGDAIKFNFP  247

Query  555  QSFALTMLSWSVIEYSAK  608
             SFA+TMLSWSVIEYSAK
Sbjct  248  ASFAMTMLSWSVIEYSAK  265



>ref|XP_003557996.1| PREDICTED: endoglucanase 9 [Brachypodium distachyon]
Length=621

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 163/194 (84%), Gaps = 5/194 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ-KK  206
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q +K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQARK  58

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++VSRK+F WTVG ++AAA   G++  I + +P+HH   PPPD YT+AL KA
Sbjct  59   KKYVDLGCLVVSRKLFVWTVGVLVAAAAFAGIVAGIAQAIPKHHPQPPPPDEYTVALRKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQ+SGKLPKHNNV WRG+SC++DG SD A   +DL GGYYD G+A K+NFP +F+
Sbjct  119  LMFFNAQKSGKLPKHNNVPWRGDSCLKDGSSDQA-FRRDLSGGYYDGGEATKYNFPAAFS  177

Query  567  LTMLSWSVIEYSAK  608
            +T+LSWSVIEYSAK
Sbjct  178  MTLLSWSVIEYSAK  191



>ref|XP_009137436.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
 emb|CDY10998.1| BnaA03g46570D [Brassica napus]
Length=619

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGRDPWGGPLEI+A DS TDDDRSRNLQ+LDR+ L R LD TQ+SWLLGP  +KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSITDDDRSRNLQELDRSTLRRPLDATQRSWLLGPPVRKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            D+GC+ VSRK+F WT+G++L    L G I +IV+ VP H    P  DNYTLAL+K L+FF
Sbjct  61   DIGCMQVSRKIFLWTLGTLLVTTFLAGSITMIVRHVPHHKHEKPQQDNYTLALNKTLLFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPK NNVSWRGNSCM+D    +    +D+VGGYYDAGD IKF+FP S+A+TML
Sbjct  121  NAQKSGKLPKKNNVSWRGNSCMKDVDEGEYPP-RDVVGGYYDAGDTIKFSFPMSYAMTML  179

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  180  SWSVIEYSAK  189



>emb|CDY03467.1| BnaC01g16150D [Brassica napus]
Length=561

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGR P  G LEI+A +S TDDDRSR +Q+LDRA L   LD T++SWLL P + KKK+YV
Sbjct  1    MYGRHPLTGSLEINAAESITDDDRSRKMQELDRATLPPPLDATRRSWLLEPPQPKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+VSRK+F WT+G+VL   +L G I +IV+ +P H    P PDNYT+AL KALMFF
Sbjct  61   DLGCILVSRKIFLWTLGAVLVTTLLAGSITMIVRHMPHHKPTEPKPDNYTVALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNV+WRG+SCM+DGK      +KDLVGGYYDAGDA KFNFP S+A+TML
Sbjct  121  NAQKSGKLPEHNNVTWRGDSCMQDGKDQTGGFYKDLVGGYYDAGDATKFNFPMSYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>emb|CDY34271.1| BnaA01g13740D [Brassica napus]
Length=561

 Score =   231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGR P   PLEI+A DS TDDDRSR LQ+ DRA L   LD T++SWLL P + KKK+YV
Sbjct  1    MYGRHPLTVPLEINAADSITDDDRSRKLQEHDRATLPPPLDATRRSWLLEPPQPKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGC++VSRK+F WT+G+VL   +L G I +IV+ +P H +  P P+NYT+AL KALMFF
Sbjct  61   DLGCMLVSRKIFLWTLGTVLVTTLLAGSITMIVRHMPHHKQTEPEPENYTVALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNV+WRG+SC++DGK      +KDLVGGYYDAGDA KFNFP S+A+TML
Sbjct  121  NAQKSGKLPEHNNVTWRGDSCLQDGKDQTGGFYKDLVGGYYDAGDATKFNFPMSYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>dbj|BAK04500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRHH P  PPD +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHHAPPTPPDQFTLALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD+A   +DL GGYYD G A+KFNFP +F
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDEA-FRRDLSGGYYDGGGAVKFNFPSAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYS K
Sbjct  178  SMTLLSWSVIEYSTK  192



>ref|XP_009137865.1| PREDICTED: endoglucanase 21 [Brassica rapa]
Length=610

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MYGR P   PLEI+A DS TDDDRSR LQ+ DRA L   LD T++SWLL P + KKK+YV
Sbjct  1    MYGRHPLTVPLEINAADSITDDDRSRKLQEHDRATLPPPLDATRRSWLLEPPQPKKKKYV  60

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGC++VSRK+F WT+G+VL   +L G I +IV+ +P H +  P P+NYT+AL KALMFF
Sbjct  61   DLGCMLVSRKIFLWTLGTVLVTTLLAGSITMIVRHMPHHKQTEPEPENYTVALRKALMFF  120

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP+HNNV+WRG+SC++DGK      +KDLVGGYYDAGDA KFNFP S+A+TML
Sbjct  121  NAQKSGKLPEHNNVTWRGDSCLQDGKDQTGGFYKDLVGGYYDAGDATKFNFPMSYAMTML  180

Query  579  SWSVIEYSAK  608
            SWSVIEYSAK
Sbjct  181  SWSVIEYSAK  190



>gb|AGK26802.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 163/195 (84%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD+ T  +DL GGYYD G A+KFNF  +F
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDE-TSRRDLSGGYYDGGSAVKFNFASAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEY+AK
Sbjct  178  SMTLLSWSVIEYNAK  192



>gb|AGK26803.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 162/195 (83%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KKRYVDLGC++VSRK+F W++G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWSLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD G A+KFNF  +F
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDGGSAVKFNFASAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEY+AK
Sbjct  178  SMTLLSWSVIEYNAK  192



>gb|AGK26798.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26799.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26800.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD G A+KFNF  +F
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDGGSAVKFNFASAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEY+AK
Sbjct  178  SMTLLSWSVIEYNAK  192



>gb|AGK26801.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 6/195 (3%)
 Frame = +3

Query  33   MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  203
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD G A+KFNF  +F
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDGGSAVKFNFASAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEY+AK
Sbjct  178  SMTLLSWSVIEYNAK  192



>tpg|DAA51201.1| TPA: endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            KRYVDLGC++V RKVF WTVG++L   V +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KRYVDLGCVVVDRKVFMWTVGTILGLGVFIGFVIMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYRAK  190



>emb|CDI66528.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
 emb|CDI66541.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYKAK  190



>ref|NP_001151770.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
 gb|ACG44266.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            KRYVDLGC++V RKVF WTVG+VL   V +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KRYVDLGCLVVDRKVFMWTVGTVLGLGVFIGFVIMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYRAK  190



>emb|CDI66566.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYRAK  190



>gb|ACN28577.1| unknown [Zea mays]
 gb|ACN34658.1| unknown [Zea mays]
 gb|AFW67687.1| hypothetical protein ZEAMMB73_593933 [Zea mays]
Length=621

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            KRYVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KRYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYRAK  190



>ref|XP_002463915.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
 gb|EER90913.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
Length=621

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYRAK  190



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDR AL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRGALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC+++ RK+F WTVG++L   + +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCMVLDRKIFMWTVGTILGVGLFIGFVMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ K LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRKSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYKAK  190



>ref|XP_004981854.1| PREDICTED: endoglucanase 10-like [Setaria italica]
Length=621

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC+++ RK+F WTVG++L   V +G I++IVK VP    P PPPD YT A+HKA
Sbjct  58   KKYVDLGCVVLDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQAVHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T  + LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTTRRSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYKAK  190



>emb|CBB36505.1| Hordeum vulgare protein similar to endo-1,4-b-glucanase BAA94257 
[Saccharum hybrid cultivar R570]
Length=626

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 153/199 (77%), Gaps = 13/199 (7%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQR-----SGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNF  551
            LMFFNAQR     SG LPKHN VSWRGNSCM+DG SD +T+ + LVGGYYDAGDAIKFN+
Sbjct  118  LMFFNAQRCEYHLSGPLPKHNGVSWRGNSCMKDGLSD-STVRRSLVGGYYDAGDAIKFNY  176

Query  552  PQSFALTMLSWSVIEYSAK  608
            P ++++TMLSWSVIEY AK
Sbjct  177  PMAWSMTMLSWSVIEYRAK  195



>ref|XP_006650552.1| PREDICTED: endoglucanase 10-like [Oryza brachyantha]
Length=618

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 150/194 (77%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGPLEI   DSAT        +DLDR AL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSAT---DDDRSRDLDRGALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++V RK+F WTVG+++   + +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCMVVDRKIFMWTVGTIVGVGLFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNS M+DG S D+T  K LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSGMKDGLS-DSTARKSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYKAK  190



>emb|CDI66602.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=624

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 151/197 (77%), Gaps = 11/197 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+ RDPWGGPLEI   DSAT        +DLDRAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFRRDPWGGPLEISNADSAT---DDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRS---GKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQ  557
            LMFFNAQR    G LPKHN VSWRGNSCM+DG SD +T+ + LVGGYYDAGDAIKFN+P 
Sbjct  118  LMFFNAQRCEFPGPLPKHNGVSWRGNSCMKDGLSD-STVRRSLVGGYYDAGDAIKFNYPM  176

Query  558  SFALTMLSWSVIEYSAK  608
            ++++TMLSWSVIEY AK
Sbjct  177  AWSMTMLSWSVIEYKAK  193



>ref|XP_010277803.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=615

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            M+  + WGG  EI+A DS T+D+RSRN++  DRAALS++LDETQQSWLLGP E+KKK+YV
Sbjct  1    MHSANHWGGSFEINA-DSTTEDERSRNME-YDRAALSQNLDETQQSWLLGPKEKKKKKYV  58

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+ SRK FKWT+ S+L A +++ L  +IVKT+P+H   +PPPDNYT ALHKAL+FF
Sbjct  59   DLGCIVCSRKAFKWTLWSILIAFLVIALPTIIVKTLPKHKSRSPPPDNYTNALHKALLFF  118

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPK+N VSWRG+S ++DG SD   I   LVGGYYDAGD IKF+FP +F +TML
Sbjct  119  NAQKSGKLPKNNGVSWRGDSGLKDG-SDMPEIKGGLVGGYYDAGDNIKFHFPMAFTMTML  177

Query  579  SWSVIEYSAK  608
            SWSVIEY+ K
Sbjct  178  SWSVIEYNHK  187



>gb|ACZ82300.1| beta-1,4 glycosidase [Phyllostachys edulis]
Length=617

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 149/194 (77%), Gaps = 8/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGGP+EI   DSAT        +DLDR AL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPMEISNADSAT---DDDRSRDLDRGALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K YVDLGC+++ RK+F WTVG++L   + +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KTYVDLGCMVIDRKIFVWTVGTILGVGLFIGFVMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRG S M+DG SD+ T+ + LVGG+YDAGDAIKFN+P +++
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGKSAMKDGLSDN-TVRRSLVGGFYDAGDAIKFNYPMAWS  176

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY AK
Sbjct  177  MTMLSWSVIEYKAK  190



>ref|XP_009385674.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGPTEQKKK-R  212
            M+  + WGG  EIH  D  TDD+ SRN+ DLDRAALSR  LDETQQSWLLGP E KKK +
Sbjct  1    MHSMNHWGGSFEIH--DPTTDDEHSRNM-DLDRAALSRQQLDETQQSWLLGPQEAKKKDK  57

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGC++V RKV KWT  +VL A V++G+ + I K++P+H +  PPPD YT ALHKALM
Sbjct  58   YVDLGCMVVKRKVLKWTFYAVLIAFVVIGVPITIAKSIPKHKKAPPPPDRYTEALHKALM  117

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FFNAQ+SG+LPK+N + WRG+S ++DG S+   +   LVGGYYDAGD IKF+FP +F++T
Sbjct  118  FFNAQKSGRLPKNNGIPWRGDSGLKDG-SEGTDVKGGLVGGYYDAGDNIKFHFPMAFSMT  176

Query  573  MLSWSVIEYSAK  608
            +LSWSVIEYS K
Sbjct  177  LLSWSVIEYSNK  188



>dbj|BAJ94336.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 147/194 (76%), Gaps = 7/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGG LEI   DSATD    R+      A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATD--DDRSRDLDRGAMMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVD+GC+++ RK+F WTVG VL   + VG +++IVK VP    P PPPD YTLALHKA
Sbjct  59   KKYVDIGCMVIDRKIFMWTVGLVLGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNS M+DG S D+T+ K LVGG+YDAGDAIKFN+P +++
Sbjct  119  LMFFNAQRSGHLPKHNGVSWRGNSGMKDGLS-DSTVKKSLVGGFYDAGDAIKFNYPMAWS  177

Query  567  LTMLSWSVIEYSAK  608
            +TMLSW+VIEY AK
Sbjct  178  MTMLSWTVIEYRAK  191



>dbj|BAA94257.1| endo-1,4-beta-glucanase Cel1 [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGG LEI   DSATD    R+      A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATD--DDRSRDLDRGAMMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVD+GC+++ RK+F WTVG VL   + VG +++IVK VP    P PPPD YTLALHKA
Sbjct  59   KKYVDIGCMVIDRKIFMWTVGLVLGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNS M+DG   D+T+ K LVGG+YDAGDAIKFNFP +++
Sbjct  119  LMFFNAQRSGHLPKHNGVSWRGNSGMKDGLP-DSTVKKSLVGGFYDAGDAIKFNFPMAWS  177

Query  567  LTMLSWSVIEYSAK  608
            +TMLSW+VIEY AK
Sbjct  178  MTMLSWTVIEYRAK  191



>emb|CDP21162.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 143/188 (76%), Gaps = 6/188 (3%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKKKRYVDL  224
            WGG LEI   DSAT+D++SRN++  DRA++S    + LDETQQSWLLGP E+KKK+YVDL
Sbjct  5    WGGSLEISTTDSATEDEKSRNME-WDRASVSYQHYQHLDETQQSWLLGPPERKKKKYVDL  63

Query  225  GCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNA  404
            GC++ S K  KWTV  +L A  ++GL V+IVK VP+H     PPDNYTLALHKAL+FFNA
Sbjct  64   GCVVCSTKALKWTVYGILIAFFVIGLPVMIVKLVPKHKHHPSPPDNYTLALHKALLFFNA  123

Query  405  QRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSW  584
            Q+SGKLPK+N + WRGNS + DG S    +   LVGGYYDAGD IKF+FP SFA+TMLSW
Sbjct  124  QKSGKLPKNNGIPWRGNSGLSDG-SKLTDVKGGLVGGYYDAGDNIKFHFPMSFAMTMLSW  182

Query  585  SVIEYSAK  608
            S IEY  K
Sbjct  183  SAIEYEQK  190



>ref|XP_006858738.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
 gb|ERN20205.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
Length=619

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 153/195 (78%), Gaps = 8/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-----RSLDETQQSWLLGPTEQK  203
            M+G + WGG  EIH  DSATDD+RSRN+ D+DRAALS     ++LDETQQSWLLGP+E K
Sbjct  1    MHGGNHWGGSFEIHG-DSATDDERSRNM-DIDRAALSHHSHSQNLDETQQSWLLGPSEPK  58

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K +Y+DLGC++ SRK F+++V +V+ A V++ L ++IVK++P+HH   P PDNYTLALHK
Sbjct  59   KNKYIDLGCVVCSRKAFRYSVWTVVIALVVIVLPIVIVKSLPKHHPKPPKPDNYTLALHK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            ALMFFNAQ+SG+LP+ N V WR +S ++DG SD   +   LVGGYYDAGD IKF FP +F
Sbjct  119  ALMFFNAQKSGRLPRSNGVPWRHDSGLQDG-SDAKDVKGGLVGGYYDAGDNIKFGFPMAF  177

Query  564  ALTMLSWSVIEYSAK  608
            +++ML W+V+EY+ K
Sbjct  178  SMSMLGWTVVEYAHK  192



>gb|EYU39502.1| hypothetical protein MIMGU_mgv1a002977mg [Erythranthe guttata]
 gb|EYU39503.1| hypothetical protein MIMGU_mgv1a002977mg [Erythranthe guttata]
Length=620

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALSR------SLDETQQSWLLGPTEQKKKRYV  218
            WGG LEI+  DSA D+DR+RN  D DRA++SR      +L+ETQ+SWLLGP ++KKK+YV
Sbjct  5    WGGTLEINGGDSANDEDRNRN-ADWDRASISRREYENDNLNETQKSWLLGPPDKKKKKYV  63

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGC++ SR   KWT+ S+L A +++GL ++I K++P+H     PPDNYT+ALHKAL+FF
Sbjct  64   DLGCVVCSRSALKWTILSILIAFIVIGLPIIIAKSLPKHKEAPTPPDNYTIALHKALLFF  123

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPK+N + WRG+S ++DG SD   +   LVGGYYDAGD  KF+FP +FA+TML
Sbjct  124  NAQKSGKLPKNNGIPWRGDSGLQDG-SDQTDLKGGLVGGYYDAGDNTKFHFPMAFAMTML  182

Query  579  SWSVIEYSAK  608
            SWSVIEY  K
Sbjct  183  SWSVIEYEHK  192



>ref|XP_003560035.1| PREDICTED: endoglucanase 10 [Brachypodium distachyon]
Length=621

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGG LEI   DSATD    R+      A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATD--DDRSRDLDRGALMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVD+GC+++ RK+F WTVG++L   + +G +++IVK VP    P PPPD YT ALHKA
Sbjct  59   KKYVDIGCMVIDRKIFLWTVGTILGVGLFIGFVMMIVKLVPHKKPPPPPPDQYTQALHKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN VSWRGNS M+DG S D+T  K LVGG+YDAGDAIKFNFP +++
Sbjct  119  LMFFNAQRSGPLPKHNGVSWRGNSGMKDGLS-DSTARKSLVGGFYDAGDAIKFNFPMAWS  177

Query  567  LTMLSWSVIEYSAK  608
            +TMLSW+VIEY AK
Sbjct  178  MTMLSWTVIEYKAK  191



>gb|ACT54547.1| endo-1,4-beta-glucanase [Dimocarpus longan]
Length=628

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 143/201 (71%), Gaps = 12/201 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAN----DSATDDDRSRNLQDLDRAALSRS-------LDETQQSWLL  185
            M+G + WGG  EI  N       TDD++SRN+   D+A+L  S       LDETQQSWLL
Sbjct  1    MHGGNHWGGSFEIVNNGDHPHHHTDDEKSRNMDQWDKASLQHSQSQRYHHLDETQQSWLL  60

Query  186  GPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnY  365
            GP E KKK+YVDLGC++ SRK  KWT+ S + A +++ L ++I KT+P+H    PPPDNY
Sbjct  61   GPPEAKKKKYVDLGCVVCSRKALKWTLWSFVIAFIVIALPIIIAKTIPKHKPRPPPPDNY  120

Query  366  TLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKF  545
            TLALHKAL+FFNAQ+SGKLPK+N + WRGNS + DG +    +   LVGGYYDAGD  KF
Sbjct  121  TLALHKALLFFNAQKSGKLPKNNGIPWRGNSGLSDGNA-TTDVKGGLVGGYYDAGDNSKF  179

Query  546  NFPQSFALTMLSWSVIEYSAK  608
            +FP SFA+TMLSWS+IEY  K
Sbjct  180  HFPMSFAMTMLSWSLIEYDHK  200



>gb|EMT18790.1| Endoglucanase 9 [Aegilops tauschii]
Length=604

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 5/175 (3%)
 Frame = +3

Query  93   ATDDDRSRNLQDLDRAALSRSLDETQQSWLLG-PTEQ--KKKRYVDLGCIIVSRKVFKWT  263
            ATDDDR RNL DLDRAALSR+LDETQQ WLLG P +Q  KKKRYVDLGC++VSRK+F W+
Sbjct  2    ATDDDRRRNL-DLDRAALSRTLDETQQGWLLGGPGDQGRKKKRYVDLGCLLVSRKLFLWS  60

Query  264  vgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVS  443
            +G +LAAA L G+   I K VPRH  P  PPD +TLAL KALMFFNAQ+SGKLPKHNNV 
Sbjct  61   LGLLLAAAALAGIAAGIAKAVPRHQAPPAPPDQFTLALRKALMFFNAQKSGKLPKHNNVP  120

Query  444  WRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            WRG+SC++DG+SD  T  +DL GGYYD G A+KFNF  +F++T+LSWSVIEY+AK
Sbjct  121  WRGDSCLKDGRSDQ-TSRRDLSGGYYDGGSAVKFNFASAFSMTLLSWSVIEYNAK  174



>ref|XP_010930303.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=618

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 146/193 (76%), Gaps = 6/193 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGP--TEQKKK  209
            M+  + WGG  EIHA D +TDD+ SRN+ DLDRAA+ R  LDETQQSWLLGP  + QKK 
Sbjct  1    MHSGNQWGGSFEIHA-DPSTDDEHSRNM-DLDRAAVYRQQLDETQQSWLLGPQDSTQKKD  58

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            +YVDLGCII  RKV  W V + L A V++G+ ++IVK++P+H    PPPD Y +ALHKAL
Sbjct  59   KYVDLGCIICKRKVVWWIVWTALIAFVVIGIPIIIVKSLPKHKEKAPPPDQYAMALHKAL  118

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            +FFNAQ+SG+LPK N + WRGNS +RDG  D   I   LVGGYYDAGD IKF+FP ++++
Sbjct  119  LFFNAQKSGRLPKSNGIPWRGNSGLRDG-FDQPDIKGGLVGGYYDAGDNIKFHFPMAYSM  177

Query  570  TMLSWSVIEYSAK  608
            T+LSWSVIEYS K
Sbjct  178  TLLSWSVIEYSQK  190



>ref|XP_002983992.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
 gb|EFJ15004.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
Length=610

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 5/184 (3%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  236
            WGGPLE+   +   DDD+SR+++ LDRAAL + L+ETQQSWLLG  E+KKK+ VDLGCI+
Sbjct  2    WGGPLEVFQLE-GHDDDQSRSME-LDRAALQK-LEETQQSWLLGAGEKKKKQVVDLGCIV  58

Query  237  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  416
             SRK+F   V +++A  +++G  VLIVKT P+H R  PPPDNYT+ALHK LMFFNAQ+SG
Sbjct  59   CSRKLFTGIVTALVAVGLIIGFTVLIVKTAPKHRRHAPPPDNYTVALHKTLMFFNAQKSG  118

Query  417  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIE  596
            KLPKHNNVS+RGNS M+DG   D  I  +L+GGYYDAGD IKF FPQ++ +T+LSWSVIE
Sbjct  119  KLPKHNNVSFRGNSGMQDGV--DPGIHGNLIGGYYDAGDNIKFLFPQAYTMTLLSWSVIE  176

Query  597  YSAK  608
            Y AK
Sbjct  177  YRAK  180



>ref|XP_002960146.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
 gb|EFJ37685.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
Length=620

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 5/184 (3%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  236
            WGGPLE+   +   DDD+SR+++ LDRAAL + L+ETQQSWLLG  E+KKK+ VDLGCI+
Sbjct  2    WGGPLEVFQLE-GHDDDQSRSME-LDRAALQK-LEETQQSWLLGAGEKKKKQVVDLGCIV  58

Query  237  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  416
             SRK+F   V +++A  +++G  VLIVKT P+H R  PPPDNYT+ALHK LMFFNAQ+SG
Sbjct  59   CSRKLFTGIVTALVAVGLIIGFTVLIVKTAPKHRRHAPPPDNYTVALHKTLMFFNAQKSG  118

Query  417  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIE  596
            KLPKHNNVS+RGNS M+DG   D  I  +L+GGYYDAGD IKF FPQ++ +T+LSWSVIE
Sbjct  119  KLPKHNNVSFRGNSGMQDGV--DPGIHGNLIGGYYDAGDNIKFLFPQAYTMTLLSWSVIE  176

Query  597  YSAK  608
            Y AK
Sbjct  177  YRAK  180



>gb|AAM13693.1| endo-1,4-beta-glucanase [Triticum aestivum]
Length=620

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 144/194 (74%), Gaps = 7/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  206
            M+GRDPWGG LEI   DSATD    R+      A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATD--DDRSRDLDRGAMMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVD+GC+++ RK+F WTVG +L   + VG +++IVK VP    P PPPD YTLALHKA
Sbjct  59   KKYVDIGCMVIDRKIFMWTVGLILGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            LMFFNAQRSG LPKHN V  RGNS M+DG S D+T+ K LVGG+YDAGDAIKFN+P +++
Sbjct  119  LMFFNAQRSGHLPKHNGVXGRGNSGMKDGLS-DSTVKKSLVGGFYDAGDAIKFNYPMAWS  177

Query  567  LTMLSWSVIEYSAK  608
            + MLSW+VIEY AK
Sbjct  178  MNMLSWTVIEYRAK  191



>gb|KDP32490.1| hypothetical protein JCGZ_13415 [Jatropha curcas]
Length=623

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 143/198 (72%), Gaps = 11/198 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEI-HANDSATDDDRSRNLQDLDRAALS-------RSLDETQQSWLLGPT  194
            M+  + WGG  EI +  +S T+D+RSRN++  DR AL         +LDETQQSWLL P 
Sbjct  1    MHSGNNWGGSFEIINGAESTTEDERSRNME-WDRGALQSQQQRYHNNLDETQQSWLLYPQ  59

Query  195  EQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
            E KKK+YVD GCI+ SRK  KWTV S+L A +++ L  +I KT+P+H    PPPDNYTLA
Sbjct  60   ETKKKKYVDFGCIVCSRKALKWTVYSILIAFLVIALPTIIAKTLPKHKSHPPPPDNYTLA  119

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKAL+FFNAQRSGKLPK+N + WRG+S ++DG   D      LVGGYYDAGD +KFNFP
Sbjct  120  LHKALLFFNAQRSGKLPKNNGIPWRGDSGLQDGNDTDYK--GGLVGGYYDAGDNVKFNFP  177

Query  555  QSFALTMLSWSVIEYSAK  608
             SF +TMLSWS+IEY+ K
Sbjct  178  MSFTMTMLSWSLIEYNHK  195



>ref|NP_001147970.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|ACG29288.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
Length=623

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 142/195 (73%), Gaps = 9/195 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  206
            MY  + WGG  EI   D A +DD SRN+ DLDR ALS      LDETQQSWLLGP E KK
Sbjct  1    MYSANHWGGSFEI--ADGAAEDDHSRNM-DLDRGALSARQHHELDETQQSWLLGPPEAKK  57

Query  207  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K +YVDLGC++V RK+  W +  V+AA VL+GL ++I K++P      PPPD YT ALHK
Sbjct  58   KDKYVDLGCVVVKRKLLWWALWCVVAAFVLIGLPIIIAKSIPHKKPGPPPPDQYTEALHK  117

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SG LPK+N + WRGNS + DG SD   +   LVGGYYDAGD IKF+FP +F
Sbjct  118  ALLFFNAQKSGHLPKNNGIKWRGNSGLSDG-SDAKDVKGGLVGGYYDAGDNIKFHFPMAF  176

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  177  SMTLLSWSVIEYSAK  191



>ref|NP_001288466.1| endoglucanase 12-like [Zea mays]
 gb|ACG29946.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|AFW60051.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|AGG19096.1| cellulase [Zea mays]
Length=623

 Score =   189 bits (481),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 142/195 (73%), Gaps = 9/195 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  206
            MY  + WGG  EI   D A +DD SRN+ DLDR ALS      LDETQQSWLLGP E KK
Sbjct  1    MYSANHWGGSFEIA--DGAAEDDHSRNM-DLDRGALSARQHHELDETQQSWLLGPPEAKK  57

Query  207  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K +YVDLGCI+V RK+  W +  V+AA VL+GL ++I K++P      PPPD YT ALHK
Sbjct  58   KDKYVDLGCIVVKRKMLWWALWCVVAAFVLIGLPIIIAKSIPHKKPGPPPPDQYTDALHK  117

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SG LPK+N + WRGNS + DG SD   +   LVGGYYDAGD IKF+FP +F
Sbjct  118  ALLFFNAQKSGHLPKNNGIKWRGNSGLSDG-SDAKDVKGGLVGGYYDAGDNIKFHFPMAF  176

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  177  SMTLLSWSVIEYSAK  191



>sp|Q7XUK4.2|GUN12_ORYSJ RecName: Full=Endoglucanase 12; AltName: Full=Endo-1,4-beta glucanase 
12; AltName: Full=OsGLU3 [Oryza sativa Japonica Group]
 emb|CAD41250.2| OSJNBa0067K08.14 [Oryza sativa Japonica Group]
 emb|CAH67495.1| H0306B06.10 [Oryza sativa Indica Group]
 emb|CAH67511.1| OSIGBa0092E01.6 [Oryza sativa Indica Group]
 dbj|BAL14837.1| endo-1,4-b-D-glucanase [Oryza sativa Japonica Group]
Length=623

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKKK  209
            MY  + WGG  EI A D A +DD SRN+ DLDR ALS     LDETQQSWLLGP E KKK
Sbjct  1    MYSANHWGGSFEIAA-DGAAEDDHSRNM-DLDRGALSARQHQLDETQQSWLLGPPEAKKK  58

Query  210  -RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
             +YVDLGC++V RK+  W + ++LAA +L+GL V+I K++P+     PPPD YT ALHKA
Sbjct  59   DKYVDLGCVVVKRKLLWWVLWTLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            L+FFNAQ+SG+LPK+N + WRGNS + DG SD   +   LVGGYYDAGD IKF+FP +F+
Sbjct  119  LLFFNAQKSGRLPKNNGIKWRGNSGLSDG-SDLTDVKGGLVGGYYDAGDNIKFHFPLAFS  177

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  178  MTMLSWSVIEYSAK  191



>ref|XP_006652472.1| PREDICTED: endoglucanase 12-like [Oryza brachyantha]
Length=629

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 145/194 (75%), Gaps = 7/194 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKKK  209
            MY  + WGG  EI A D A +DD SRN+ DLDR ALS     LDETQQSWLLGP E KKK
Sbjct  1    MYSANHWGGSFEIAA-DGAAEDDHSRNM-DLDRGALSARQHQLDETQQSWLLGPPEAKKK  58

Query  210  -RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
             +YVDLGC++V RK+  W +  +LAA +L+GL V+I K++P+     PPPD YT ALHKA
Sbjct  59   DKYVDLGCVVVKRKLLWWILWVLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKA  118

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            L+FFNAQ+SG+LPK+N + WRGNS + DG SD   +   LVGGYYDAGD IKF+FP +F+
Sbjct  119  LLFFNAQKSGRLPKNNGIKWRGNSGLSDG-SDLTDVKGGLVGGYYDAGDNIKFHFPLAFS  177

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEYSAK
Sbjct  178  MTMLSWSVIEYSAK  191



>ref|XP_004976098.1| PREDICTED: endoglucanase 12-like [Setaria italica]
Length=623

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 138/195 (71%), Gaps = 9/195 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  206
            MY  + WGG  EI   D A +DD SRN+ DLDR ALS      LDETQQSWLLGP E KK
Sbjct  1    MYSGNQWGGSFEI--GDGAAEDDHSRNM-DLDRGALSARQHHELDETQQSWLLGPPEAKK  57

Query  207  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K +YVDLGC++V RKV  W +  ++ A VL+GL ++I K +P      PP D YT  LHK
Sbjct  58   KDKYVDLGCVVVKRKVLWWALWCLVGAFVLIGLPIIIAKAIPHKKPRPPPDDQYTEVLHK  117

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL FFNAQ+SG+LPK+N V WRGNS + DG SD   +   LVGGYYDAGD IKF+FP +F
Sbjct  118  ALRFFNAQKSGRLPKNNGVPWRGNSGLSDG-SDAKDVKGGLVGGYYDAGDNIKFHFPMAF  176

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  177  SMTLLSWSVIEYSAK  191



>ref|XP_008813788.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 143/193 (74%), Gaps = 6/193 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGPTEQKKKR-  212
            M+  + WGG  EIH  D  TDD+  R++ DLDRAA+SR  LDETQQSWLL P +  KK+ 
Sbjct  1    MHSGNHWGGTFEIHV-DPVTDDEHGRSM-DLDRAAVSRQQLDETQQSWLLEPQDSSKKKD  58

Query  213  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
             YVDLGC++  RKV  W + + L A V++G+ ++I K++P+H     PPD YT+ALHKAL
Sbjct  59   EYVDLGCVVCKRKVVGWIMWTALVAFVVIGIPIIIAKSLPKHKEKELPPDQYTMALHKAL  118

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            +FFNAQ+SG+LPK+N +SWRGNS ++DG  D   I   LVGGYYDAGD IKF+FP ++++
Sbjct  119  LFFNAQKSGRLPKNNGISWRGNSGLKDG-FDQPDIEGGLVGGYYDAGDNIKFHFPMAYSM  177

Query  570  TMLSWSVIEYSAK  608
            T+LSWSVIEYS K
Sbjct  178  TLLSWSVIEYSHK  190



>ref|XP_002961082.1| hypothetical protein SELMODRAFT_75214 [Selaginella moellendorffii]
 gb|EFJ38621.1| hypothetical protein SELMODRAFT_75214 [Selaginella moellendorffii]
Length=613

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 146/190 (77%), Gaps = 8/190 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MY  + WGGPLE+  + S  ++D+S    DLDRAAL + L+ETQQSWLLG  E+K+K+ +
Sbjct  1    MY-HNSWGGPLEL--DPSVNEEDQSNRSMDLDRAALQK-LEETQQSWLLGAGEKKRKKTI  56

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+ S+K+F   V ++LA   + G  VLIVKT PRHHR   PPDNYTLALHKAL FF
Sbjct  57   DLGCIVCSQKLFLGIVYAILAVGFIAGFTVLIVKTAPRHHRHPSPPDNYTLALHKALKFF  116

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP  NN+S+RG+S ++DG  + A    DLVGGYYDAGD IKF+FPQ+FA+T+L
Sbjct  117  NAQKSGKLPHGNNISYRGDSGLKDGSDNQA----DLVGGYYDAGDNIKFHFPQAFAMTLL  172

Query  579  SWSVIEYSAK  608
            SWSVIEYS+K
Sbjct  173  SWSVIEYSSK  182



>ref|XP_004976099.1| PREDICTED: endoglucanase 12-like [Setaria italica]
Length=629

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 140/196 (71%), Gaps = 9/196 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS------LDETQQSWLLGPTEQ  200
            MY  + WGG  EI A D A++DD SRN+ DLD  AL  +      LDETQQ WLLGP  +
Sbjct  1    MYSANHWGGSFEI-ATDGASEDDDSRNM-DLDPGALQSARQLRHELDETQQGWLLGPPAK  58

Query  201  KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALH  380
            KK R+VDLGC++V RKV  W    ++A  VLVGL V+I K++PR     PPPD Y  ALH
Sbjct  59   KKNRHVDLGCVVVKRKVLWWAFWGLVAGFVLVGLPVIISKSIPRKTPRPPPPDQYAEALH  118

Query  381  KALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQS  560
            KAL+FFNAQ+SG+LP+ N + WRGNS ++DG SD   +   LVGGYYDAGD IKF+FP +
Sbjct  119  KALLFFNAQKSGRLPRSNGIPWRGNSGLKDG-SDAKDVKGGLVGGYYDAGDNIKFHFPMA  177

Query  561  FALTMLSWSVIEYSAK  608
            F++T+LSWSVIEYSAK
Sbjct  178  FSMTLLSWSVIEYSAK  193



>ref|XP_011077092.1| PREDICTED: endoglucanase 12 [Sesamum indicum]
Length=620

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 148/190 (78%), Gaps = 8/190 (4%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALSR-----SLDETQQSWLLGPTEQKKKR-YV  218
            WGG LEI+  DS T+D++SRN+ D DRA++S      +LDETQQSWLLGP+++KKK+ YV
Sbjct  5    WGGTLEINGADSTTEDEKSRNM-DWDRASISHQGYHHTLDETQQSWLLGPSDKKKKKKYV  63

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+ SR   KWT+GS+L A  ++GL ++I K++P+H    PPPDNYT+ALHKAL+FF
Sbjct  64   DLGCIVCSRTALKWTLGSILVAFFVIGLPIIIAKSIPKHKPRPPPPDNYTVALHKALLFF  123

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLPK+N + WRG+S ++DG  +   +   LVGGYYDAGD  KFNFP SFA+TML
Sbjct  124  NAQKSGKLPKNNGIPWRGDSGLQDGL-NQTDLKGGLVGGYYDAGDNTKFNFPMSFAMTML  182

Query  579  SWSVIEYSAK  608
            SWSVIEY  K
Sbjct  183  SWSVIEYEHK  192



>ref|XP_009602898.1| PREDICTED: endoglucanase 12 [Nicotiana tomentosiformis]
Length=635

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 146/209 (70%), Gaps = 21/209 (10%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALSR-----------------SLD  161
            M+  + WGG LEI    + +A + DRSRNL D DRA+++                  +LD
Sbjct  1    MHSANHWGGSLEIANTGDSTAEEYDRSRNL-DWDRASVNHHQKQQQYNNYDQYSHRHNLD  59

Query  162  ETQQSWLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhr  341
            ETQQSWLLGP E+KKK+YVDLGCI+ SRK FK+T+  ++ A +++ L  +I K++P+H  
Sbjct  60   ETQQSWLLGPPEKKKKKYVDLGCIVCSRKAFKYTIYGIIIAFLVIALPTIIAKSLPKHKT  119

Query  342  pnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYY  521
               PPDNYT+ALHKAL+FFNAQ+SGKLPK+N V WRG+S ++DG S    +   L+GGYY
Sbjct  120  RPSPPDNYTIALHKALLFFNAQKSGKLPKNNEVPWRGDSGLQDG-SKLTDVKGGLIGGYY  178

Query  522  DAGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            DAGD  KF+FP SFA+TMLSWSVIEY  K
Sbjct  179  DAGDNTKFHFPMSFAMTMLSWSVIEYEHK  207



>ref|XP_002966925.1| hypothetical protein SELMODRAFT_408186 [Selaginella moellendorffii]
 gb|EFJ31524.1| hypothetical protein SELMODRAFT_408186 [Selaginella moellendorffii]
Length=613

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  218
            MY  + WGGPLE+  + S  ++D+S    DLDRAAL + L+ETQQSWLLG  E+K+K+ +
Sbjct  1    MY-HNSWGGPLEL--DPSVNEEDQSNRSMDLDRAALQK-LEETQQSWLLGAGEKKRKKTI  56

Query  219  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  398
            DLGCI+ S+K+F   V ++LA   + G  VLIVKT PRHHR + PPDNYT+ALHKAL FF
Sbjct  57   DLGCIVCSQKLFLGIVYAILAVGFIAGFTVLIVKTAPRHHRHSSPPDNYTIALHKALKFF  116

Query  399  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTML  578
            NAQ+SGKLP  NN+S+RG+S ++DG  + A    DLVGGYYDAGD IKF+FPQ+FA+T+L
Sbjct  117  NAQKSGKLPHGNNISYRGDSGLKDGSDNQA----DLVGGYYDAGDNIKFHFPQAFAMTLL  172

Query  579  SWSVIEYSAK  608
            SWSVIEYS+K
Sbjct  173  SWSVIEYSSK  182



>ref|XP_006353239.1| PREDICTED: endoglucanase 12-like [Solanum tuberosum]
Length=634

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 139/203 (68%), Gaps = 21/203 (10%)
 Frame = +3

Query  57   WGGPLEIH---ANDSATDDD-RSRNLQDLDRAAL---------------SRSLDETQQSW  179
            WGG LEI      +S TDDD RSRN  DLDRA++               SR+LDETQQSW
Sbjct  6    WGGALEIATTTGGESTTDDDNRSRNF-DLDRASVNQLQRYDNYDRSTQSSRNLDETQQSW  64

Query  180  LLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppd  359
            LLGP E+KKK+YVDLGCII SRK  K+T+  ++ A  ++ L  ++VK  P+H      PD
Sbjct  65   LLGPPEKKKKKYVDLGCIICSRKALKYTLIGIIVAFAVIALPTIVVKVWPKHKSQPSLPD  124

Query  360  nYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAI  539
            NYT ALHK LMFF+AQ+SGKLPK N + WRG+S ++DG S    +   LVGGYYDAGD I
Sbjct  125  NYTFALHKVLMFFDAQKSGKLPKTNGIPWRGDSGLQDG-SKLTDVKGGLVGGYYDAGDNI  183

Query  540  KFNFPQSFALTMLSWSVIEYSAK  608
            KF++P SFA+TMLSWSVIEY  K
Sbjct  184  KFHYPMSFAMTMLSWSVIEYEHK  206



>ref|XP_009782313.1| PREDICTED: endoglucanase 12 [Nicotiana sylvestris]
Length=634

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 145/208 (70%), Gaps = 20/208 (10%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDD--DRSRNLQDLDRAALS----------------RSLDE  164
            M+  + WGG LEI  N  +T +  DRSRNL D D+A+++                 +LDE
Sbjct  1    MHSANHWGGSLEIANNGDSTAEEYDRSRNL-DWDKASINHQQQQQYNNYDQYSQRHNLDE  59

Query  165  TQQSWLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrp  344
            TQQSWLLGP E+KKK++VDLGCI+ SRK FK+T+  ++ A +++ L  +I KT+P+H   
Sbjct  60   TQQSWLLGPPEKKKKKHVDLGCIVCSRKAFKYTIYGIIIAFLVIALPTIIAKTLPKHKTR  119

Query  345  npppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYD  524
              PPDNYT+ALHKAL+FFNAQ+SGKLPK N + WRG+S ++DG S    +   L+GGYYD
Sbjct  120  PSPPDNYTIALHKALLFFNAQKSGKLPKSNGIPWRGDSGLKDG-SKLTDVKGGLIGGYYD  178

Query  525  AGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            AGD  KF+FP SFA+TMLSWSVIEY  K
Sbjct  179  AGDNTKFHFPMSFAMTMLSWSVIEYEHK  206



>ref|XP_011010912.1| PREDICTED: endoglucanase 12 [Populus euphratica]
 ref|XP_011010993.1| PREDICTED: endoglucanase 12 [Populus euphratica]
Length=620

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 142/194 (73%), Gaps = 6/194 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH-ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKK  206
            M+  + WGG LEI+   +S TDDD+SRN++  D+AAL      LDETQQSWLL P E KK
Sbjct  1    MHSANHWGGSLEIYNGTESTTDDDKSRNME-WDKAALQPQHHHLDETQQSWLLYPQETKK  59

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGC+  S K  KWT+ + + A +++ L  ++VKT+P+H+   PPPDNYTLAL KA
Sbjct  60   KKYVDLGCVACSHKALKWTLYAFVFALLVIALPTIVVKTLPKHNSQPPPPDNYTLALRKA  119

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            L+FFNAQ+SGKL K+N + WRG+S ++DG   D +    LVGGYYDAGD  KF+FP +FA
Sbjct  120  LLFFNAQKSGKLHKNNGIPWRGDSGLQDGNGTDFSK-AGLVGGYYDAGDNTKFHFPMAFA  178

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY  K
Sbjct  179  MTMLSWSVIEYRQK  192



>ref|XP_003580066.1| PREDICTED: endoglucanase 12 [Brachypodium distachyon]
Length=622

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 143/195 (73%), Gaps = 10/195 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS----LDETQQSWLLGPTEQKK  206
            M+ ++ WGG  EI       +DD SRN+ D+DR AL       LDETQQSWLLGP E KK
Sbjct  1    MHSQNHWGGSFEI---ADGAEDDHSRNM-DIDRGALQHQQHHQLDETQQSWLLGPPEAKK  56

Query  207  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K +YVDLGC++V RK+  W + +VL A VL+GL ++I K++P+     PPPD YT ALHK
Sbjct  57   KDKYVDLGCVVVKRKLLWWILWAVLGAFVLIGLPIIIAKSIPKKKPHAPPPDKYTDALHK  116

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SGKLPK+N + WRGNS ++DG SD   +   LVGGYYDAGD IKF+FP +F
Sbjct  117  ALLFFNAQKSGKLPKNNGIPWRGNSGLKDG-SDLTDVKGGLVGGYYDAGDNIKFHFPMAF  175

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSV+EYSA+
Sbjct  176  SMTLLSWSVVEYSAR  190



>ref|XP_008801082.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 144/193 (75%), Gaps = 6/193 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSR-SLDETQQSWLLGPTE--QKKK  209
            M+  + WGG  EIH  D ATDD+ SR+L DLDR ALSR  LDETQQSWLL P +  QKK 
Sbjct  1    MHSGNQWGGAFEIHV-DPATDDEHSRSL-DLDRGALSRHQLDETQQSWLLEPQDGSQKKD  58

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            +YVDLGC++  RKV  W + S L A V+VG+ ++IVK++P+H    PPPD Y +AL KAL
Sbjct  59   KYVDLGCVVCKRKVLWWVIWSALIAFVVVGIPIIIVKSLPKHKEKAPPPDRYAMALQKAL  118

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            +FFNAQ+SG+LPK+N + WRG+S ++DG  D   I   LVGGYYDAGD IKF+FP ++++
Sbjct  119  LFFNAQKSGRLPKNNGIPWRGDSGLKDG-FDQPDIKGGLVGGYYDAGDNIKFHFPMAYSM  177

Query  570  TMLSWSVIEYSAK  608
            T+LSWSVIEYS K
Sbjct  178  TLLSWSVIEYSQK  190



>ref|XP_010065082.1| PREDICTED: endoglucanase 12 [Eucalyptus grandis]
 gb|KCW87984.1| hypothetical protein EUGRSUZ_A00393 [Eucalyptus grandis]
Length=629

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 140/198 (71%), Gaps = 12/198 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDS--ATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQ  200
            M+ R+ WGG  EI+  DS  A DD RSR   + DRAAL       LDETQQSWLLG   Q
Sbjct  1    MHARNHWGGSFEINGGDSSAAEDDQRSR---EWDRAALQPQQHHELDETQQSWLLGNHNQ  57

Query  201  K--KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
            +  K +YVDLGC++ SRK  KWT  + +AA  L+ L V+IVKTVPRH    PPPDNYT+A
Sbjct  58   RPQKNKYVDLGCVVCSRKALKWTGWAFVAAFFLIALPVIIVKTVPRHKARPPPPDNYTVA  117

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKAL+FFNAQ+SGKLPK+N + WRGNS + DG      +   LVGGYYDAGD  KF+FP
Sbjct  118  LHKALLFFNAQKSGKLPKNNPIPWRGNSGLTDGNG-TTDVKGGLVGGYYDAGDNTKFHFP  176

Query  555  QSFALTMLSWSVIEYSAK  608
             +FA++MLSWSVIEYS K
Sbjct  177  MAFAMSMLSWSVIEYSHK  194



>gb|AEO97186.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97213.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=621

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 139/195 (71%), Gaps = 7/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  203
            M+  + WGG  EI+  A +S TDD++SRN++  D+AAL      LDETQQSWLL   E K
Sbjct  1    MHSANHWGGSFEIYNGAAESTTDDEKSRNME-WDKAALQPQRHHLDETQQSWLLYRQETK  59

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD GCI  S +  KWT+ + + A +++ L  ++ KT+P+H     PPDNYTLALHK
Sbjct  60   KKKYVDFGCIACSHRALKWTLYAFVFAVLVILLPTVLAKTLPKHRSKPSPPDNYTLALHK  119

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SGKLPK+N + WR +S ++DG   D +    LVGGYYDAGD  KF+FP +F
Sbjct  120  ALLFFNAQKSGKLPKNNGIPWREDSGLQDGNGSDFSKL-GLVGGYYDAGDNTKFHFPMAF  178

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYS K
Sbjct  179  AMTMLSWSVIEYSQK  193



>ref|XP_002514768.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47322.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=624

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 143/200 (72%), Gaps = 14/200 (7%)
 Frame = +3

Query  39   MYGRDPWGGPLEI-HANDSATDDDRSRNLQDLDRAAL--------SRSLDETQQSWLLGP  191
            M+  + WGG  EI +  +S  +D RSRN++  DR AL        + +LDETQQSWLL P
Sbjct  1    MHSGNNWGGSFEIMNGAESTAEDQRSRNIE-WDRGALHSQQHYHHNHNLDETQQSWLLYP  59

Query  192  TEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  371
             E KKK+Y+D GCI+ S K FKWT+ S+L A +++ L  ++ KT+P+H    PPPDNYTL
Sbjct  60   QETKKKKYIDFGCIVCSHKAFKWTLYSILIAFLVIALPTIVAKTLPKHKSSPPPPDNYTL  119

Query  372  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFK-DLVGGYYDAGDAIKFN  548
            ALHKAL+FFNAQRSGKLPK+N + WRG+S ++DG   D   FK  L GGYYDAGD IKF+
Sbjct  120  ALHKALLFFNAQRSGKLPKNNGIPWRGDSGLQDGNDTD---FKAGLDGGYYDAGDNIKFH  176

Query  549  FPQSFALTMLSWSVIEYSAK  608
            FP ++ +TMLSWS+IEY+ K
Sbjct  177  FPMAYTMTMLSWSLIEYNHK  196



>gb|AFZ78628.1| korrigan [Populus tomentosa]
Length=691

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 139/195 (71%), Gaps = 7/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  203
            M+  + WGG  EI+  A +S TDD++SRN++  D+AAL      LDETQQSWLL   E K
Sbjct  1    MHSANHWGGSFEIYNGAAESTTDDEKSRNME-WDKAALQPQRHHLDETQQSWLLYRQETK  59

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD GCI  S +  KWT+ + + A +++ L  ++ KT+P+H     PPDNYTLALHK
Sbjct  60   KKKYVDFGCIACSHRALKWTLYAFVFAVLVILLPTVLAKTLPKHRSKPSPPDNYTLALHK  119

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SGKLPK+N + WR +S ++DG   D +    LVGGYYDAGD  KF+FP +F
Sbjct  120  ALLFFNAQKSGKLPKNNGIPWREDSGLQDGNGSDFSKL-GLVGGYYDAGDNTKFHFPMAF  178

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYS K
Sbjct  179  AMTMLSWSVIEYSQK  193



>ref|XP_010929679.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=619

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 145/194 (75%), Gaps = 6/194 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSR-SLDETQQSWLLGPTE---QKK  206
            MY  + WGGP EIH +   ++D++SRN+ DLDRAAL R  LDET+Q WLL P +   +KK
Sbjct  1    MYSTNHWGGPFEIHVDPMLSEDEQSRNM-DLDRAALQRQELDETEQGWLLRPQDTEMKKK  59

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K+YVDLGCI+  R++ KW + SVL   ++VG+ V++ KT+P+H  P  PPDNY +ALH A
Sbjct  60   KKYVDLGCILCKREMLKWLILSVLIGFIVVGIPVIVAKTLPKHREPVSPPDNYAVALHMA  119

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            L FF+AQ+SG+LPK+N+V WRGNS + DG    A +   LVGGYYD+G+ IKF+FP +F+
Sbjct  120  LKFFDAQKSGRLPKNNDVPWRGNSGLEDGIGL-ADLKGGLVGGYYDSGNNIKFHFPMAFS  178

Query  567  LTMLSWSVIEYSAK  608
            +T+LSWSVIEYS K
Sbjct  179  MTLLSWSVIEYSHK  192



>gb|AGG19084.1| cellulase [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 9/191 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS--LDETQQSWLLGPTEQKKK-  209
            M+ ++ WGG  +I       +DD+SRN+ D+DR AL     LDETQQSWLLGP E KKK 
Sbjct  1    MHSQNHWGGTFDI----DGAEDDQSRNM-DIDRGALQHQHQLDETQQSWLLGPPEAKKKD  55

Query  210  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  389
            RYVDLGC++V RK+  W + +VL A VL+G+ ++I K +P+     PPPD YT ALHKAL
Sbjct  56   RYVDLGCVVVKRKLLWWMLWAVLGAFVLIGVPIIIAKNIPKKKHHAPPPDKYTDALHKAL  115

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            +FFNAQ+SGKLPK+N + WRGNS M+DG +D   +   LVGGYYDAGD IKF+FP +F++
Sbjct  116  LFFNAQKSGKLPKNNGIPWRGNSGMKDG-ADLPDVKGGLVGGYYDAGDNIKFHFPMAFSM  174

Query  570  TMLSWSVIEYS  602
            T+LSWSV+EY+
Sbjct  175  TLLSWSVVEYA  185



>ref|XP_002446733.1| hypothetical protein SORBIDRAFT_06g021440 [Sorghum bicolor]
 gb|EES11061.1| hypothetical protein SORBIDRAFT_06g021440 [Sorghum bicolor]
Length=630

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 141/195 (72%), Gaps = 8/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  206
            MY  + WGG  +I   D A+++D SRN  D+D  ALS      LDETQQ WLLGP E KK
Sbjct  1    MYSANHWGGSFDI-TTDGASEEDDSRN-TDVDGGALSARQHHELDETQQGWLLGPPEAKK  58

Query  207  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            K R+VDLGC++V RKV  W    ++A  VLVGL +++ K++PR   P PPPD Y  ALHK
Sbjct  59   KGRHVDLGCVLVKRKVLWWAFWGLVAGFVLVGLPIIVYKSIPRRAPPPPPPDQYAEALHK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SG++PK+N + WRGNS ++DG SD   +   LVGGYYDAGD IKF+FP +F
Sbjct  119  ALLFFNAQKSGRIPKNNGIPWRGNSGLKDG-SDAKDVKGGLVGGYYDAGDNIKFHFPMAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>gb|AFZ78629.1| korrigan [Populus tomentosa]
Length=621

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 140/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  203
            M+  + WGG LEI+  + +S TDD++SRN++  D+AAL      LDETQQSWLL P E K
Sbjct  1    MHSANHWGGSLEIYNGSAESTTDDEKSRNME-WDKAALQPQHHHLDETQQSWLLYPQETK  59

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD+GC+  S K  KWT+ + + A +++ L  ++ +T+P+H     PPDNYT+AL K
Sbjct  60   KKKYVDMGCVACSHKALKWTLYAFVFALLVIALPTILAETLPKHKSKPTPPDNYTIALQK  119

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SGKL K+N + WRG+S ++DG   D +    LVGGYYDAGD  KF+FP +F
Sbjct  120  ALLFFNAQKSGKLHKNNGIPWRGDSGLQDGNGTDFSK-AGLVGGYYDAGDNTKFHFPMAF  178

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEY  K
Sbjct  179  AMTMLSWSVIEYRQK  193



>ref|XP_002312211.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE89578.1| endo-1 family protein [Populus trichocarpa]
 gb|AEO97187.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97214.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=620

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 143/194 (74%), Gaps = 6/194 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH-ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKK  206
            M+  + WGG LEI+   +S TDD++SRN++  D+AAL      LDETQQSWLL P E KK
Sbjct  1    MHSANHWGGSLEIYNGAESTTDDEKSRNME-WDKAALQPQHHHLDETQQSWLLYPQETKK  59

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
            K++VDLGC+  S K  KWT+ + + A +++ L +++VKT+P+H+   PPPDNYTLAL KA
Sbjct  60   KKHVDLGCVACSHKALKWTLYAFVFALLVIALPIILVKTLPKHNSKPPPPDNYTLALRKA  119

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            L+FFNAQ+SGKL K+N + WRG+S ++DG   D +    LVGGYYDAGD  KF+FP +FA
Sbjct  120  LLFFNAQKSGKLHKNNGIPWRGDSGLQDGNGTDFSK-AGLVGGYYDAGDNTKFHFPMAFA  178

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSVIEY  K
Sbjct  179  MTMLSWSVIEYRQK  192



>ref|XP_011014603.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014609.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014618.1| PREDICTED: endoglucanase 12-like isoform X2 [Populus euphratica]
Length=621

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 138/195 (71%), Gaps = 7/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  203
            M+  + WGG  EI+  A +S TD ++SRN++  D+AAL      LDETQQSWLL   E K
Sbjct  1    MHSANHWGGSFEIYNGAAESTTDYEKSRNMER-DKAALHPQRHHLDETQQSWLLYRQETK  59

Query  204  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            KK+YVD GCI  S +  KWT+ + + A +++ L  ++ KT+P+H     PPDNYTLALHK
Sbjct  60   KKKYVDFGCIACSHRALKWTLYAFVFAVLVILLPTVLAKTLPKHRSKPSPPDNYTLALHK  119

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SGKLPK+N + WR +S ++DG   D +    LVGGYYDAGD  KF+FP +F
Sbjct  120  ALLFFNAQKSGKLPKNNGIPWREDSGLQDGNGSDFSKL-GLVGGYYDAGDNTKFHFPMAF  178

Query  564  ALTMLSWSVIEYSAK  608
            A+TMLSWSVIEYS K
Sbjct  179  AMTMLSWSVIEYSQK  193



>ref|XP_010533225.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 137/204 (67%), Gaps = 35/204 (17%)
 Frame = +3

Query  69   LEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCIIVSRK  248
            + I A DS+T DDRS NLQDLD AA         +S LLGP+E+KKK Y+DL     SRK
Sbjct  1    MSIDAADSSTGDDRSWNLQDLDHAA------AVSRSSLLGPSERKKK-YIDL----ASRK  49

Query  249  VFKWTvgsvlaaavlvglivlivKTVprhhr------------------------pnppp  356
            +  WTVG++LAA  L G I L VK VPRH+                           PP 
Sbjct  50   IVLWTVGTILAAGFLAGFITLNVKNVPRHNHKHWPQDSYPIALHKALETASRHRDQTPPR  109

Query  357  dnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDA  536
            +NYT ALHKALMFFNAQRSG+LPKHNNV WRG+SC++DGK    + +KDLVGGYYDAGDA
Sbjct  110  NNYTAALHKALMFFNAQRSGELPKHNNVPWRGDSCLQDGKGTSGSFYKDLVGGYYDAGDA  169

Query  537  IKFNFPQSFALTMLSWSVIEYSAK  608
            IKFNFP SFA+TMLSWSVIEYSAK
Sbjct  170  IKFNFPMSFAMTMLSWSVIEYSAK  193



>gb|EAY94707.1| hypothetical protein OsI_16485 [Oryza sativa Indica Group]
 gb|EAZ31232.1| hypothetical protein OsJ_15332 [Oryza sativa Japonica Group]
Length=641

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 146/212 (69%), Gaps = 25/212 (12%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKKK  209
            MY  + WGG  EI A D A +DD SRN+ DLDR ALS     LDETQQSWLLGP E KKK
Sbjct  1    MYSANHWGGSFEIAA-DGAAEDDHSRNM-DLDRGALSARQHQLDETQQSWLLGPPEAKKK  58

Query  210  -RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
             +YVDLGC++V RK+  W + ++LAA +L+GL V+I K++P+     PPPD YT ALHKA
Sbjct  59   DKYVDLGCVVVKRKLLWWVLWTLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKA  118

Query  387  LMFFNAQRS------------------GKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVG  512
            L+FFNAQ+S                  G+LPK+N + WRGNS + DG SD   +   LVG
Sbjct  119  LLFFNAQKSLLSLTNNFGHVSFSALTAGRLPKNNGIKWRGNSGLSDG-SDLTDVKGGLVG  177

Query  513  GYYDAGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            GYYDAGD IKF+FP +F++TMLSWSVIEYSAK
Sbjct  178  GYYDAGDNIKFHFPLAFSMTMLSWSVIEYSAK  209



>ref|XP_006468640.1| PREDICTED: endoglucanase 12-like [Citrus sinensis]
Length=637

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 140/210 (67%), Gaps = 21/210 (10%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDD---------------DRSRNLQDLDRAALS----RSLD  161
            M+G + WGG LEI  ++S  +                  S +  D DRAAL       LD
Sbjct  1    MHGGNHWGGSLEIVNSNSIAEGFADSNNNRSNNNNNNHSSSSTDDWDRAALHSQRFHHLD  60

Query  162  ETQQSWLLGPTE-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhh  338
            ETQQSWLLGP E  KK RYVDLGCI+VSRK  KWTV S L A +++GL V+I K++P+H 
Sbjct  61   ETQQSWLLGPKETNKKNRYVDLGCIVVSRKALKWTVASFLIAFLVIGLPVIIAKSLPKHK  120

Query  339  rpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGY  518
               P PD+YT ALHKAL+FFNAQ+SGKLPK+N + WRGNS + DG S    +   LVGGY
Sbjct  121  SAPPSPDDYTHALHKALLFFNAQKSGKLPKNNGIPWRGNSGLSDGNS-TTDVKGGLVGGY  179

Query  519  YDAGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            YDAGD  KF+FP SFA+TMLSWS+IEY+ K
Sbjct  180  YDAGDNTKFHFPMSFAMTMLSWSLIEYNHK  209



>ref|XP_007028162.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
 gb|EOY08664.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
Length=619

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 147/196 (75%), Gaps = 12/196 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-----RSLDETQQSWLLGPTEQK  203
            M+ R+ WGG  +++  +    +++S N  + DRAAL      RSLDETQQ WLLGP + K
Sbjct  1    MHARNHWGGSFDVNHGE----EEKSWN-TEWDRAALQSQQQDRSLDETQQGWLLGPPQTK  55

Query  204  KK-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALH  380
            KK +YVDLGCI+ SRK FKWT+ S+L+A +++ + ++I K++P+H R  PPPDNYT+AL 
Sbjct  56   KKDKYVDLGCIVCSRKAFKWTLISILSAFIVIAVPIIIAKSLPKHTRRPPPPDNYTVALR  115

Query  381  KALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQS  560
            KAL+FFNAQ+SG LPK+N +SWRGNS + DGK ++  +   LVGGYYDAGD  KF+FP +
Sbjct  116  KALLFFNAQKSGNLPKNNGISWRGNSGLNDGK-EEMDLKGWLVGGYYDAGDNTKFHFPMA  174

Query  561  FALTMLSWSVIEYSAK  608
            F++TMLSWS+IEYS K
Sbjct  175  FSMTMLSWSLIEYSHK  190



>ref|XP_006448516.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
 gb|ESR61756.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
Length=637

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 139/210 (66%), Gaps = 21/210 (10%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDD---------------DRSRNLQDLDRAALS----RSLD  161
            M+G + WGG LEI  ++S  +                  S +  D DRAAL       LD
Sbjct  1    MHGGNHWGGSLEIVNSNSIAEGFADSNHNRSNNNNNNHSSSSTDDWDRAALHSQRFHHLD  60

Query  162  ETQQSWLLGPTE-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhh  338
            ETQQSWLLGP E  KK RYVDLGCI+VS K  KWTV S L A +++GL V+I K++P+H 
Sbjct  61   ETQQSWLLGPKETNKKNRYVDLGCIVVSHKALKWTVASFLIAFLVIGLPVIIAKSLPKHK  120

Query  339  rpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGY  518
               P PD+YT ALHKAL+FFNAQ+SGKLPK+N + WRGNS + DG S    +   LVGGY
Sbjct  121  SAPPSPDDYTHALHKALLFFNAQKSGKLPKNNGIPWRGNSGLSDGNS-TTDVKGGLVGGY  179

Query  519  YDAGDAIKFNFPQSFALTMLSWSVIEYSAK  608
            YDAGD  KF+FP SFA+TMLSWS+IEY+ K
Sbjct  180  YDAGDNTKFHFPMSFAMTMLSWSLIEYNHK  209



>gb|EMT15171.1| Endoglucanase 12 [Aegilops tauschii]
Length=619

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 141/190 (74%), Gaps = 5/190 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPTEQKKK-R  212
            M+ ++ WGG  EI  + S  +D+ SRN+ D+D  AL  R LDETQ+SWLLGP E KKK +
Sbjct  1    MHSQNHWGGSFEI-TDPSEVEDNHSRNM-DIDPGALQQRQLDETQKSWLLGPPETKKKDK  58

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            Y+DLGC++V RK+    +G+VL A +L+GL ++I K++P+     P PD YT ALHKAL+
Sbjct  59   YIDLGCVLVKRKLLWSMLGAVLGAFLLIGLPIIIAKSIPKKPSRAPAPDKYTQALHKALL  118

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FF+AQ+SGKLPK N + WRGNS ++DG SD   +   LVGGYYDAGD IKF+FP +F++T
Sbjct  119  FFDAQKSGKLPKKNGIPWRGNSGLKDG-SDLRDVKGGLVGGYYDAGDNIKFHFPMAFSMT  177

Query  573  MLSWSVIEYS  602
            +LSWSV+EYS
Sbjct  178  LLSWSVVEYS  187



>ref|XP_010673846.1| PREDICTED: endoglucanase 12-like [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 138/206 (67%), Gaps = 17/206 (8%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAAL-------------SRSLDETQQSW  179
            M+  + WGG  E+   +   +D+RSR +++ DRA+L             S  LD  QQSW
Sbjct  1    MHNPNLWGGNYEVQIINKDVEDERSREMENWDRASLLYQEQLHQNGHNNSHELDHVQQSW  60

Query  180  LLGPTEQKKKR---YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnp  350
            LL P E +K R   YVDLGCI+V +K  KW   S L A +L+ + ++I K++P+H    P
Sbjct  61   LLAPQESRKNRKNMYVDLGCIVVKKKFLKWVFWSFLIAFILIAMPIIIAKSLPKHKHGPP  120

Query  351  ppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAG  530
            PPDNYTLALHKAL+FFNAQ+SGKLPK N ++WRGNS ++DG S  + +   LVGGYYD+G
Sbjct  121  PPDNYTLALHKALLFFNAQKSGKLPKKNGIAWRGNSGLKDG-SKLSDVKGGLVGGYYDSG  179

Query  531  DAIKFNFPQSFALTMLSWSVIEYSAK  608
            +  KF+FP ++A+TMLSWSVIEY  K
Sbjct  180  ENTKFHFPMAYAMTMLSWSVIEYPHK  205



>ref|XP_004250089.1| PREDICTED: endoglucanase 12 [Solanum lycopersicum]
Length=635

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 138/204 (68%), Gaps = 22/204 (11%)
 Frame = +3

Query  57   WGGPLEIHANDSAT-----DDDRSRNLQDLDRAAL---------------SRSLDETQQS  176
            WGG LEI    +       DD+RSRN  DLDRA++               SR+LDETQQS
Sbjct  6    WGGALEIATTTTGGESTTDDDNRSRNF-DLDRASVNQLQRYDIYDRSTQSSRNLDETQQS  64

Query  177  WLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnppp  356
            WLLGP  +KKK+YVDLGC+I SRK  K+T+  ++ A  ++ L  ++VK  P+H    P P
Sbjct  65   WLLGPPVKKKKKYVDLGCVICSRKALKYTLIGIIVAFAVIALPTIVVKVWPKHKSQPPLP  124

Query  357  dnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDA  536
            DNYT ALHKALMFF+AQ+SGKLPK N + WRG+S ++DG S    +   LVGGYYDAGD 
Sbjct  125  DNYTFALHKALMFFDAQKSGKLPKSNRIPWRGDSGLQDG-SKLTDVKGGLVGGYYDAGDN  183

Query  537  IKFNFPQSFALTMLSWSVIEYSAK  608
            IKF++P SFA+TMLSWSVIEY  K
Sbjct  184  IKFHYPMSFAMTMLSWSVIEYEHK  207



>ref|NP_001288520.1| uncharacterized protein LOC103641803 [Zea mays]
 gb|AFW58720.1| hypothetical protein ZEAMMB73_822588 [Zea mays]
 gb|AGG19093.1| cellulase [Zea mays]
Length=626

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 136/195 (70%), Gaps = 8/195 (4%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  206
            M+  + WGG  +I   D A++DD  RN  D+D  ALS      LDETQQ WLL P   KK
Sbjct  1    MHSVNHWGGSFDI-TTDVASEDDDCRN-TDVDAGALSARQHHELDETQQGWLLSPEGAKK  58

Query  207  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  383
            + R+VDLGC++V RKV +W    ++A  VLVGL V + K++P      PPPD Y  ALHK
Sbjct  59   RSRHVDLGCVVVKRKVLRWAFWGLVAGFVLVGLPVTVYKSIPHRPPRPPPPDRYAEALHK  118

Query  384  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSF  563
            AL+FFNAQ+SG++P++N + WRG+S ++DG SD   +   LVGGYYDAGD IKF+FP +F
Sbjct  119  ALLFFNAQKSGRIPRNNGIPWRGDSGLKDG-SDAKDVKGGLVGGYYDAGDNIKFHFPMAF  177

Query  564  ALTMLSWSVIEYSAK  608
            ++T+LSWSVIEYSAK
Sbjct  178  SMTLLSWSVIEYSAK  192



>ref|XP_001772986.1| predicted protein [Physcomitrella patens]
 gb|EDQ62211.1| predicted protein [Physcomitrella patens]
Length=610

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  236
            WGGP+E+  +  A DD RSRNL D+DRA++ +SL+ETQQSWLL P  +KKK+ +DLGC++
Sbjct  5    WGGPMEMATDSGAEDDTRSRNL-DVDRASV-KSLEETQQSWLLEPKTKKKKKEIDLGCMV  62

Query  237  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  416
             SRK+F    G++ AA+ +VGL +LI K  PR H   PP DNYT+AL  AL FF+AQ+SG
Sbjct  63   CSRKLFLIIFGTIFAASAIVGLSILIWKVAPRKHHRPPPLDNYTVALKLALKFFDAQKSG  122

Query  417  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIE  596
            +LPK NN+SWRG S +RDG+        +L GG+YDAGD IKF FP +FA+T+LSWSVIE
Sbjct  123  RLPKTNNISWRGTSALRDGRDAVGGNPTNLSGGFYDAGDNIKFGFPGAFAMTLLSWSVIE  182

Query  597  YSAK  608
            Y AK
Sbjct  183  YKAK  186



>ref|XP_003601506.1| Endoglucanase [Medicago truncatula]
 gb|AES71757.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=624

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 132/198 (67%), Gaps = 10/198 (5%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAN-DSATDDDRSRNLQDLDRAAL------SRSLDETQQSWLLG-PT  194
            M+ R+ WGG  E+ +N +  + D+ SR     D+AAL         LDET QSW+L  P 
Sbjct  1    MHSRNQWGGSFELSSNSEVPSGDETSRTGDQWDKAALLDHGNRREGLDETLQSWILERPN  60

Query  195  EQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
             +KK +YVD GCI++S K  KW  G +      +GL ++I K +P+HH    PPDNYTLA
Sbjct  61   MKKKTKYVDFGCIVLSHKALKWIFGIIFVGFCAIGLPIIIAKALPKHHPSPIPPDNYTLA  120

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKAL FFNAQ+SG+LPK N +SWR NS ++DGK  D    K LVGGYYDAGD IKF+FP
Sbjct  121  LHKALRFFNAQKSGRLPKSNGISWRRNSGLQDGKDTDDK--KGLVGGYYDAGDNIKFHFP  178

Query  555  QSFALTMLSWSVIEYSAK  608
             SFA+TMLSWSV+EY  K
Sbjct  179  MSFAMTMLSWSVLEYKQK  196



>ref|NP_176738.1| glycosyl hydrolase 9A2 [Arabidopsis thaliana]
 sp|O04478.1|GUN7_ARATH RecName: Full=Endoglucanase 7; AltName: Full=Endo-1,4-beta glucanase 
7 [Arabidopsis thaliana]
 gb|AAB60922.1| F5I14.14 [Arabidopsis thaliana]
 dbj|BAF01264.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34400.1| glycosyl hydrolase 9A2 [Arabidopsis thaliana]
Length=623

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 140/198 (71%), Gaps = 11/198 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALSR---SLDETQQSWLLGPTE--  197
            M+  + WGG L+   +D  +A +++R RN  + DR A+      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRIAAEEEERLRNTTEWDRGAIHSQRSELDETQQGWLLAPQDNW  60

Query  198  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
             +KKK+YV+LGC+ VSR VF WTVGS+    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSRTVFLWTVGSIAVLFLVVALPIIIVKSLPRHKSAPPPPDNYTLA  120

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKAL FF+AQ+SGKLPK N VSWRG+S  +DG  D   +   LVGGYYD G  +KF+FP
Sbjct  121  LHKALQFFDAQKSGKLPKKNKVSWRGDSGTKDGLPD---VVGGLVGGYYDGGSNVKFHFP  177

Query  555  QSFALTMLSWSVIEYSAK  608
             +F++TMLSWS+IEYS K
Sbjct  178  MAFSMTMLSWSLIEYSHK  195



>ref|XP_008791029.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=616

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 139/192 (72%), Gaps = 5/192 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSR-SLDETQQSWLLGPTE-QKKKR  212
            MY  + WGGP EI   DS+T+D++SR + DLDRA L R  LD T+Q WLL P + +KK +
Sbjct  1    MYSANHWGGPFEIQV-DSSTEDEQSRYV-DLDRAVLQRQELDTTEQGWLLRPRDAEKKSK  58

Query  213  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  392
            YVDLGCI+   +  +W + S L   V+VG+ +++ KT+P+H  P  PPDNYT+ALH AL 
Sbjct  59   YVDLGCILCKWETLRWVIWSALIGFVVVGIPIIVAKTLPKHREPISPPDNYTVALHMALK  118

Query  393  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALT  572
            FF+AQ+SG+LPK+N+V WRGNS + DG      +   LVGGYYD+G+ IKF+FP +F++T
Sbjct  119  FFDAQKSGRLPKNNDVLWRGNSGLEDGIGF-TELKGGLVGGYYDSGNNIKFHFPMAFSMT  177

Query  573  MLSWSVIEYSAK  608
            +LSWSVIEYS K
Sbjct  178  LLSWSVIEYSHK  189



>ref|XP_010528623.1| PREDICTED: endoglucanase 7 [Tarenaya hassleriana]
Length=632

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 143/207 (69%), Gaps = 20/207 (10%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAND----SATDDDRSRNLQDLDRAAL---------SRSLDETQQSW  179
            M+  + WGG L+    D    +A ++ R R   + DR A+          R LDETQQSW
Sbjct  1    MHPGNLWGGTLDAADGDRAATAAEEELRLREAAEWDRGAIHSQRLMGESQRYLDETQQSW  60

Query  180  LLGPTE----QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpn  347
            LL P E    +KKK++V+LGC+ VSRK F WTVGS+  A V+VGL +++ K++PRH    
Sbjct  61   LLSPQETLRNKKKKKHVNLGCVSVSRKAFLWTVGSIAVAFVVVGLPIIVAKSLPRHKSAP  120

Query  348  pppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  527
            PPPDNYTLALHKAL+FFNAQ+SGKLPK+N +SWRG+S + DG ++ A     LVGGYYD 
Sbjct  121  PPPDNYTLALHKALLFFNAQKSGKLPKNNGISWRGDSGLNDGSAEVA---GGLVGGYYDG  177

Query  528  GDAIKFNFPQSFALTMLSWSVIEYSAK  608
            G  +KF+FP +F++TMLSWS+IEYS K
Sbjct  178  GTNVKFHFPMAFSMTMLSWSLIEYSHK  204



>ref|XP_010415102.1| PREDICTED: endoglucanase 7-like [Camelina sativa]
Length=623

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 140/198 (71%), Gaps = 11/198 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTE--  197
            M+  + WGG L+   +D  +A +++R RN+ D DR A+      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRAAADEEERRRNMTDWDRGAIHSQRHELDETQQGWLLAPQDSW  60

Query  198  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
             +KKK+YV+LGC+ VSR V  WTVG++    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSRTVCMWTVGAIAVLFIVVALPIIIVKSLPRHKSIPPPPDNYTLA  120

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKA+ FF+AQ+SGKLPK N VSWRG+S ++DG  D   +   LVGGYYD G   KF+FP
Sbjct  121  LHKAIKFFDAQKSGKLPKKNKVSWRGDSGLKDGLPD---VVGGLVGGYYDEGSNGKFHFP  177

Query  555  QSFALTMLSWSVIEYSAK  608
             +F++TMLSWS+IEYS K
Sbjct  178  MAFSMTMLSWSLIEYSHK  195



>gb|KHN09941.1| Endoglucanase 7 [Glycine soja]
Length=630

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 139/200 (70%), Gaps = 11/200 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNL--QDLDRAAL-------SRSLDETQQSWLLGP  191
            M+ R+ WGG  E+ ++        + N   ++ DRAAL       S+ LDET QSW+LG 
Sbjct  1    MHSRNNWGGSFEMSSSGEEVSGYEANNNHNKEWDRAALLERYHPQSQDLDETLQSWVLGR  60

Query  192  TEQKKK-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYT  368
             E+ KK +YVD GCI++S K  KW  GS+  A +++GL ++IVK++P+HH P  PPDNYT
Sbjct  61   GEKSKKTKYVDFGCIMISHKALKWLFGSIFLAFIVIGLPIIIVKSLPKHHSPPTPPDNYT  120

Query  369  LALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFN  548
            LALHKAL+FFNAQ+SG+LPK N + WRGNS + DG +D   +   LVGGYYDAGD  KF+
Sbjct  121  LALHKALLFFNAQKSGRLPKSNGIPWRGNSGLNDG-NDTTDVKGGLVGGYYDAGDNTKFH  179

Query  549  FPQSFALTMLSWSVIEYSAK  608
            FP +FA+TMLSWSV+EY  K
Sbjct  180  FPMAFAMTMLSWSVLEYKQK  199



>ref|XP_003556773.1| PREDICTED: endoglucanase 12-like [Glycine max]
Length=630

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 139/200 (70%), Gaps = 11/200 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNL--QDLDRAAL-------SRSLDETQQSWLLGP  191
            M+ R+ WGG  E+ ++        + N   ++ DRAAL       S+ LDET QSW+LG 
Sbjct  1    MHSRNNWGGSFEMSSSGEEVSGYEANNNHNKEWDRAALLERYHPQSQDLDETLQSWVLGR  60

Query  192  TEQKKK-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYT  368
             E+ KK +YVD GCI++S K  KW  GS+  A +++GL ++IVK++P+HH P  PPDNYT
Sbjct  61   GEKSKKTKYVDFGCIMISHKALKWLFGSIFLAFIVIGLPIIIVKSLPKHHSPPTPPDNYT  120

Query  369  LALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFN  548
            LALHKAL+FFNAQ+SG+LPK N + WRGNS + DG +D   +   LVGGYYDAGD  KF+
Sbjct  121  LALHKALLFFNAQKSGRLPKSNGIPWRGNSGLNDG-NDTTDVKGGLVGGYYDAGDNTKFH  179

Query  549  FPQSFALTMLSWSVIEYSAK  608
            FP +FA+TMLSWSV+EY  K
Sbjct  180  FPMAFAMTMLSWSVLEYKQK  199



>ref|XP_004152840.1| PREDICTED: endoglucanase 7-like [Cucumis sativus]
 gb|KGN61236.1| hypothetical protein Csa_2G072990 [Cucumis sativus]
Length=627

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 11/199 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSA--TDDDRSRNLQDLDRAALS------RSLDETQQSWLLGPT  194
            M G + WGGPLE+  N+     D DR    +D DRAAL         LDETQ+SWLLGP 
Sbjct  1    MQGGNHWGGPLEVIDNNGGGGEDHDRRTAAEDWDRAALQSQTFNQNELDETQRSWLLGPP  60

Query  195  E-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  371
            + +KKK+YVDLGC++VSRK  KW++ S+L A  ++GL +++ KT PRHH P  PPD Y+ 
Sbjct  61   DGKKKKKYVDLGCVMVSRKALKWSLISILIAFCVIGLPIIVAKTWPRHHPPPLPPDRYSE  120

Query  372  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNF  551
            AL KAL+FFNAQ+SG+L K NN++WRGNS + DG    A     LVGGYYD+G+  K+NF
Sbjct  121  ALRKALLFFNAQKSGRLGKSNNITWRGNSGLNDGNETLAK--GGLVGGYYDSGENSKYNF  178

Query  552  PQSFALTMLSWSVIEYSAK  608
            P ++++TMLSWS+IEYS K
Sbjct  179  PMAYSMTMLSWSLIEYSHK  197



>ref|XP_004169320.1| PREDICTED: endoglucanase 7-like [Cucumis sativus]
Length=627

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 11/199 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSA--TDDDRSRNLQDLDRAALS------RSLDETQQSWLLGPT  194
            M G + WGGPLE+  N+     D DR    +D DRAAL         LDETQ+SWLLGP 
Sbjct  1    MQGGNHWGGPLEVIDNNGGGGEDHDRRTAAEDWDRAALQSQTFNQNELDETQRSWLLGPP  60

Query  195  E-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  371
            + +KKK+YVDLGC++VSRK  KW++ S+L A  ++GL +++ KT PRHH P  PPD Y+ 
Sbjct  61   DGKKKKKYVDLGCVMVSRKALKWSLISILIAFCVIGLPIIVAKTWPRHHPPPLPPDRYSE  120

Query  372  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNF  551
            AL KAL+FFNAQ+SG+L K NN++WRGNS + DG    A     LVGGYYD+G+  K+NF
Sbjct  121  ALRKALLFFNAQKSGRLGKSNNITWRGNSGLNDGNETLAK--GGLVGGYYDSGENSKYNF  178

Query  552  PQSFALTMLSWSVIEYSAK  608
            P ++++TMLSWS+IEYS K
Sbjct  179  PMAYSMTMLSWSLIEYSHK  197



>ref|XP_002888427.1| hypothetical protein ARALYDRAFT_894138 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64686.1| hypothetical protein ARALYDRAFT_894138 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 138/198 (70%), Gaps = 11/198 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALSR---SLDETQQSWLLGPTE--  197
            M+  + WGG L+   +D  +A +++R R   + DR A+      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRIAAEEEERLRKTTEWDRGAIHSQRSELDETQQGWLLAPQDSW  60

Query  198  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
             +KKK+YV+LGC+ VS+    WT+G++    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSQTACMWTIGTIAVLFLVVALPIIIVKSLPRHKSTPPPPDNYTLA  120

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKAL FF+AQ+SGKLPK N VSWRG+S + DGK D   +   LVGGYYD G  IKF+FP
Sbjct  121  LHKALQFFDAQKSGKLPKKNKVSWRGDSGLGDGKPD---VVGGLVGGYYDGGSNIKFHFP  177

Query  555  QSFALTMLSWSVIEYSAK  608
             +F++TMLSWS+IEYS K
Sbjct  178  MAFSMTMLSWSLIEYSHK  195



>ref|XP_010496067.1| PREDICTED: endoglucanase 7 [Camelina sativa]
Length=623

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 141/198 (71%), Gaps = 11/198 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTE--  197
            M+  + WGG L+   +D  +A +++R+RN+ D D+ ++      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRAAADEEERTRNMTDWDKGSIHSQRHELDETQQGWLLAPQDSW  60

Query  198  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  374
             +KKK+YV+LGC+ VSR V  WTVG++    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSRTVCMWTVGAIAVLFIVVALPIIIVKSLPRHKSIPPPPDNYTLA  120

Query  375  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFP  554
            LHKA+ FF+AQ+SGKLPK + VSWRG+S ++DG  D   +   LVGGYYD G   KF+FP
Sbjct  121  LHKAIKFFDAQKSGKLPKKDKVSWRGDSGLKDGLPD---VVGGLVGGYYDGGSNGKFHFP  177

Query  555  QSFALTMLSWSVIEYSAK  608
             +F++TMLSWS+IEYS K
Sbjct  178  MAFSMTMLSWSLIEYSHK  195



>ref|XP_008441913.1| PREDICTED: endoglucanase 7 [Cucumis melo]
Length=628

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 140/200 (70%), Gaps = 12/200 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLEI---HANDSATDDDRSRNLQDLDRAAL------SRSLDETQQSWLLGP  191
            M G + WGGPLE+   +      D D+ R  +D DRAAL         LDETQ+SWLLGP
Sbjct  1    MQGGNHWGGPLEVIDDNNGGGGKDHDQRRAAEDWDRAALRSQSFNQNELDETQRSWLLGP  60

Query  192  TE-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYT  368
             + +KKK+YVDLGC++VSRK  KW++ S+L A  ++GL +++ KT PRHH P  PPD Y+
Sbjct  61   PDGKKKKKYVDLGCVMVSRKALKWSLISILIAFCVIGLPIIVAKTWPRHHPPPLPPDRYS  120

Query  369  LALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFN  548
             AL KAL+FFNAQ+SG+L K NN+ WRGNS + DG  +D      LVGGYYD+G+  K+N
Sbjct  121  EALRKALLFFNAQKSGRLGKSNNIRWRGNSGVNDG--NDTLAKGGLVGGYYDSGENSKYN  178

Query  549  FPQSFALTMLSWSVIEYSAK  608
            FP ++++TMLSWS+IEYS K
Sbjct  179  FPMAYSMTMLSWSLIEYSHK  198



>ref|XP_004502103.1| PREDICTED: endoglucanase 12-like [Cicer arietinum]
Length=620

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 133/194 (69%), Gaps = 6/194 (3%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSL--DETQQSWLL--GPTEQKK  206
            M+ R+ WGG  E+ + +  +  + S   Q  D+AAL      DET QSW+L    T++KK
Sbjct  1    MHSRNQWGGSFELSSGEVVSGYEISPAEQ-WDKAALLEQPRRDETLQSWILERSETKRKK  59

Query  207  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  386
             +YVD GCI++S K  KW  GS+  A  ++GL ++I   +P+HH    PPDNYTLALHKA
Sbjct  60   SKYVDFGCIVLSHKALKWIFGSIFVAFCVIGLPIIIAHFLPKHHAKPIPPDNYTLALHKA  119

Query  387  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFA  566
            L FFNAQ+SGKLPK+N + WRGNS ++DGK D   +   LVGGYYDAGD IKF+FP SFA
Sbjct  120  LRFFNAQKSGKLPKNNGIPWRGNSGLQDGK-DSNDVKGGLVGGYYDAGDNIKFHFPMSFA  178

Query  567  LTMLSWSVIEYSAK  608
            +TMLSWSV+EY  K
Sbjct  179  MTMLSWSVLEYKQK  192



>ref|XP_009127411.1| PREDICTED: endoglucanase 7 [Brassica rapa]
Length=630

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 140/205 (68%), Gaps = 18/205 (9%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSR--NLQDLDRAALS----------RSLDETQQSWL  182
            M+  + WGG L+   +D A  ++  R  N+ + DR AL             LDETQQ WL
Sbjct  1    MHPGNLWGGRLDAIDSDRAEAEEEERRRNMTEWDRGALHSQQLSAEHQRNQLDETQQGWL  60

Query  183  LGPTE---QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpp  353
            L P +   +K+K+YV+LGCI VSR VF WTVGS++   ++V L ++IVK++PRH    PP
Sbjct  61   LAPQDSWKKKRKKYVNLGCISVSRTVFTWTVGSIVVLFLVVALPIIIVKSLPRHKSTPPP  120

Query  354  pdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGD  533
            PDNYTLA+HKA+ FF+AQ+SGKLPK+N VSWRGNS ++DG  D   +   LVGGYYD G 
Sbjct  121  PDNYTLAIHKAIQFFDAQKSGKLPKNNRVSWRGNSGLKDGLPD---VVGGLVGGYYDGGS  177

Query  534  AIKFNFPQSFALTMLSWSVIEYSAK  608
              KF+FP +F++TMLSWS+IEYS K
Sbjct  178  NTKFHFPMAFSMTMLSWSLIEYSQK  202



>ref|XP_001775325.1| predicted protein [Physcomitrella patens]
 gb|EDQ59795.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = +3

Query  60   GGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCIIV  239
            GGP+ +  +  A DD RSR + D D A+L +SL+ETQQSWLL P   K+K+ +DLGC++ 
Sbjct  7    GGPMRMIMDSEAGDDTRSRKM-DFDMASL-KSLEETQQSWLLEPAAPKEKKEIDLGCVVC  64

Query  240  SRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSGK  419
            SRK+F   +G++ AA  +VGL +LI K  PR     PP DNYT+AL  AL FF+AQ+SG 
Sbjct  65   SRKMFFILIGTLFAAGAIVGLSILIYKFAPRKQHHPPPLDNYTIALKMALKFFDAQKSGH  124

Query  420  LPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIEY  599
            LP  NN+SWR +S + DG+  DA +  +L GGYYDAGD IKF FP ++A+T+LSWSVIEY
Sbjct  125  LPPSNNISWRSHSGLNDGR--DAGV--NLTGGYYDAGDNIKFGFPAAYAMTLLSWSVIEY  180

Query  600  SAK  608
             +K
Sbjct  181  KSK  183



>ref|XP_006300882.1| hypothetical protein CARUB_v10019972mg [Capsella rubella]
 gb|EOA33780.1| hypothetical protein CARUB_v10019972mg [Capsella rubella]
Length=624

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 12/199 (6%)
 Frame = +3

Query  39   MYGRDPWGGPLE---IHANDSATDDDRSRNLQDLDRA---ALSRSLDETQQSWLLGPTE-  197
            M+  + WGG L+   I   ++  ++ R RN+ D DR    +    LDETQQ WLL P + 
Sbjct  1    MHPGNVWGGSLDAVDIDRAEAEEEEQRRRNMTDWDRGVNHSQRHELDETQQGWLLAPQDS  60

Query  198  --QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  371
              +KKKRYV+LGC+ VSR VF WTVGS+    ++V L ++IVK++P+H    PP DNYTL
Sbjct  61   WKKKKKRYVNLGCVSVSRTVFMWTVGSIAVLFIVVALPIIIVKSLPKHESTLPPSDNYTL  120

Query  372  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNF  551
            A+HKA+ FF+AQ+SGKLPK N VSWRG+S ++DG  D   +   LVGGYYD G   KF+F
Sbjct  121  AIHKAIKFFDAQKSGKLPKKNKVSWRGDSGLKDGFPD---VVGGLVGGYYDGGSNGKFHF  177

Query  552  PQSFALTMLSWSVIEYSAK  608
            P +F++TMLSWS+IEYS K
Sbjct  178  PMAFSMTMLSWSLIEYSHK  196



>ref|XP_009403795.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=618

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 135/191 (71%), Gaps = 4/191 (2%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGPTEQKKKRY  215
            M+  + WGG  +I  +DS  DD +S N+  +D+AAL R  LDETQQ WLLGP + KK +Y
Sbjct  1    MHYSNRWGGSFDIQ-HDSHADDVQSSNMA-IDKAALLREQLDETQQGWLLGPRDVKKDKY  58

Query  216  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  395
            +DL  ++  +++ KW V S+L A V++G+ +++ K +P H  P   PD YT+AL  AL F
Sbjct  59   IDLWIVVCKKEMVKWVVYSLLIAFVVIGVPIVVAKMIPTHKEPVLLPDEYTVALRLALEF  118

Query  396  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTM  575
            FNAQ+SG+LPK+N V WRGNS ++DG S+ + +   LVGGYYD+G+ IKF++P +F++T+
Sbjct  119  FNAQKSGRLPKNNGVPWRGNSGLQDG-SELSDVIGGLVGGYYDSGNNIKFHYPMAFSMTL  177

Query  576  LSWSVIEYSAK  608
            LSWS +EY  K
Sbjct  178  LSWSAVEYGPK  188



>gb|KFK41003.1| hypothetical protein AALP_AA2G072700 [Arabis alpina]
Length=630

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 18/205 (9%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSR--NLQDLDRAALS----------RSLDETQQSWL  182
            M+  + WGG L+   +D A  ++  R  N+ + DR AL             LDETQQSWL
Sbjct  1    MHPGNLWGGRLDAVDSDRAAAEEEERRRNMTEWDRGALHSQRLTAESERNQLDETQQSWL  60

Query  183  LGPTE---QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpp  353
            L P +   +K+K+YV+LGC+ VSR VF WTVGS++   ++V L ++IVK++P H    P 
Sbjct  61   LAPEDSWRKKRKKYVNLGCVSVSRTVFLWTVGSIVVLFLVVALPIIIVKSLPPHKSAPPT  120

Query  354  pdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGD  533
             DNYTLALH AL FF+AQ+SG+LPK+N VSWRG+S ++DG  D   +   LVGGYYD G 
Sbjct  121  SDNYTLALHNALQFFDAQKSGRLPKNNKVSWRGDSGLKDGLPD---VPGGLVGGYYDGGS  177

Query  534  AIKFNFPQSFALTMLSWSVIEYSAK  608
              KF+FP +F++TMLSWS+IEYS K
Sbjct  178  NTKFHFPMAFSMTMLSWSLIEYSHK  202



>ref|XP_006391540.1| hypothetical protein EUTSA_v10018270mg [Eutrema salsugineum]
 gb|ESQ28826.1| hypothetical protein EUTSA_v10018270mg [Eutrema salsugineum]
Length=630

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 18/205 (9%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSR--NLQDLDRAALS----------RSLDETQQSWL  182
            M+  + WGG L+   +D A  ++  R  N+ + DR AL             LDETQQSWL
Sbjct  1    MHPGNLWGGNLDAVDSDRAAAEEEERRRNMMEWDRGALHSQQLTAENQRNQLDETQQSWL  60

Query  183  LGPTE---QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpp  353
            L P +   +K+K+YV+LGC+ V R V  WTVGS++   ++V L ++IVKT+PRH    PP
Sbjct  61   LAPQDSWKKKRKKYVNLGCVSVGRTVCMWTVGSIVVLFLVVALPIIIVKTLPRHKSTPPP  120

Query  354  pdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGD  533
             DNYTLALHKAL FF+AQ+SGKLPK N VSWRG+S ++DG  D   +   LVGGYYD G 
Sbjct  121  SDNYTLALHKALQFFDAQKSGKLPKKNRVSWRGDSGLKDGLPD---VPGGLVGGYYDGGS  177

Query  534  AIKFNFPQSFALTMLSWSVIEYSAK  608
             IKF+FP +F++TMLSWS+IEY+ K
Sbjct  178  NIKFHFPMAFSMTMLSWSLIEYNHK  202



>ref|XP_001759056.1| predicted protein [Physcomitrella patens]
 gb|EDQ76125.1| predicted protein [Physcomitrella patens]
Length=610

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 129/184 (70%), Gaps = 2/184 (1%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  236
            WGG +++     A DD  S+N  D+DRA++ +SL+ET QSWLL P  +KKK+ +DLGC++
Sbjct  5    WGGSVDMATGSGAEDDTHSKN-PDVDRASV-KSLEETHQSWLLEPKAEKKKKEIDLGCMV  62

Query  237  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  416
             SRK+F     + +AA+ +VGL VL  K  PR H   PP DNYT+AL  AL FF+AQ+SG
Sbjct  63   CSRKLFLILFVTTIAASSIVGLSVLFWKMTPRKHHHPPPLDNYTIALKMALKFFDAQKSG  122

Query  417  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSVIE  596
            +LPK NN+SWR +S + DG+        DL GGYYDAGD IKF FP +FA+T+LSWSVIE
Sbjct  123  RLPKSNNISWRESSALLDGQVAINGNPTDLSGGYYDAGDNIKFGFPGAFAMTLLSWSVIE  182

Query  597  YSAK  608
            Y AK
Sbjct  183  YKAK  186



>gb|EMS51342.1| Endoglucanase 9 [Triticum urartu]
Length=694

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = +3

Query  198  QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLAL  377
            +KKKRYVDLGC++VSRK+F WT+G +LAAA L G+ V I K VPRH  P  PPD +TLAL
Sbjct  129  RKKKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAVGIAKAVPRHQAPPTPPDQFTLAL  188

Query  378  HKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQ  557
             KALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD G A+KFNF  
Sbjct  189  RKALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDGGSAVKFNFAS  247

Query  558  SFALTMLSWSVIEYSAK  608
            +F++T+LSWSVIEY+AK
Sbjct  248  AFSMTLLSWSVIEYNAK  264



>gb|EPS58029.1| endo-1,4-beta-glucanase, partial [Genlisea aurea]
Length=629

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 134/199 (67%), Gaps = 16/199 (8%)
 Frame = +3

Query  57   WGGPLEIHANDSATDDDRSR---NLQDLDRAALSR----SLDETQQSWLL-GPTEQKKKR  212
            WGG LEI ++  +   +  +   N Q+ DRA++      SLD+TQQ WLL  P+E+KK +
Sbjct  3    WGGSLEITSSGGSPFSEEEKSIGNHQEWDRASIGHIKHHSLDDTQQGWLLLDPSEKKKTK  62

Query  213  -------YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  371
                   +VDLGC++ SR   KW+V  +  A +++ L V+++K+VP    P PPPDNYT 
Sbjct  63   KKKKNDGFVDLGCVVCSRTALKWSVSLLAIAFLVIFLPVVVLKSVPEDRPPPPPPDNYTA  122

Query  372  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNF  551
            ALHKAL+FFNAQ+SGKLP  N + WRG+S + DG  +   +   LVGGYYD+G++ K++F
Sbjct  123  ALHKALLFFNAQKSGKLPADNGIPWRGDSGLTDGL-NATDVEGGLVGGYYDSGESTKYHF  181

Query  552  PQSFALTMLSWSVIEYSAK  608
            P SFA+TMLSWSVIEY AK
Sbjct  182  PLSFAMTMLSWSVIEYEAK  200



>gb|AFR40441.1| cellulase, partial [Populus nigra]
 gb|AFR40445.1| cellulase, partial [Populus nigra]
 gb|AFR40449.1| cellulase, partial [Populus nigra]
Length=89

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40406.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40415.1| cellulase, partial [Populus trichocarpa]
Length=86

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40402.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40404.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40407.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40410.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40411.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40413.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40416.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40417.1| cellulase, partial [Populus alba]
 gb|AFR40419.1| cellulase, partial [Populus alba]
 gb|AFR40420.1| cellulase, partial [Populus alba]
 gb|AFR40421.1| cellulase, partial [Populus alba]
 gb|AFR40436.1| cellulase, partial [Populus nigra]
 gb|AFR40437.1| cellulase, partial [Populus nigra]
 gb|AFR40438.1| cellulase, partial [Populus nigra]
 gb|AFR40439.1| cellulase, partial [Populus nigra]
 gb|AFR40440.1| cellulase, partial [Populus nigra]
 gb|AFR40444.1| cellulase, partial [Populus nigra]
 gb|AFR40446.1| cellulase, partial [Populus nigra]
 gb|AFR40447.1| cellulase, partial [Populus nigra]
 gb|AFR40448.1| cellulase, partial [Populus nigra]
Length=89

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40405.1| cellulase, partial [Populus trichocarpa]
Length=85

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40409.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40418.1| cellulase, partial [Populus alba]
 gb|AFR40422.1| cellulase, partial [Populus alba]
 gb|AFR40423.1| cellulase, partial [Populus alba]
 gb|AFR40442.1| cellulase, partial [Populus nigra]
 gb|AFR40443.1| cellulase, partial [Populus nigra]
Length=88

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40430.1| cellulase, partial [Populus fremontii]
Length=81

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40426.1| cellulase, partial [Populus fremontii]
 gb|AFR40427.1| cellulase, partial [Populus fremontii]
 gb|AFR40431.1| cellulase, partial [Populus fremontii]
Length=87

 Score =   135 bits (339),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCFIVSRKIFVWT  76



>gb|AFR40424.1| cellulase, partial [Populus fremontii]
 gb|AFR40425.1| cellulase, partial [Populus fremontii]
 gb|AFR40429.1| cellulase, partial [Populus fremontii]
 gb|AFR40433.1| cellulase, partial [Populus fremontii]
 gb|AFR40434.1| cellulase, partial [Populus fremontii]
Length=88

 Score =   134 bits (338),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCFIVSRKIFVWT  76



>gb|AFR40432.1| cellulase, partial [Populus fremontii]
 gb|AFR40435.1| cellulase, partial [Populus fremontii]
Length=89

 Score =   134 bits (338),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCFIVSRKIFVWT  76



>gb|AFR40428.1| cellulase, partial [Populus fremontii]
Length=87

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCXIVSRKIFVWT  76



>ref|XP_008370239.1| PREDICTED: endoglucanase 9-like [Malus domestica]
Length=323

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = +3

Query  363  YTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIK  542
            Y LALHKALMFFNAQRSG+LP+HNNVSWR +SC+RDGK  D     DLVGGYYDAG+AIK
Sbjct  47   YKLALHKALMFFNAQRSGRLPRHNNVSWRSDSCLRDGKFTDT--LNDLVGGYYDAGNAIK  104

Query  543  FNFPQSFALTMLSWSVIEYSAK  608
            FNFP SFA+TMLSWSVIEYSAK
Sbjct  105  FNFPASFAMTMLSWSVIEYSAK  126



>gb|AFR40408.1| cellulase, partial [Populus trichocarpa]
Length=87

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLG IIVSRK+F WT
Sbjct  61   VDLGXIIVSRKIFVWT  76



>gb|AFR40412.1| cellulase, partial [Populus trichocarpa]
Length=89

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +3

Query  39   MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  215
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  216  VDLGCIIVSRKVFKWT  263
            VDLG IIVSRK+F WT
Sbjct  61   VDLGXIIVSRKIFVWT  76



>gb|EMT00674.1| Endoglucanase 10 [Aegilops tauschii]
Length=555

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +3

Query  231  IIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQR  410
            +++ RK+F WTVG +L   + VG +++IVK VP    P PPPD YTLALHKALMFFNAQR
Sbjct  1    MVIDRKIFMWTVGLILGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKALMFFNAQR  60

Query  411  SGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFALTMLSWSV  590
            SG LPKHN VSWRGNS M+DG S D+T+ K LVGG+YDAGDAIKFN+P ++++TMLSW+V
Sbjct  61   SGHLPKHNGVSWRGNSGMKDGLS-DSTVKKSLVGGFYDAGDAIKFNYPMAWSMTMLSWTV  119

Query  591  IEYSAK  608
            IEY AK
Sbjct  120  IEYRAK  125



>emb|CBI29606.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  390  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDAGDAIKFNFPQSFAL  569
            MFFNAQRSGKLPKHNNVSWRGNS M DGKS+  + +KDLVGGYYDAGDAIKFNFP SFA+
Sbjct  1    MFFNAQRSGKLPKHNNVSWRGNSGMNDGKSETGSFYKDLVGGYYDAGDAIKFNFPMSFAM  60

Query  570  TMLSWSVIEYSAK  608
            TMLSWSVIEYSAK
Sbjct  61   TMLSWSVIEYSAK  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800