BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018B12

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01995.1|  unnamed protein product                                153   4e-64   Coffea canephora [robusta coffee]
ref|XP_009772840.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    150   4e-63   Nicotiana sylvestris
ref|XP_008452092.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    152   6e-63   Cucumis melo [Oriental melon]
ref|XP_010263617.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    151   6e-63   Nelumbo nucifera [Indian lotus]
ref|XP_006435021.1|  hypothetical protein CICLE_v10002155mg             153   6e-63   Citrus clementina [clementine]
ref|XP_009588225.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    150   7e-63   Nicotiana tomentosiformis
ref|XP_010061298.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    151   7e-63   Eucalyptus grandis [rose gum]
emb|CDP07494.1|  unnamed protein product                                152   8e-63   Coffea canephora [robusta coffee]
ref|XP_004146498.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    151   9e-63   Cucumis sativus [cucumbers]
gb|KDP38522.1|  hypothetical protein JCGZ_04447                         150   1e-62   Jatropha curcas
ref|XP_009391607.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    153   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233530.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    150   2e-62   
ref|XP_010265678.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    150   2e-62   Nelumbo nucifera [Indian lotus]
gb|KJB17752.1|  hypothetical protein B456_003G013500                    149   2e-62   Gossypium raimondii
gb|KJB43468.1|  hypothetical protein B456_007G201900                    149   3e-62   Gossypium raimondii
ref|XP_006878532.1|  hypothetical protein AMTR_s00011p00224870          148   3e-62   Amborella trichopoda
gb|KJB12032.1|  hypothetical protein B456_002G126800                    150   3e-62   Gossypium raimondii
ref|XP_002510412.1|  Protein yrdA, putative                             149   4e-62   Ricinus communis
ref|XP_006346962.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   4e-62   Solanum tuberosum [potatoes]
ref|XP_010102071.1|  hypothetical protein L484_009014                   150   4e-62   Morus notabilis
ref|XP_007046882.1|  Gamma carbonic anhydrase 1, CA1                    148   4e-62   Theobroma cacao [chocolate]
ref|XP_004160973.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   4e-62   
ref|XP_002282021.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    148   5e-62   Vitis vinifera
gb|KHG00707.1|  hypothetical protein F383_22748                         150   7e-62   Gossypium arboreum [tree cotton]
gb|KHG23300.1|  hypothetical protein F383_08437                         149   8e-62   Gossypium arboreum [tree cotton]
ref|XP_010113421.1|  hypothetical protein L484_026755                   148   8e-62   Morus notabilis
ref|XP_006466826.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    147   9e-62   Citrus sinensis [apfelsine]
gb|KDP38527.1|  hypothetical protein JCGZ_04452                         150   1e-61   Jatropha curcas
ref|NP_001275071.1|  transcription factor APFI-like                     147   1e-61   Solanum tuberosum [potatoes]
ref|XP_009371625.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    145   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_006425642.1|  hypothetical protein CICLE_v10026267mg             147   1e-61   Citrus clementina [clementine]
ref|XP_008338081.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    145   2e-61   
ref|XP_008338249.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    145   2e-61   Malus domestica [apple tree]
ref|XP_008786862.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    147   2e-61   Phoenix dactylifera
ref|XP_010922032.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   2e-61   Elaeis guineensis
ref|XP_009340721.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    145   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_008444737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    147   3e-61   Cucumis melo [Oriental melon]
gb|KJB12033.1|  hypothetical protein B456_002G126800                    149   3e-61   Gossypium raimondii
ref|XP_002510411.1|  Protein yrdA, putative                             146   4e-61   Ricinus communis
ref|XP_011074556.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    147   5e-61   Sesamum indicum [beniseed]
ref|XP_002302024.1|  transcription factor APFI family protein           146   5e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008788543.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   5e-61   Phoenix dactylifera
ref|XP_011007461.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   6e-61   Populus euphratica
ref|XP_004152688.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    146   6e-61   Cucumis sativus [cucumbers]
ref|XP_002306878.1|  transcription factor APFI family protein           144   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008241708.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   7e-61   Prunus mume [ume]
ref|XP_006386210.1|  hypothetical protein POPTR_0002s03550g             145   7e-61   
ref|XP_010931534.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    148   7e-61   Elaeis guineensis
ref|XP_009799511.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    151   8e-61   Nicotiana sylvestris
ref|XP_007204711.1|  hypothetical protein PRUPE_ppa009928mg             144   8e-61   Prunus persica
ref|XP_009799510.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    151   8e-61   Nicotiana sylvestris
ref|XP_011083204.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    146   1e-60   Sesamum indicum [beniseed]
dbj|BAB39954.1|  OSJNBa0004B13.8                                        150   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006383176.1|  hypothetical protein POPTR_0005s12280g             145   1e-60   Populus trichocarpa [western balsam poplar]
ref|NP_001042763.1|  Os01g0283100                                       151   1e-60   
gb|EEC70424.1|  hypothetical protein OsI_01428                          151   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_010550419.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    147   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_004287879.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   2e-60   Fragaria vesca subsp. vesca
ref|XP_011011740.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   2e-60   Populus euphratica
ref|XP_010029770.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   2e-60   Eucalyptus grandis [rose gum]
gb|KFK44104.1|  hypothetical protein AALP_AA1G216400                    145   2e-60   Arabis alpina [alpine rockcress]
ref|XP_004232424.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   3e-60   Solanum lycopersicum
ref|XP_006644073.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   4e-60   Oryza brachyantha
ref|XP_006340643.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   4e-60   Solanum tuberosum [potatoes]
ref|XP_010679759.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   4e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009399949.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017577.1|  Gamma carbonic anhydrase 1, CA1                    145   5e-60   
ref|XP_008810436.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   7e-60   Phoenix dactylifera
ref|XP_007204710.1|  hypothetical protein PRUPE_ppa009928mg             142   7e-60   
ref|XP_010538097.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    147   9e-60   Tarenaya hassleriana [spider flower]
ref|XP_009590737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    149   1e-59   Nicotiana tomentosiformis
ref|XP_003537599.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   1e-59   Glycine max [soybeans]
gb|ACU19296.1|  unknown                                                 144   1e-59   Glycine max [soybeans]
gb|AFK45344.1|  unknown                                                 141   2e-59   Medicago truncatula
ref|XP_009386943.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    147   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_564091.1|  gamma carbonic anhydrase 1                            144   2e-59   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43151.1|  unknown protein                                        144   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517218.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    142   3e-59   Glycine max [soybeans]
gb|ACU23675.1|  unknown                                                 142   3e-59   Glycine max [soybeans]
ref|XP_004291863.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    143   3e-59   Fragaria vesca subsp. vesca
gb|KHN36089.1|  Hypothetical protein glysoja_003212                     142   3e-59   Glycine soja [wild soybean]
ref|XP_006305516.1|  hypothetical protein CARUB_v10009987mg             144   4e-59   Capsella rubella
gb|EPS71345.1|  hypothetical protein M569_03414                         144   5e-59   Genlisea aurea
ref|XP_007136608.1|  hypothetical protein PHAVU_009G0592001g            141   6e-59   Phaseolus vulgaris [French bean]
ref|XP_009110271.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    142   6e-59   Brassica rapa
gb|AAM61583.1|  unknown                                                 142   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477178.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   7e-59   
emb|CDX96658.1|  BnaA08g22010D                                          142   7e-59   
ref|XP_010484635.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    140   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010498381.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010459631.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    144   8e-59   Camelina sativa [gold-of-pleasure]
gb|KCW68228.1|  hypothetical protein EUGRSUZ_F01883                     151   9e-59   Eucalyptus grandis [rose gum]
ref|XP_010679758.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    143   9e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009365039.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    140   1e-58   Pyrus x bretschneideri [bai li]
ref|NP_001185039.1|  gamma carbonic anhydrase 1                         143   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336133.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    140   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_004512067.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    143   1e-58   Cicer arietinum [garbanzo]
ref|XP_004967660.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    145   1e-58   Setaria italica
ref|XP_003612060.1|  Transcription factor APFI-like protein             145   1e-58   Medicago truncatula
ref|XP_006393845.1|  hypothetical protein EUTSA_v10004794mg             140   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010444788.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    138   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006416491.1|  hypothetical protein EUTSA_v10008724mg             141   2e-58   
ref|XP_007222873.1|  hypothetical protein PRUPE_ppa009923mg             140   2e-58   Prunus persica
ref|XP_008220827.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    140   3e-58   Prunus mume [ume]
ref|XP_008655471.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    143   3e-58   
ref|XP_007156970.1|  hypothetical protein PHAVU_002G032600g             142   4e-58   Phaseolus vulgaris [French bean]
ref|XP_008364986.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    140   4e-58   
ref|XP_002455477.1|  hypothetical protein SORBIDRAFT_03g011540          141   6e-58   Sorghum bicolor [broomcorn]
ref|XP_009365536.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    140   6e-58   Pyrus x bretschneideri [bai li]
emb|CDX83758.1|  BnaC08g18870D                                          142   8e-58   
ref|XP_003612061.1|  Transcription factor APFI-like protein             143   8e-58   
dbj|BAD44607.1|  unknown protein                                        139   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDM82924.1|  unnamed protein product                                144   1e-57   Triticum aestivum [Canadian hard winter wheat]
gb|AFK48594.1|  unknown                                                 138   1e-57   Lotus japonicus
ref|XP_003567426.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    142   1e-57   Brachypodium distachyon [annual false brome]
gb|EYU31197.1|  hypothetical protein MIMGU_mgv1a012119mg                137   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_010465384.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    139   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008388037.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    137   3e-57   Malus domestica [apple tree]
ref|XP_008672300.1|  PREDICTED: uncharacterized protein LOC100217...    142   6e-57   Zea mays [maize]
ref|XP_003523810.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    137   8e-57   Glycine max [soybeans]
gb|AFK46651.1|  unknown                                                 137   1e-56   Lotus japonicus
ref|NP_569036.1|  gamma carbonic anhydrase 3                            135   1e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01732.1|  predicted protein                                      140   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001137016.1|  uncharacterized protein LOC100217184               140   2e-56   Zea mays [maize]
tpg|DAA54233.1|  TPA: hypothetical protein ZEAMMB73_935334              140   3e-56   
gb|AFK40628.1|  unknown                                                 135   5e-56   Lotus japonicus
ref|XP_010523601.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    136   6e-56   Tarenaya hassleriana [spider flower]
gb|ACG35255.1|  transcription factor APFI                               141   7e-56   Zea mays [maize]
gb|KFK28325.1|  hypothetical protein AALP_AA8G501300                    133   1e-55   Arabis alpina [alpine rockcress]
ref|XP_002890347.1|  F18O14.34                                          131   1e-55   
gb|ACU22925.1|  unknown                                                 134   1e-55   Glycine max [soybeans]
emb|CDY45234.1|  BnaA07g12560D                                          131   2e-55   Brassica napus [oilseed rape]
ref|XP_009103523.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    131   2e-55   Brassica rapa
gb|AAF79435.1|AC025808_17  F18O14.34                                    130   4e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30772.1|  BnaC07g16720D                                          131   7e-55   Brassica napus [oilseed rape]
ref|XP_002865062.1|  gamma CA3                                          138   8e-55   
gb|ADQ43216.1|  GAMMA CA3/carbonate dehydratase                         139   1e-54   Schrenkiella parvula
gb|AFK09615.1|  gamma carbonic anhydrase 3                              138   2e-54   Arabidopsis kamchatica
ref|NP_001241093.1|  uncharacterized protein LOC100805278               126   2e-54   Glycine max [soybeans]
ref|XP_011083663.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    133   2e-54   Sesamum indicum [beniseed]
ref|XP_006393603.1|  hypothetical protein EUTSA_v10011707mg             128   3e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001078808.1|  gamma carbonic anhydrase 3                         136   4e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50984.1|  BnaC02g48920D                                          132   8e-54   Brassica napus [oilseed rape]
gb|AFK09616.1|  gamma carbonic anhydrase 3                              136   5e-53   Arabidopsis halleri subsp. gemmifera
gb|AFK09618.1|  gamma carbonic anhydrase 3                              130   2e-52   Arabidopsis lyrata subsp. lyrata
gb|ABK26184.1|  unknown                                                 128   2e-52   Picea sitchensis
ref|XP_009612501.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    118   8e-52   Nicotiana tomentosiformis
emb|CDY67628.1|  BnaCnng55730D                                          121   1e-51   Brassica napus [oilseed rape]
ref|XP_002894036.1|  hypothetical protein ARALYDRAFT_891497             121   1e-51   
ref|NP_175159.1|  gamma carbonic anhydrase 2                            121   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304043.1|  hypothetical protein CARUB_v10009842mg             119   6e-51   
gb|AAK28403.1|AF249876_1  transcription factor APFI                     120   7e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009771198.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    116   9e-51   Nicotiana sylvestris
ref|XP_010500247.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    118   9e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010463232.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    118   1e-50   
ref|XP_004238283.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    114   1e-50   Solanum lycopersicum
ref|XP_009145039.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    120   2e-50   Brassica rapa
emb|CDY55089.1|  BnaA02g34770D                                          128   2e-50   Brassica napus [oilseed rape]
ref|XP_006341958.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    113   2e-50   Solanum tuberosum [potatoes]
emb|CDY47592.1|  BnaC08g04620D                                          115   3e-50   Brassica napus [oilseed rape]
ref|NP_001066265.1|  Os12g0169700                                       119   3e-50   
emb|CDY17034.1|  BnaA08g03980D                                          115   3e-50   Brassica napus [oilseed rape]
gb|EYU45182.1|  hypothetical protein MIMGU_mgv1a011728mg                114   6e-50   Erythranthe guttata [common monkey flower]
ref|XP_002463275.1|  hypothetical protein SORBIDRAFT_02g041030          117   9e-50   Sorghum bicolor [broomcorn]
gb|KEH36170.1|  gamma carbonic anhydrase-like protein                   115   1e-49   Medicago truncatula
gb|ACJ85087.1|  unknown                                                 114   2e-49   Medicago truncatula
ref|XP_006663861.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    118   2e-49   Oryza brachyantha
emb|CDY23649.1|  BnaA05g17800D                                          120   3e-49   Brassica napus [oilseed rape]
gb|KFK36155.1|  hypothetical protein AALP_AA4G085200                    117   4e-49   Arabis alpina [alpine rockcress]
ref|NP_001169012.1|  uncharacterized protein LOC100382844               116   6e-49   Zea mays [maize]
gb|EAZ04886.1|  hypothetical protein OsI_27068                          118   1e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_004958498.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    117   2e-48   Setaria italica
ref|XP_009107430.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    110   2e-48   
gb|AFK41197.1|  unknown                                                 113   2e-48   Medicago truncatula
ref|XP_002968991.1|  hypothetical protein SELMODRAFT_145865             123   3e-48   Selaginella moellendorffii
ref|NP_001060439.1|  Os07g0642900                                       114   2e-47   
gb|EPS62312.1|  hypothetical protein M569_12479                         108   9e-47   Genlisea aurea
ref|XP_003562574.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    108   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_001754319.1|  predicted protein                                  129   2e-44   
gb|KDO84602.1|  hypothetical protein CISIN_1g0242242mg                  150   7e-43   Citrus sinensis [apfelsine]
gb|ACG33606.1|  transcription factor APFI                               106   7e-41   Zea mays [maize]
gb|KJB17751.1|  hypothetical protein B456_003G013500                    149   1e-40   Gossypium raimondii
ref|XP_001776500.1|  predicted protein                                99.8    3e-40   
gb|KCW68230.1|  hypothetical protein EUGRSUZ_F01883                     116   5e-40   Eucalyptus grandis [rose gum]
gb|EMT05905.1|  hypothetical protein F775_31227                         140   4e-39   
ref|XP_002504597.1|  predicted protein                                99.0    6e-39   Micromonas commoda
ref|XP_001758123.1|  predicted protein                                  102   1e-38   
ref|XP_003059787.1|  predicted protein                                94.7    3e-37   Micromonas pusilla CCMP1545
gb|KJB43471.1|  hypothetical protein B456_007G201900                    116   1e-36   Gossypium raimondii
ref|XP_007136607.1|  hypothetical protein PHAVU_009G0592001g            112   4e-35   Phaseolus vulgaris [French bean]
gb|AFW79497.1|  hypothetical protein ZEAMMB73_562884                    108   3e-34   
gb|ACV52585.1|  transcription factor APFI-like protein                  106   5e-34   Nicotiana benthamiana
ref|XP_006305517.1|  hypothetical protein CARUB_v10009987mg             110   9e-34   
gb|AFK37757.1|  unknown                                                 112   9e-34   Medicago truncatula
tpg|DAA63887.1|  TPA: hypothetical protein ZEAMMB73_753225              105   9e-34   
dbj|BAB10927.1|  ferripyochelin-binding protein-like                    110   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011398885.1|  Uncharacterized protein F751_3627                97.8    3e-31   Auxenochlorella protothecoides
ref|XP_005536976.1|  transcription factor APFI                        86.7    2e-30   Cyanidioschyzon merolae strain 10D
gb|EMT05784.1|  hypothetical protein F775_31542                         105   3e-30   
ref|XP_008871299.1|  hypothetical protein H310_07655                  87.4    9e-30   Aphanomyces invadans
emb|CBI17490.3|  unnamed protein product                                105   2e-29   Vitis vinifera
ref|XP_009831264.1|  hypothetical protein H257_07436                  84.3    9e-29   Aphanomyces astaci
ref|XP_005644680.1|  gamma-carbonic anhydrase                         80.5    9e-29   Coccomyxa subellipsoidea C-169
ref|XP_005649920.1|  trimeric LpxA-like protein                       94.7    1e-28   Coccomyxa subellipsoidea C-169
gb|KDO22056.1|  hypothetical protein SPRG_12043                       88.6    2e-28   Saprolegnia parasitica CBS 223.65
ref|XP_008608997.1|  hypothetical protein SDRG_05080                  88.6    2e-28   Saprolegnia diclina VS20
emb|CCI47075.1|  unnamed protein product                              84.3    6e-28   Albugo candida
ref|XP_006297478.1|  hypothetical protein CARUB_v10013498mg             116   4e-27   Capsella rubella
ref|XP_005850191.1|  hypothetical protein CHLNCDRAFT_20587            84.3    6e-27   Chlorella variabilis
ref|XP_011398930.1|  Uncharacterized protein F751_3672                79.0    5e-26   Auxenochlorella protothecoides
dbj|GAM24838.1|  hypothetical protein SAMD00019534_080130             88.2    7e-26   Acytostelium subglobosum LB1
ref|XP_005847553.1|  hypothetical protein CHLNCDRAFT_35390            84.0    2e-25   Chlorella variabilis
emb|CCA20868.1|  conserved hypothetical protein                       77.8    3e-25   Albugo laibachii Nc14
ref|XP_002673591.1|  gamma carbonic dehydratase                       73.6    1e-24   Naegleria gruberi strain NEG-M
gb|KDD73982.1|  hypothetical protein H632_c1679p0                     95.1    2e-24   Helicosporidium sp. ATCC 50920
ref|XP_005766975.1|  gamma carbonic anhydrase                         86.3    3e-24   Emiliania huxleyi CCMP1516
ref|XP_009523979.1|  hypothetical protein PHYSODRAFT_285582           77.0    4e-24   Phytophthora sojae
ref|XP_001703237.1|  gamma carbonic anhydrase                         82.4    5e-24   Chlamydomonas reinhardtii
ref|XP_008890951.1|  hypothetical protein PPTG_01107                  76.6    6e-24   Phytophthora parasitica INRA-310
ref|XP_002908534.1|  conserved hypothetical protein                   76.3    6e-24   Phytophthora infestans T30-4
gb|KCW68231.1|  hypothetical protein EUGRSUZ_F01883                     104   8e-24   Eucalyptus grandis [rose gum]
gb|AAS48195.1|  mitochondrial NADH:ubiquinone oxidoreductase 27 k...  82.4    1e-23   Chlamydomonas reinhardtii
gb|AAU93943.1|  gamma-carbonic anhydrase                              70.1    2e-23   Helicosporidium sp. ex Simulium jonesi
gb|KJB43469.1|  hypothetical protein B456_007G201900                    101   4e-23   Gossypium raimondii
ref|XP_002948065.1|  hypothetical protein VOLCADRAFT_73531            80.1    6e-23   Volvox carteri f. nagariensis
dbj|BAF32946.1|  putative gamma-type carbonic anhydrase               86.7    8e-23   Pleurochrysis haptonemofera
gb|KHG18626.1|  Protein YrdA                                            100   1e-22   Gossypium arboreum [tree cotton]
ref|XP_005703463.1|  hypothetical protein Gasu_55130                  74.3    3e-22   Galdieria sulphuraria
gb|KDO84603.1|  hypothetical protein CISIN_1g0242241mg                98.2    8e-22   Citrus sinensis [apfelsine]
gb|ETI49161.1|  hypothetical protein F443_06919                       66.6    1e-21   Phytophthora parasitica P1569
ref|XP_005713311.1|  carbonic anhydrase, gamma type                   99.0    2e-21   Chondrus crispus [carageen]
ref|XP_008903478.1|  hypothetical protein PPTG_09984                  66.2    3e-21   Phytophthora parasitica INRA-310
ref|XP_002997211.1|  conserved hypothetical protein                   68.6    4e-21   Phytophthora infestans T30-4
ref|XP_009516211.1|  hypothetical protein PHYSODRAFT_537494           66.6    4e-21   Phytophthora sojae
emb|CCA17668.1|  conserved hypothetical protein                       63.2    1e-20   Albugo laibachii Nc14
ref|XP_008672301.1|  PREDICTED: uncharacterized protein LOC100217...  95.1    2e-20   Zea mays [maize]
dbj|GAM26691.1|  hypothetical protein SAMD00019534_098660             82.4    2e-20   Acytostelium subglobosum LB1
emb|CCI50078.1|  unnamed protein product                              64.3    3e-20   Albugo candida
ref|XP_008610617.1|  hypothetical protein SDRG_06605                  66.6    5e-20   Saprolegnia diclina VS20
ref|XP_004351419.1|  trimeric LpxA-like domain-containing protein     72.4    6e-20   Cavenderia fasciculata
gb|EWM27773.1|  Trimeric LpxA                                         70.1    2e-19   Nannochloropsis gaditana
ref|XP_636871.1|  trimeric LpxA-like domain-containing protein        77.4    2e-19   Dictyostelium discoideum AX4
ref|XP_008862851.1|  hypothetical protein H310_01513                  64.3    6e-19   Aphanomyces invadans
ref|XP_009149442.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...  90.5    8e-19   
gb|KIY95938.1|  transferase                                           63.5    9e-19   Monoraphidium neglectum
ref|XP_004333657.1|  GAMMA CA3 (GAMMA CARBONIC ANHYDRASE 3), puta...  73.9    1e-18   Acanthamoeba castellanii str. Neff
emb|CBN79571.1|  gamma carbonic anhydrase                             60.1    1e-18   Ectocarpus siliculosus
ref|XP_009821152.1|  hypothetical protein H257_00264                  64.3    1e-18   Aphanomyces astaci
gb|EFA76939.1|  trimeric LpxA-like domain-containing protein          63.2    3e-18   Heterostelium album PN500
emb|CBK21456.2|  unnamed protein product                              62.4    3e-18   Blastocystis hominis
ref|XP_009821153.1|  hypothetical protein, variant                    62.8    6e-18   Aphanomyces astaci
ref|XP_005790022.1|  gamma carbonic anhydrase                         86.7    9e-18   Emiliania huxleyi CCMP1516
ref|XP_004034789.1|  hypothetical protein IMG5_113400                 72.4    1e-17   Ichthyophthirius multifiliis
gb|EWM28838.1|  Trimeric LpxA                                         63.9    2e-17   Nannochloropsis gaditana
gb|KDD72217.1|  hypothetical protein H632_c3683p0                     68.6    3e-17   Helicosporidium sp. ATCC 50920
ref|XP_003289169.1|  hypothetical protein DICPUDRAFT_48414            70.5    7e-17   Dictyostelium purpureum
ref|XP_001696746.1|  gamma carbonic anhydrase                         85.9    8e-17   Chlamydomonas reinhardtii
ref|WP_015718917.1|  acetyltransferase                                75.9    9e-17   Geobacter sp. M18
ref|XP_005706870.1|  hypothetical protein Gasu_22590                  85.1    1e-16   Galdieria sulphuraria
gb|ACR17001.1|  gamma-type carbonic anhydratase-like protein          70.1    1e-16   Corynebacterium kroppenstedtii DSM 44385
ref|WP_012531949.1|  acetyltransferase                                76.3    1e-16   Geobacter bemidjiensis
ref|WP_041629030.1|  acetyltransferase                                70.1    1e-16   
ref|WP_039673101.1|  acetyltransferase                                70.9    2e-16   
ref|WP_041963596.1|  acetyltransferase                                70.9    2e-16   Sulfurospirillum cavolei
ref|WP_020593264.1|  hypothetical protein                             73.2    2e-16   Kiloniella laminariae
emb|CBN75766.1|  putative carbonic anhydrase                          70.1    3e-16   Ectocarpus siliculosus
ref|WP_021132357.1|  carbonic anhydrase/acetyltransferase             72.4    3e-16   Phaeospirillum fulvum
ref|WP_012663737.1|  acetyltransferase                                67.0    3e-16   Nautilia profundicola
ref|WP_011443735.1|  carbonic anhydrase                               69.3    3e-16   Novosphingobium
ref|WP_044828700.1|  carbonic anhydrase                               70.9    3e-16   Thalassospira sp. HJ
ref|WP_026842119.1|  transferase                                      76.3    3e-16   Geobacter bremensis
ref|WP_007091625.1|  MULTISPECIES: carbonic anhydrase                 70.9    3e-16   Thalassospira
ref|WP_043837486.1|  carbonic anhydrase                               66.6    3e-16   Roseomonas aerilata
ref|XP_976599.2|  hypothetical protein TTHERM_00541460                75.5    4e-16   Tetrahymena thermophila SB210
gb|KDO19703.1|  hypothetical protein SPRG_21390                       80.1    4e-16   Saprolegnia parasitica CBS 223.65
ref|WP_021802336.1|  hexapeptide repeat-containing transferase        67.4    4e-16   Clostridium intestinale
ref|WP_014804134.1|  acetyltransferase                                72.0    4e-16   Turneriella parva
ref|WP_033067257.1|  carbonic anhydrase                               70.5    4e-16   Thalassospira australica
ref|WP_015838795.1|  acetyltransferase                                75.5    5e-16   Geobacter sp. M21
gb|EKF07893.1|  carbonic anhydrase/acetyltransferase                  70.1    5e-16   
ref|WP_040823796.1|  carbonic anhydrase                               70.1    6e-16   
ref|WP_002727628.1|  carbonic anhydrase                               69.3    6e-16   
ref|WP_039333376.1|  carbonic anhydrase                               68.6    6e-16   
ref|WP_041958185.1|  acetyltransferase                                68.2    7e-16   
ref|WP_028791231.1|  carbonic anhydrase                               69.3    8e-16   
ref|WP_013275402.1|  hypothetical protein                             66.2    8e-16   
ref|WP_016830496.1|  acetyltransferase                                64.7    1e-15   
ref|WP_014318457.1|  acetyltransferase                                64.7    1e-15   
ref|WP_034842867.1|  carbonic anhydrase                               66.2    1e-15   
ref|WP_018023585.1|  hypothetical protein                             69.3    1e-15   
ref|WP_028262838.1|  hypothetical protein                             71.2    1e-15   
ref|WP_029665451.1|  MULTISPECIES: hypothetical protein               70.9    1e-15   
ref|WP_011480697.1|  hypothetical protein                             70.5    1e-15   
ref|WP_012991920.1|  acetyltransferase                                69.7    2e-15   
ref|WP_025251571.1|  acetyltransferase                                63.5    2e-15   
ref|WP_005510604.1|  MULTISPECIES: acetyltransferase                  68.6    2e-15   
ref|WP_038626077.1|  acetyltransferase                                68.6    2e-15   
ref|WP_037959567.1|  acetyltransferase                                67.8    2e-15   
ref|WP_034648674.1|  acetyltransferase                                63.2    2e-15   
ref|XP_005831500.1|  hypothetical protein GUITHDRAFT_152983           75.9    2e-15   
ref|WP_042083557.1|  carbonic anhydrase                               70.1    2e-15   
ref|WP_007473220.1|  acetyltransferase                                65.9    2e-15   
ref|WP_007547159.1|  acetyltransferase                                70.5    2e-15   
ref|WP_012459916.1|  acetyltransferase                                70.9    3e-15   
ref|WP_013779035.1|  hypothetical protein                             73.6    3e-15   
ref|WP_028096230.1|  carbonic anhydrase                               68.9    3e-15   
ref|XP_005787770.1|  hexapeptide repeat-containing transferas-lik...  71.2    3e-15   
ref|WP_014309021.1|  acetyltransferase                                63.2    3e-15   
ref|WP_014311158.1|  acetyltransferase                                63.2    3e-15   
ref|WP_014306267.1|  acetyltransferase                                63.2    3e-15   
ref|WP_016459211.1|  hypothetical protein                             62.0    3e-15   
ref|WP_014307766.1|  acetyltransferase                                63.2    3e-15   
gb|AEX45396.1|  putative siderophore binding protein                  61.6    3e-15   
ref|WP_014316148.1|  acetyltransferase                                63.2    3e-15   
ref|WP_003850064.1|  acetyltransferase                                63.2    4e-15   
ref|XP_005850061.1|  hypothetical protein CHLNCDRAFT_34352            70.5    4e-15   
ref|WP_011937143.1|  acetyltransferase                                72.0    4e-15   
ref|WP_004212025.1|  hypothetical protein                             63.5    4e-15   
ref|WP_038538794.1|  hypothetical protein                             67.8    5e-15   
ref|WP_012159569.1|  hypothetical protein                             66.6    5e-15   
ref|WP_028584954.1|  acetyltransferase                                71.6    6e-15   
ref|WP_005392829.1|  acetyltransferase                                62.0    6e-15   
ref|WP_005391090.1|  acetyltransferase                                61.6    7e-15   
ref|WP_008069326.1|  carbonic anhydrase                               66.2    7e-15   
ref|WP_031556442.1|  carbonic anhydrase                               65.5    8e-15   
ref|WP_017502329.1|  carbonic anhydrase                               63.9    8e-15   
ref|WP_014415395.1|  carbonic anhydrase                               70.5    9e-15   
emb|CCQ74394.1|  Conserved hypothetical protein yrdA                  66.6    9e-15   
ref|WP_044026281.1|  acetyltransferase                                61.6    9e-15   
ref|WP_014857207.1|  acetyltransferase                                66.2    9e-15   
ref|WP_007706893.1|  carbonic anhydrase                               63.5    1e-14   
ref|WP_029522898.1|  transferase                                      66.2    1e-14   
ref|WP_005007542.1|  putative Transferase, hexapeptide repeat pro...  65.1    1e-14   
ref|WP_012675364.1|  acetyltransferase                                66.2    1e-14   
ref|WP_027018926.1|  acetyltransferase                                71.2    1e-14   
ref|WP_029520498.1|  transferase                                      66.2    1e-14   
ref|WP_024774917.1|  acetyltransferase                                66.2    1e-14   
ref|WP_008289121.1|  acetyltransferase                                66.2    1e-14   
gb|EJK53176.1|  hypothetical protein THAOC_27443                      53.1    1e-14   
ref|WP_041148764.1|  acetyltransferase                                68.9    1e-14   
ref|WP_044823901.1|  acetyltransferase                                67.0    1e-14   
ref|WP_037507860.1|  carbonic anhydrase                               63.5    1e-14   
ref|WP_011390173.1|  carbonic anhydrase                               68.9    1e-14   
ref|WP_041391656.1|  carbonic anhydrase                               61.2    1e-14   
ref|WP_014799857.1|  acetyltransferase                                63.2    1e-14   
ref|WP_026873762.1|  carbonic anhydrase                               64.7    1e-14   
ref|WP_013240932.1|  acetyltransferase                                62.8    1e-14   
ref|WP_027011573.1|  acetyltransferase                                63.9    2e-14   
ref|WP_014317413.1|  acetyltransferase                                63.2    2e-14   
ref|WP_014301175.1|  acetyltransferase                                63.2    2e-14   
ref|WP_014366273.1|  acetyltransferase                                62.8    2e-14   
ref|WP_038012874.1|  carbonic anhydrase                               63.5    2e-14   
ref|WP_014474320.1|  acetyltransferase                                64.3    2e-14   
ref|WP_010934034.1|  acetyltransferase                                63.2    2e-14   
ref|WP_024787975.1|  MULTISPECIES: acetyltransferase                  64.7    2e-14   
ref|WP_039455831.1|  hypothetical protein                             65.9    2e-14   
ref|WP_027289020.1|  carbonic anhydrase                               66.2    2e-14   
ref|WP_024791961.1|  acetyltransferase                                64.7    2e-14   
ref|WP_010337969.1|  carbonic anhydrase                               62.8    2e-14   
ref|WP_014745465.1|  carbonic anhydrase                               71.2    2e-14   
ref|WP_024791458.1|  acetyltransferase                                64.7    2e-14   
gb|EET90107.1|  conserved hypothetical protein                        64.3    2e-14   
ref|WP_013638500.1|  acetyltransferase                                70.1    2e-14   
ref|WP_007438211.1|  carbonic anhydrase                               64.3    2e-14   
ref|WP_012674376.1|  acetyltransferase                                68.6    2e-14   
ref|WP_040084554.1|  acetyltransferase                                68.2    2e-14   
ref|WP_014835690.1|  acetyltransferase                                62.4    2e-14   
ref|WP_013910521.1|  acetyltransferase                                62.4    2e-14   
ref|WP_004505474.1|  transferase hexapeptide repeat protein           61.2    2e-14   
ref|WP_010239482.1|  carbonic anhydrase                               59.7    3e-14   
ref|WP_022726936.1|  carbonic anhydrase                               68.2    3e-14   
ref|WP_023839484.1|  carbonic anhydrase                               61.6    3e-14   
ref|WP_004786007.1|  acetyltransferase                                64.7    3e-14   
gb|ACC73927.1|  transferase hexapeptide repeat containing protein     60.1    3e-14   
ref|WP_024080899.1|  putative hexapeptide repeat acetyltransferase    66.6    3e-14   
ref|WP_010121198.1|  acetyltransferase                                63.2    3e-14   
ref|WP_034964099.1|  acetyltransferase                                69.3    3e-14   
ref|WP_018571149.1|  MULTISPECIES: anhydrase                          56.6    3e-14   
ref|WP_021224722.1|  carbonic anhydrase                               62.8    3e-14   
ref|WP_014102582.1|  carbonic anhydrase                               65.1    3e-14   
ref|WP_015590070.1|  Carbonic anhydrase/acetyltransferase, isoleu...  67.8    3e-14   
ref|WP_018128352.1|  hypothetical protein                             63.5    3e-14   
ref|WP_013299506.1|  carbonic anhydrase                               63.9    4e-14   
ref|WP_042620513.1|  acetyltransferase                                67.0    4e-14   
ref|WP_020403893.1|  hypothetical protein                             64.3    4e-14   
ref|WP_012063476.1|  hypothetical protein                             65.5    4e-14   
ref|WP_025345345.1|  acetyltransferase                                64.7    4e-14   
ref|WP_037466843.1|  carbonic anhydrase                               63.9    4e-14   
ref|WP_041765326.1|  anhydrase                                        60.1    4e-14   
ref|WP_026986265.1|  carbonic anhydrase                               67.8    4e-14   
ref|WP_011896476.1|  acetyltransferase                                60.1    4e-14   
ref|WP_012359352.1|  acetyltransferase                                65.5    4e-14   
ref|WP_042698554.1|  carbonic anhydrase                               65.1    4e-14   
gb|EMY68298.1|  transferase hexapeptide repeat protein                65.1    4e-14   
ref|WP_037456495.1|  carbonic anhydrase                               63.9    4e-14   
ref|WP_015381083.1|  gamma-type carbonic anhydratase-like protein     65.5    4e-14   
ref|WP_039927404.1|  acetyltransferase                                65.1    4e-14   
ref|WP_015681936.1|  transferase hexapeptide repeat protein           65.1    4e-14   
gb|KJF43448.1|  acetyltransferase                                     62.0    4e-14   
ref|WP_030058217.1|  MULTISPECIES: anhydrase                          64.3    4e-14   
ref|WP_006283845.1|  hypothetical protein                             59.7    4e-14   
ref|WP_003857208.1|  acetyltransferase                                59.7    4e-14   
ref|WP_038582038.1|  acetyltransferase                                59.7    5e-14   
ref|WP_006061560.1|  bacterial transferase hexapeptide repeat pro...  65.5    5e-14   
gb|KJF17737.1|  carnitine operon protein CaiE                         57.4    5e-14   
ref|WP_003863705.1|  acetyltransferase                                59.7    5e-14   
ref|WP_011631675.1|  carbonic anhydrase                               63.5    5e-14   
ref|WP_040095463.1|  hypothetical protein                             65.5    5e-14   
gb|EPE84828.1|  transferase hexapeptide repeat protein                62.8    5e-14   
ref|WP_024790101.1|  acetyltransferase                                65.1    5e-14   
ref|WP_016753520.1|  acetyltransferase                                62.0    5e-14   
ref|WP_013459351.1|  acetyltransferase                                72.8    5e-14   
ref|WP_023028565.1|  hypothetical protein                             63.2    5e-14   
ref|WP_011013406.1|  acetyltransferase                                59.7    5e-14   
ref|WP_043288165.1|  carbonic anhydrase                               63.2    5e-14   
ref|WP_004753596.1|  acetyltransferase                                62.0    5e-14   
ref|WP_007679964.1|  carbonic anhydrase                               63.9    5e-14   
ref|WP_019014984.1|  hypothetical protein                             65.1    6e-14   
gb|EMN00863.1|  transferase hexapeptide repeat protein                62.4    6e-14   
ref|WP_029551776.1|  hypothetical protein                             71.6    6e-14   
ref|WP_037898747.1|  anhydrase                                        64.3    6e-14   
ref|WP_038563256.1|  acetyltransferase                                62.4    6e-14   
ref|WP_005282027.1|  acetyltransferase                                63.5    6e-14   
ref|WP_004761571.1|  transferase hexapeptide repeat protein           62.0    6e-14   
ref|WP_041141369.1|  acetyltransferase                                71.6    6e-14   
gb|EMT20760.1|  hypothetical protein F775_43921                       73.6    6e-14   
ref|WP_015467349.1|  carbonic anhydrase, family 3                     64.3    6e-14   
ref|WP_027632952.1|  hypothetical protein                             64.7    6e-14   
ref|WP_042588115.1|  hypothetical protein                             57.4    6e-14   
ref|WP_038528172.1|  carbonic anhydrase                               64.3    6e-14   
ref|WP_035673275.1|  carbonic anhydrase                               64.3    6e-14   
ref|WP_020766837.1|  MULTISPECIES: transferase hexapeptide repeat...  62.4    6e-14   
ref|XP_002956125.1|  hypothetical protein VOLCADRAFT_83469            77.8    6e-14   
ref|WP_017670191.1|  hypothetical protein                             59.7    6e-14   
ref|WP_041811026.1|  carbonic anhydrase                               64.3    7e-14   
ref|WP_021343479.1|  anhydrase                                        67.8    7e-14   
ref|WP_014187883.1|  carbonic anhydrase                               64.7    7e-14   
ref|WP_010089609.1|  anhydrase                                        57.4    7e-14   
ref|WP_035291537.1|  hypothetical protein                             65.5    7e-14   
dbj|BAK64770.1|  conserved hypothetical protein                       60.8    7e-14   
ref|WP_002973111.1|  transferase hexapeptide repeat protein           64.3    7e-14   
ref|WP_024021755.1|  carbonic anhydrase                               62.8    7e-14   
ref|WP_009821934.1|  carbonic anhydrase                               63.2    7e-14   
ref|WP_028640743.1|  carbonic anhydrase                               61.6    7e-14   
ref|WP_038621291.1|  acetyltransferase                                62.4    8e-14   
ref|WP_012975468.1|  carbonic anhydrase                               63.2    8e-14   
ref|WP_005279967.1|  acetyltransferase                                62.8    9e-14   
gb|EJK68540.1|  hypothetical protein THAOC_10267                      53.9    9e-14   
ref|WP_012081704.1|  acetyltransferase                                71.2    9e-14   
ref|WP_017184183.1|  hypothetical protein                             61.2    9e-14   
emb|CCC97995.1|  conserved protein of unknown function                63.9    1e-13   
gb|EMO74775.1|  transferase hexapeptide repeat protein                62.0    1e-13   
ref|WP_019052663.1|  hypothetical protein                             61.2    1e-13   
ref|WP_012012958.1|  acetyltransferase                                65.9    1e-13   
gb|EMO43159.1|  transferase hexapeptide repeat protein                61.6    1e-13   
ref|WP_015261577.1|  acetyltransferase                                62.4    1e-13   
gb|EZQ08771.1|  carbonic anhydrase                                    63.9    1e-13   
ref|WP_013554977.1|  acetyltransferase                                69.7    1e-13   
ref|WP_007012635.1|  carbonic anhydrase                               62.0    1e-13   
ref|WP_023030881.1|  hypothetical protein                             62.4    1e-13   
gb|EKR74225.1|  transferase hexapeptide repeat protein                61.6    1e-13   
ref|WP_008993221.1|  carbonic anhydrase                               61.2    1e-13   
ref|WP_035867665.1|  anhydrase                                        65.1    1e-13   
ref|WP_039674598.1|  acetyltransferase                                62.0    1e-13   
ref|WP_010578283.1|  acetyltransferase                                60.8    1e-13   
ref|WP_014011079.1|  acetyltransferase                                66.2    1e-13   
ref|WP_013831491.1|  carbonic anhydrase                               62.0    1e-13   
ref|WP_041976300.1|  hypothetical protein                             63.5    1e-13   
ref|WP_040106621.1|  transferase                                      57.8    1e-13   
gb|EMI64653.1|  transferase hexapeptide repeat protein                61.6    1e-13   
ref|WP_029098917.1|  hypothetical protein                             62.0    1e-13   
ref|WP_006961722.1|  carbonic anhydrase, family 3                     60.5    1e-13   
ref|WP_020975364.1|  hypothetical protein                             65.1    1e-13   
ref|WP_013537141.1|  acetyltransferase                                66.2    1e-13   
ref|WP_009655637.1|  carbonic anhydrase                               63.9    1e-13   
ref|WP_002074145.1|  transferase hexapeptide repeat protein           61.2    1e-13   
ref|WP_004766655.1|  transferase hexapeptide repeat protein           60.8    1e-13   
ref|WP_003009958.1|  transferase hexapeptide repeat protein           62.0    1e-13   
ref|WP_044414922.1|  acetyltransferase                                66.2    1e-13   
ref|WP_013326385.1|  acetyltransferase                                65.9    1e-13   
ref|WP_033236431.1|  anhydrase                                        67.0    1e-13   
ref|WP_043363635.1|  carbonic anhydrase                               61.2    1e-13   
ref|WP_043974327.1|  carbonic anhydrase                               62.0    1e-13   
ref|WP_008102791.1|  carbonic anhydrase                               63.9    1e-13   
ref|WP_020968974.1|  MULTISPECIES: hypothetical protein               67.0    1e-13   
ref|WP_034327444.1|  acetyltransferase                                69.7    1e-13   
ref|WP_035297301.1|  hypothetical protein                             62.0    1e-13   
ref|WP_023026045.1|  MULTISPECIES: hypothetical protein               62.4    1e-13   
ref|WP_008286511.1|  acetyltransferase                                69.7    1e-13   
ref|WP_025898515.1|  carbonic anhydrase                               62.0    1e-13   
ref|WP_043334892.1|  carbonic anhydrase                               60.8    1e-13   
ref|XP_011402318.1|  Gamma carbonic anhydrase-like 1, mitochondrial   58.5    1e-13   
ref|WP_020980387.1|  transferase hexapeptide repeat protein           61.2    1e-13   
ref|WP_021318712.1|  carbonic anhydrase                               59.7    1e-13   
ref|WP_021689862.1|  hypothetical protein                             60.5    2e-13   
ref|WP_008907439.1|  hypothetical protein                             64.3    2e-13   
ref|WP_004455912.1|  transferase hexapeptide repeat protein           61.2    2e-13   
ref|WP_020848014.1|  gamma carbonic anhydrase                         65.9    2e-13   
ref|WP_036063898.1|  acetyltransferase                                61.2    2e-13   
gb|KGQ22520.1|  carbonic anhydrase                                    59.7    2e-13   



>emb|CDP01995.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   153 bits (387),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGSLGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI+GDVQVGR SSIW + C  R
Sbjct  61   VAPSASIVGDVQVGRSSSIW-YGCVLR  86


 Score =   118 bits (295),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIGTGTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGTGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009772840.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=268

 Score =   150 bits (378),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV VGR++SIW + C  R
Sbjct  61   VAPSASLIGDVHVGRNASIW-YGCVLR  86


 Score =   118 bits (295),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG GTNIQDNSLVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_008452092.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=271

 Score =   152 bits (383),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P ++++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVINKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIGDVQVGR SSIW
Sbjct  61   VAPSASIIGDVQVGRMSSIW  80


 Score =   115 bits (289),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTIE  140



>ref|XP_010263617.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   151 bits (382),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_006435021.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
 ref|XP_006473528.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR48261.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
Length=270

 Score =   153 bits (386),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   114 bits (286),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009588225.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=268

 Score =   150 bits (378),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDV VGR++SIW
Sbjct  61   VAPSASLIGDVHVGRNASIW  80


 Score =   117 bits (294),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG GTNIQDNSLVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_010061298.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW68229.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=273

 Score =   151 bits (382),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>emb|CDP07494.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   152 bits (385),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPLVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   114 bits (286),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+++G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSITVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_004146498.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN53299.1| hypothetical protein Csa_4G046620 [Cucumis sativus]
Length=271

 Score =   151 bits (382),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   115 bits (289),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTIE  140



>gb|KDP38522.1| hypothetical protein JCGZ_04447 [Jatropha curcas]
Length=272

 Score =   150 bits (379),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCR QGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRFQGNYYFQEQLSRHRTLMNIFDKAPVVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SS+W + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSVW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009391607.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   153 bits (387),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKVPNVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGQGSSIW-YGCVLR  86


 Score =   113 bits (282),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNLTGKVLPTIIG+NVTVGH+A LHGCTVE
Sbjct  81   YGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLTGKVLPTIIGDNVTVGHNAVLHGCTVE  140



>ref|XP_004233530.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Solanum 
lycopersicum]
Length=268

 Score =   150 bits (379),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKTPTVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV VGR++SIW + C  R
Sbjct  61   VAPSASLIGDVHVGRNASIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_010265678.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   150 bits (378),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDTF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>gb|KJB17752.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=271

 Score =   149 bits (377),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPFVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVE  140



>gb|KJB43468.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
 gb|KJB43470.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=271

 Score =   149 bits (376),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A +TVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIHTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVGR SSIW
Sbjct  61   VAPSASVIGDVQVGRSSSIW  80


 Score =   116 bits (290),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVE  140



>ref|XP_006878532.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
 gb|ERM94677.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
Length=273

 Score =   148 bits (374),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPHVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV+VG  SSIW + C  R
Sbjct  61   VAPSASVIGDVKVGHGSSIW-YGCVLR  86


 Score =   117 bits (292),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+GTGTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGTGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>gb|KJB12032.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=273

 Score =   150 bits (379),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGSLG+A YTVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++AF
Sbjct  1    MGSLGKAIYTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKSPLVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVE  140



>ref|XP_002510412.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52599.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   149 bits (376),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y++GFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSIGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR +SIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGASIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDN+LVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNTLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_006346962.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Solanum tuberosum]
 ref|XP_006346963.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Solanum tuberosum]
 ref|XP_006346964.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X3 [Solanum tuberosum]
Length=268

 Score =   149 bits (375),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV VGR++SIW + C  R
Sbjct  61   VAPSASLIGDVHVGRNASIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_010102071.1| hypothetical protein L484_009014 [Morus notabilis]
 gb|EXB91921.1| hypothetical protein L484_009014 [Morus notabilis]
Length=272

 Score =   150 bits (379),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   114 bits (286),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN +SIG GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNGISIGAGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_007046882.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOX91039.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=271

 Score =   148 bits (374),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V R+AF
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVE  140



>ref|XP_004160973.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
Length=271

 Score =   149 bits (377),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V  +AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDMDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIGDVQVGR SSIW
Sbjct  61   VAPSASIIGDVQVGRGSSIW  80


 Score =   115 bits (288),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTIE  140



>ref|XP_002282021.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Vitis vinifera]
 emb|CAN79636.1| hypothetical protein VITISV_014473 [Vitis vinifera]
 emb|CBI19719.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   148 bits (374),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQ+SRHR LMNLFDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFLEQISRHRTLMNLFDKAPIVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>gb|KHG00707.1| hypothetical protein F383_22748 [Gossypium arboreum]
Length=271

 Score =   150 bits (378),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDV+VGR SSIW
Sbjct  61   VAPSASVIGDVKVGRSSSIW  80


 Score =   114 bits (284),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+ KVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSRKVLPTIIGSNVTVGHSAVLHGCTVE  140



>gb|KHG23300.1| hypothetical protein F383_08437 [Gossypium arboreum]
Length=271

 Score =   149 bits (377),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQ LDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQTLDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVGR SSIW
Sbjct  61   VAPSASVIGDVQVGRGSSIW  80


 Score =   114 bits (286),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNNISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVE  140



>ref|XP_010113421.1| hypothetical protein L484_026755 [Morus notabilis]
 gb|EXC35448.1| hypothetical protein L484_026755 [Morus notabilis]
Length=271

 Score =   148 bits (374),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNY+F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYHFQEQLSRHRTLMNVFDKAPAVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   115 bits (289),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGH+A LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHAAVLHGCTVE  140



>ref|XP_006466826.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|KDO70974.1| hypothetical protein CISIN_1g024153mg [Citrus sinensis]
Length=271

 Score =   147 bits (371),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V+++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            +APSASIIGDVQVGR SSIW + C  R
Sbjct  61   LAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>gb|KDP38527.1| hypothetical protein JCGZ_04452 [Jatropha curcas]
Length=271

 Score =   150 bits (379),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V +EAF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   113 bits (282),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++SIG GTNIQDNSLVHVAKSNL+GKVLPT++G+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPTLVGDNVTVGHSAVLHGCTVE  140



>ref|NP_001275071.1| transcription factor APFI-like [Solanum tuberosum]
 gb|ABB86281.1| transcription factor APFI-like [Solanum tuberosum]
Length=268

 Score =   147 bits (372),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1    MGTLGKASYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV VGR++SIW + C  R
Sbjct  61   VAPSASLIGDVHVGRNASIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_009371625.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=268

 Score =   145 bits (367),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIG VQVGR SSIW + C  R
Sbjct  61   VAPSASIIGQVQVGRGSSIW-YGCVLR  86


 Score =   117 bits (294),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NSVSIG+GTNIQDNSLVHVAKSNLTGKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDANSVSIGSGTNIQDNSLVHVAKSNLTGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_006425642.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
 gb|ESR38882.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
Length=271

 Score =   147 bits (370),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            +APSASIIGDVQVGR SSIW + C  R
Sbjct  61   LAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_008338081.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   145 bits (367),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIG VQVGR SSIW
Sbjct  61   VAPSASIIGQVQVGRGSSIW  80


 Score =   117 bits (293),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNLTGKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLTGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_008338249.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   145 bits (367),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIG VQVGR SSIW + C  R
Sbjct  61   VAPSASIIGQVQVGRGSSIW-YGCVLR  86


 Score =   117 bits (293),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_008786862.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   147 bits (372),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK+P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKLPKVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGGGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +GTGTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_010922032.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=272

 Score =   149 bits (376),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR  MN++DKVP+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTFMNIYDKVPNVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   113 bits (283),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009340721.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=268

 Score =   145 bits (366),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIG VQVGR SSIW + C  R
Sbjct  61   VAPSASIIGQVQVGRGSSIW-YGCVLR  86


 Score =   117 bits (293),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_008444737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=273

 Score =   147 bits (370),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA +HGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVIHGCTVE  140



>gb|KJB12033.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=194

 Score =   149 bits (375),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGSLG+A YTVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++AF
Sbjct  1    MGSLGKAIYTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKSPLVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVGR SSIW
Sbjct  61   VAPSASVIGDVQVGRGSSIW  80


 Score =   113 bits (282),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVE  140



>ref|XP_002510411.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52598.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   146 bits (369),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLGCR QG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGCRFQGSYYFQEQLSRHRTLMNIFDKAPMVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVG+ +SIW + C  R
Sbjct  61   VAPSASIIGDVQVGKGASIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G GTNIQDNSLVHVAKSNL+GKV+PTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVIPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_011074556.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   147 bits (370),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGSLGRA YT+G W+RETGQA+DRLGCRLQGNYYF EQLSRHR LMNLFDK P V R+AF
Sbjct  1    MGSLGRAVYTLGLWVRETGQAMDRLGCRLQGNYYFQEQLSRHRTLMNLFDKSPVVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ SSIW + C  R
Sbjct  61   VAPSASLIGDVQVGQGSSIW-YGCVLR  86


 Score =   114 bits (286),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA +HGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVIHGCTIE  140



>ref|XP_002302024.1| transcription factor APFI family protein [Populus trichocarpa]
 ref|XP_011028863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Populus 
euphratica]
 gb|ABK95146.1| unknown [Populus trichocarpa]
 gb|EEE81297.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   146 bits (369),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGKGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVVHGCTVE  140



>ref|XP_008788543.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   149 bits (376),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPIVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGQGSSIW-YGCVLR  86


 Score =   112 bits (280),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN + +G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNRIRVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_011007461.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   144 bits (364),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDV VGR SSIW + C  R
Sbjct  61   VAPGASVIGDVLVGRGSSIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_004152688.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004167040.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN62616.1| hypothetical protein Csa_2G361800 [Cucumis sativus]
Length=273

 Score =   146 bits (368),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA +HGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVIHGCTVE  140



>ref|XP_002306878.1| transcription factor APFI family protein [Populus trichocarpa]
 gb|EEE93874.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   144 bits (364),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDV VGR SSIW + C  R
Sbjct  61   VAPGASVIGDVLVGRGSSIW-YGCVLR  86


 Score =   116 bits (290),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_008241708.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=271

 Score =   144 bits (363),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI+G VQVGR SSIW + C  R
Sbjct  61   VAPSASIVGQVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVE  140



>ref|XP_006386210.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
 gb|ERP64007.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
Length=285

 Score =   145 bits (367),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  15   MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  74

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVG+ SSIW
Sbjct  75   VAPSASVIGDVQVGKGSSIW  94


 Score =   115 bits (288),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  95   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVVHGCTVE  154



>ref|XP_010931534.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=325

 Score =   148 bits (373),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  54   MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPQVDKDAF  113

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVG  SSIW
Sbjct  114  VAPSASVIGDVQVGGGSSIW  133


 Score =   112 bits (281),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +G+GTN+QDNSLVHVAKSN++GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  134  YGCVLRGDVNSIRVGSGTNVQDNSLVHVAKSNISGKVLPTIIGDNVTVGHSAVLHGCTVE  193



>ref|XP_009799511.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=271

 Score =   151 bits (382),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASI+GDV +GR +SIW
Sbjct  61   VAPSASIVGDVHIGRSASIW  80


 Score =   109 bits (272),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VSIG GTN+QDNSL+HVAKSN++G+VLPT IG NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPTTIGKNVTIGHSAVLHGCTVE  140



>ref|XP_007204711.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05910.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=271

 Score =   144 bits (362),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI+G VQVGR SSIW + C  R
Sbjct  61   VAPSASIVGQVQVGRGSSIW-YGCVLR  86


 Score =   116 bits (291),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009799510.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=284

 Score =   151 bits (382),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI+GDV +GR +SIW + C  R
Sbjct  61   VAPSASIVGDVHIGRSASIW-YGCVLR  86


 Score =   109 bits (272),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VSIG GTN+QDNSL+HVAKSN++G+VLPT IG NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPTTIGKNVTIGHSAVLHGCTVE  140



>ref|XP_011083204.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=265

 Score =   146 bits (368),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGS GRAFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGSFGRAFYTVGFWIRETGQALDRLGSRLQGNYFFQEQLSRHRTLMNVFDKVPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI+GDV VGR SSIW + C  R
Sbjct  61   VAPSASIVGDVHVGRGSSIW-YGCVLR  86


 Score =   114 bits (284),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLP +IG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPILIGDNVTVGHSAVLHGCTVE  140



>dbj|BAB39954.1| OSJNBa0004B13.8 [Oryza sativa Japonica Group]
Length=257

 Score =   150 bits (380),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGD+QVG+ +SIW
Sbjct  61   VAPSASLIGDIQVGQGASIW  80


 Score =   109 bits (273),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_006383176.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
 gb|ERP60973.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
Length=271

 Score =   145 bits (366),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASI G+V VGR SSIW
Sbjct  61   VAPSASITGNVHVGRSSSIW  80


 Score =   115 bits (287),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NV+VGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVSVGHSAVLHGCTVE  140



>ref|NP_001042763.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAD82610.1| putative gamma-carbonic anhydrase [Oryza sativa Japonica Group]
 dbj|BAF04677.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAG96503.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87611.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92644.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00769.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54348.1| hypothetical protein OsJ_01333 [Oryza sativa Japonica Group]
Length=263

 Score =   151 bits (381),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGD+QVG+ +SIW
Sbjct  61   VAPSASLIGDIQVGQGASIW  80


 Score =   108 bits (271),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  140



>gb|EEC70424.1| hypothetical protein OsI_01428 [Oryza sativa Indica Group]
Length=263

 Score =   151 bits (381),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGD+QVG+ +SIW
Sbjct  61   VAPSASLIGDIQVGQGASIW  80


 Score =   108 bits (271),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_010550419.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Tarenaya 
hassleriana]
Length=265

 Score =   147 bits (370),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+AFY VGFWIRETGQALDRLGCRLQGNYYF E+LSRHR LMN+FDK PSV ++AF
Sbjct  1    MGTLGKAFYNVGFWIRETGQALDRLGCRLQGNYYFREELSRHRTLMNVFDKAPSVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV+VG  SSIW + C  R
Sbjct  61   VAPSASVIGDVRVGHGSSIW-YGCVLR  86


 Score =   112 bits (281),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDNSLVHVAKSNLTGKVLPTIIG+NVT+GH A LHGCT+E
Sbjct  81   YGCVLRGDANSISVGAGTNIQDNSLVHVAKSNLTGKVLPTIIGDNVTIGHGAVLHGCTIE  140



>ref|XP_004287879.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   144 bits (363),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYFFKEQLSRHRTLMNVFDKAPEVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIG VQVGR SSIW + C  R
Sbjct  61   VAPSASIIGQVQVGRGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNL GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLDGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_011011740.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011741.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011742.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   144 bits (363),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFKEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASI G+V VGR SSIW
Sbjct  61   VAPSASITGNVHVGRGSSIW  80


 Score =   115 bits (287),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNSVS+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NV+VGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSVSVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVSVGHSAVLHGCTVE  140



>ref|XP_010029770.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW56730.1| hypothetical protein EUGRSUZ_I02417 [Eucalyptus grandis]
Length=271

 Score =   144 bits (362),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQG+YYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGSYYFQEQLSRHRTLMNVFDKAPVIDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGD+Q+GR SSIW + C  R
Sbjct  61   VAPSASIIGDIQIGRGSSIW-YGCVLR  86


 Score =   115 bits (287),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++SIG GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>gb|KFK44104.1| hypothetical protein AALP_AA1G216400 [Arabis alpina]
Length=275

 Score =   145 bits (367),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P VH+EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKSPIVHKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+GR SSIW
Sbjct  61   VAPSASVIGDVQIGRGSSIW  80


 Score =   113 bits (283),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+V++G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVTVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_004232424.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Solanum 
lycopersicum]
Length=270

 Score =   144 bits (364),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDV +GR +SIW + C  R
Sbjct  61   VAPSASIIGDVHIGRSASIW-YGCVLR  86


 Score =   114 bits (284),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++GKVLPTIIG NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPTIIGKNVTIGHSAVLHGCTVE  140



>ref|XP_006644073.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Oryza 
brachyantha]
Length=263

 Score =   149 bits (377),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNY+FHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGQGASIW-YGCVLR  86


 Score =   108 bits (271),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_006340643.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Solanum tuberosum]
Length=270

 Score =   144 bits (364),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDV +GR +SIW + C  R
Sbjct  61   VAPSASIIGDVHIGRSASIW-YGCVLR  86


 Score =   114 bits (284),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++GKVLPTIIG NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPTIIGKNVTIGHSAVLHGCTVE  140



>ref|XP_010679759.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=255

 Score =   144 bits (363),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFW+RE+GQALDRLGCRLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWVRESGQALDRLGCRLQGNYFFQEQLSRHRTLMNVFDKKPMVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIGDV++G  SSIW
Sbjct  61   VAPSASIIGDVRIGHRSSIW  80


 Score =   114 bits (284),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGC+LRGDVN +SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCILRGDVNFISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009399949.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   144 bits (362),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y VG WIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYAVGCWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV VG+ SSIW + C  R
Sbjct  61   VAPSASVIGDVHVGQGSSIW-YGCVLR  86


 Score =   114 bits (285),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSIHIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_007017577.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOY14802.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=273

 Score =   145 bits (365),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFWIRETGQALDRLGCRLQG+Y F EQ+SRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAVYTVGFWIRETGQALDRLGCRLQGSYLFQEQISRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVGR SSIW
Sbjct  61   VAPSASVIGDVQVGRGSSIW  80


 Score =   113 bits (282),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGSVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_008810436.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   149 bits (375),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y VGFWIRETGQA+DRLGCR QGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYAVGFWIRETGQAIDRLGCRFQGNYYFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDVQVG+ SSIW + C  R
Sbjct  61   VAPSASVMGDVQVGQGSSIW-YGCVLR  86


 Score =   108 bits (271),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ IG+GTNIQDNSLVHVAKSN++G+VL TIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSIRIGSGTNIQDNSLVHVAKSNVSGRVLRTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_007204710.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05909.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=190

 Score =   142 bits (359),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASI+G VQVGR SSIW
Sbjct  61   VAPSASIVGQVQVGRGSSIW  80


 Score =   114 bits (286),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVE  140



>ref|XP_010538097.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=277

 Score =   147 bits (372),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGSLGRA YTVGFWIRETGQALDRLGCRLQGN+YF EQLSRHR LMN+FDK PSV ++AF
Sbjct  1    MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNHYFREQLSRHRTLMNVFDKAPSVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+G  SSIW
Sbjct  61   VAPSASVIGDVQIGGGSSIW  80


 Score =   109 bits (272),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN +S+G+ TNIQDNSLVHVAKSN++GKVLPTIIG+NVT+GHSA LHGCT+E
Sbjct  81   YGCVLRGDVNGISVGSWTNIQDNSLVHVAKSNISGKVLPTIIGDNVTIGHSAVLHGCTIE  140



>ref|XP_009590737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=271

 Score =   149 bits (376),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI+GDV +GR +SIW + C  R
Sbjct  61   VAPSASIVGDVHIGRSASIW-YGCVLR  86


 Score =   107 bits (268),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNSV IG GTN+QDNSL+HVAKSN++G+VLPT IG NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSVIIGAGTNVQDNSLIHVAKSNVSGRVLPTTIGKNVTIGHSAVLHGCTVE  140



>ref|XP_003537599.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
 gb|KHN41952.1| Hypothetical protein glysoja_003692 [Glycine soja]
Length=270

 Score =   144 bits (362),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDV VG  SSIW + C  R
Sbjct  61   VAPSASLLGDVHVGPASSIW-YGCVLR  86


 Score =   113 bits (282),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>gb|ACU19296.1| unknown [Glycine max]
Length=270

 Score =   144 bits (362),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDV VG  SSIW + C  R
Sbjct  61   VAPSASLLGDVHVGPASSIW-YGCVLR  86


 Score =   112 bits (281),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>gb|AFK45344.1| unknown [Medicago truncatula]
 gb|KEH40168.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   141 bits (356),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y+VGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYSVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            +APSAS+IGDV +GR SSIW + C  R
Sbjct  61   IAPSASVIGDVHIGRGSSIW-YGCVMR  86


 Score =   114 bits (286),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCV+RGDVN++S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVMRGDVNNISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009386943.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   147 bits (371),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH+ AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDVQVG+ SSIW + C  R
Sbjct  61   VAPGASVIGDVQVGQGSSIW-YGCVLR  86


 Score =   108 bits (270),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +G+ TNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHS  LHGCTVE
Sbjct  81   YGCVLRGDVNSIHVGSSTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSVVLHGCTVE  140



>ref|NP_564091.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|Q9FWR5.1|GCA1_ARATH RecName: Full=Gamma carbonic anhydrase 1, mitochondrial; Short=AtCA1; 
Short=GAMMA CA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF98404.1|AC024609_5 Unknown protein [Arabidopsis thaliana]
 dbj|BAD44650.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01128.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29870.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=275

 Score =   144 bits (363),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV +GR SSIW + C  R
Sbjct  61   VAPSASVIGDVHIGRGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>dbj|BAD43151.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   144 bits (362),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV +GR SSIW + C  R
Sbjct  61   VAPSASVIGDVHIGRGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_003517218.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
Length=270

 Score =   142 bits (358),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDV VG  SSIW + C  R
Sbjct  61   VAPSASLLGDVHVGPASSIW-YGCVLR  86


 Score =   113 bits (282),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>gb|ACU23675.1| unknown [Glycine max]
Length=270

 Score =   142 bits (358),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDV VG  SSIW + C  R
Sbjct  61   VAPSASLLGDVHVGPASSIW-YGCVLR  86


 Score =   113 bits (282),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_004291863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   143 bits (361),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGKGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ IG GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVIGAGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVVHGCTVE  140



>gb|KHN36089.1| Hypothetical protein glysoja_003212 [Glycine soja]
Length=270

 Score =   142 bits (358),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDV VG  SSIW + C  R
Sbjct  61   VAPSASLLGDVHVGPASSIW-YGCVLR  86


 Score =   113 bits (282),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_006305516.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38414.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=275

 Score =   144 bits (364),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKTAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGRGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>gb|EPS71345.1| hypothetical protein M569_03414 [Genlisea aurea]
Length=249

 Score =   144 bits (363),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M SLG+AFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMNLFDKVP VH++AF
Sbjct  1    MASLGKAFYTVGFWIRETGQALDRLGSRLQGNYHFQEQLSRHRTLMNLFDKVPVVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASI GDV +G  SSIW + C  R
Sbjct  61   VAPSASITGDVHIGGGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD   V IGTGTNIQDNSLVHVAKSNLTGKVLPT+IGNNVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDAKHVGIGTGTNIQDNSLVHVAKSNLTGKVLPTVIGNNVTVGHSAVLQGCTVE  140



>ref|XP_007136608.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 ref|XP_007136613.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
 gb|ESW08602.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08607.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
Length=179

 Score =   141 bits (355),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   113 bits (283),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVE  140



>ref|XP_009110271.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Brassica 
rapa]
Length=269

 Score =   142 bits (357),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IG+VQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGNVQIGRGSSIW-YGCVLR  86


 Score =   112 bits (280),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPTIIGDNVTIGHSAVLHGCTVE  140



>gb|AAM61583.1| unknown [Arabidopsis thaliana]
Length=275

 Score =   142 bits (359),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV +GR SSIW + C  R
Sbjct  61   VAPSASVIGDVHIGRGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_010477178.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
 ref|XP_010477179.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   144 bits (362),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGRGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NSVS+G+GTNIQDNSL+HVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDANSVSVGSGTNIQDNSLLHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>emb|CDX96658.1| BnaA08g22010D [Brassica napus]
Length=269

 Score =   142 bits (357),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IG+VQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGNVQIGRGSSIW-YGCVLR  86


 Score =   112 bits (280),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_010484635.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   140 bits (352),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKKAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+ASI GDV VGR SSIW
Sbjct  61   VAPNASITGDVHVGRGSSIW  80


 Score =   114 bits (285),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_010498381.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   144 bits (362),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKTPIVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGRGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_010459631.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010459632.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Camelina sativa]
Length=269

 Score =   144 bits (362),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGRGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>gb|KCW68228.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=269

 Score =   151 bits (382),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   102 bits (254),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 4/60 (7%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTV     LHGCTVE
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTV----VLHGCTVE  136



>ref|XP_010679758.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=272

 Score =   143 bits (361),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNVFDKKPLIDKQTF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G  SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGCGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++SIG+GTNIQDNSLVHVAK+N+ GKVLPTIIG+NVTVGHSA LHGCTV+
Sbjct  81   YGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNVAGKVLPTIIGDNVTVGHSAILHGCTVD  140



>ref|XP_009365039.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   140 bits (354),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   112 bits (281),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNLTGKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>ref|NP_001185039.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AEE29871.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=220

 Score =   143 bits (360),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV +GR SSIW + C  R
Sbjct  61   VAPSASVIGDVHIGRGSSIW-YGCVLR  86


 Score =   110 bits (276),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_009336133.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   140 bits (354),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   112 bits (281),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNLTGKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>ref|XP_004512067.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cicer 
arietinum]
Length=269

 Score =   143 bits (360),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+AFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+F+K P VH++AF
Sbjct  1    MGTLGKAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVFNKTPYVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            +APSASI GDVQ+G+ SSIW + C  R
Sbjct  61   IAPSASITGDVQIGQSSSIW-YGCVLR  86


 Score =   110 bits (276),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS++IG+ TNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNSITIGSSTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_004967660.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Setaria 
italica]
Length=263

 Score =   145 bits (367),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKTPHVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGPGASIW-YGCVLR  86


 Score =   107 bits (268),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PTIIG NVTVGHSA L GCT+E
Sbjct  81   YGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGENVTVGHSAVLQGCTIE  140



>ref|XP_003612060.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95018.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=270

 Score =   145 bits (365),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1    MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            +APSASI GDVQ+G  SSIW + C  R
Sbjct  61   IAPSASITGDVQIGHASSIW-YGCVLR  86


 Score =   108 bits (270),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+++IG+ TNIQDNSLVHVAKSNL+G+VLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_006393845.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
 gb|ABB45859.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31131.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
Length=258

 Score =   140 bits (354),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AF
Sbjct  1    MGTMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASI GDV VGR SSIW
Sbjct  61   VAPSASITGDVHVGRGSSIW  80


 Score =   112 bits (280),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+++G GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDANSITVGAGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTIGHSAVLHGCTVE  140



>ref|XP_010444788.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Camelina 
sativa]
Length=258

 Score =   138 bits (348),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+ASI GDV VGR SSIW
Sbjct  61   VAPNASITGDVHVGRGSSIW  80


 Score =   114 bits (285),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_006416491.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
 gb|ESQ34844.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
Length=221

 Score =   141 bits (356),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+GR SSIW
Sbjct  61   VAPSASVIGDVQIGRGSSIW  80


 Score =   110 bits (276),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V++G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVT+GHSA LHGCTV 
Sbjct  81   YGCVLRGDANTVTVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVR  140



>ref|XP_007222873.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
 gb|EMJ24072.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
Length=272

 Score =   140 bits (354),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>ref|XP_008220827.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=272

 Score =   140 bits (354),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>ref|XP_008655471.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Zea 
mays]
 gb|AFW79496.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=263

 Score =   143 bits (360),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VHR+AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG+ +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGQGASIW-YGCVLR  86


 Score =   108 bits (271),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PTIIGNNVT+GHSA L GCTVE
Sbjct  81   YGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVE  140



>ref|XP_007156970.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
 gb|ESW28964.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
Length=270

 Score =   142 bits (357),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVH++AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKGPSVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDV VG  SSIW + C  R
Sbjct  61   VAPSASLLGDVHVGPASSIW-YGCVLR  86


 Score =   109 bits (273),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN + IG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNGIVIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVE  140



>ref|XP_008364986.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Malus 
domestica]
Length=272

 Score =   140 bits (354),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   110 bits (276),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLNGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>ref|XP_002455477.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
 gb|EES00597.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
Length=263

 Score =   141 bits (355),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGPGASIW-YGCVLR  86


 Score =   109 bits (273),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PTIIGNNVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGNNVTVGHSAVLQGCTVE  140



>ref|XP_009365536.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=272

 Score =   140 bits (354),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVGR SSIW + C  R
Sbjct  61   VAPSASVIGDVQVGRGSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GK LPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKALPTIIGDNVTVGHSAVIHGCTVE  140



>emb|CDX83758.1| BnaC08g18870D [Brassica napus]
Length=269

 Score =   142 bits (358),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IG+VQ+GR SSIW + C  R
Sbjct  61   VAPSASVIGNVQIGRGSSIW-YGCVLR  86


 Score =   108 bits (270),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV  TIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPATIIGDNVTIGHSAVLHGCTVE  140



>ref|XP_003612061.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95019.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=201

 Score =   143 bits (361),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1    MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            +APSASI GDVQ+G  SSIW
Sbjct  61   IAPSASITGDVQIGHASSIW  80


 Score =   107 bits (267),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+++IG+ TNIQDNSLVHVAKSNL+G+VLPTIIG+NVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPTIIGDNVTVGHSAVLQGCTVE  140



>dbj|BAD44607.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   139 bits (349),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRAFY+VGFWI ETGQALDRLGCRLQG  YF EQLSRHR  MN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWILETGQALDRLGCRLQGKNYFREQLSRHRTQMNVFDKAPIVDKEAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDV +GR SSIW + C  R
Sbjct  61   VAPSASVIGDVHIGRGSSIW-YGCVLR  86


 Score =   111 bits (278),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  140



>emb|CDM82924.1| unnamed protein product [Triticum aestivum]
Length=262

 Score =   144 bits (362),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + +AFY VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IGDV+VG+ SSIW
Sbjct  61   SASLIGDVEVGQGSSIW  77


 Score =   106 bits (265),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGC+LRGD N+V +G+GTNIQDNS+VHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  78   YGCILRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  137



>gb|AFK48594.1| unknown [Lotus japonicus]
Length=273

 Score =   138 bits (348),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVG+ SSIW
Sbjct  61   VAPSASVIGDVQVGKGSSIW  80


 Score =   111 bits (278),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_003567426.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=260

 Score =   142 bits (357),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + +AFY VGFWIRETGQALDRLG RLQGNY+FHEQ+SRHR LMN+FDK P VHREAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGSRLQGNYFFHEQISRHRTLMNIFDKAPYVHREAFVAP  60

Query  345  SASIIGDVQVGRHSSIWVWMCSTR  416
            SAS+IGDVQVG+ SSIW + C  R
Sbjct  61   SASLIGDVQVGQGSSIW-YGCVLR  83


 Score =   108 bits (270),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V IG+GTNIQDNS+VHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  78   YGCVLRGDANNVQIGSGTNIQDNSVVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  137



>gb|EYU31197.1| hypothetical protein MIMGU_mgv1a012119mg [Erythranthe guttata]
Length=261

 Score =   137 bits (345),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            LGR+  TVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++ FVAP
Sbjct  3    LGRSICTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKAPFVQKDVFVAP  62

Query  345  SASIIGDVQVGRHSSIWVWMCSTR  416
            SASIIGDV VG +SSIW + C  R
Sbjct  63   SASIIGDVHVGSNSSIW-YGCVVR  85


 Score =   112 bits (280),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCV+RGDVN VSIG+GTNIQDNSLVHVAKSNL GKVLPT+IG+NVTVGHSA LHGCTVE
Sbjct  80   YGCVVRGDVNKVSIGSGTNIQDNSLVHVAKSNLYGKVLPTLIGDNVTVGHSAILHGCTVE  139



>ref|XP_010465384.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   139 bits (350),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+ASI GDV VGR SSIW
Sbjct  61   VAPNASITGDVHVGRGSSIW  80


 Score =   109 bits (273),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG+NVTVGHSA LH CTVE
Sbjct  81   YGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTVIGDNVTVGHSAVLHRCTVE  140



>ref|XP_008388037.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=272

 Score =   137 bits (346),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLS+HR LMN+F+K P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSQHRTLMNVFNKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSASIIGDVQVGR SSIW + C  R
Sbjct  61   VAPSASIIGDVQVGRGSSIW-YGCVLR  86


 Score =   110 bits (276),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++ +G GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNIVVGYGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>ref|XP_008672300.1| PREDICTED: uncharacterized protein LOC100217184 isoform X1 [Zea 
mays]
 gb|ACN28454.1| unknown [Zea mays]
 tpg|DAA54232.1| TPA: transcription factor APFI [Zea mays]
Length=262

 Score =   142 bits (357),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGSGASIW-YGCVLR  86


 Score =   105 bits (263),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVE  140



>ref|XP_003523810.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Glycine 
max]
 gb|KHN45863.1| Hypothetical protein glysoja_023086 [Glycine soja]
Length=276

 Score =   137 bits (345),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VG WIRETGQA+DRLG RLQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYSVGNWIRETGQAIDRLGSRLQGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+GR SSIW
Sbjct  61   VAPSASVIGDVQLGRGSSIW  80


 Score =   110 bits (274),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +G GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>gb|AFK46651.1| unknown [Lotus japonicus]
Length=273

 Score =   137 bits (345),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFILEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVG+ SSIW
Sbjct  61   VAPSASVIGDVQVGKGSSIW  80


 Score =   109 bits (273),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDV+S+ +G+GTNIQDNSLVHVAKSNL GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGTVLRGDVSSIRVGSGTNIQDNSLVHVAKSNLGGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|NP_569036.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 sp|Q94AU7.1|GCA3_ARATH RecName: Full=Gamma carbonic anhydrase 3, mitochondrial; Short=AtCA3; 
Short=GAMMA CA3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76458.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAL85116.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAM64929.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
 gb|AED98222.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=258

 Score =   135 bits (341),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+AS+ GDV VGR SSIW
Sbjct  61   VAPNASLSGDVHVGRGSSIW  80


 Score =   110 bits (276),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+GHSA LHGCTVE
Sbjct  81   YGCVLRGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVE  140



>dbj|BAK01732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   140 bits (352),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + +AFY VG WIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MTKAFYAVGLWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  345  SASIIGDVQVGRHSSIWVWMCSTR  416
            SAS+IGDV+VG  SSIW + C  R
Sbjct  61   SASLIGDVEVGPGSSIW-YGCVLR  83


 Score =   107 bits (266),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+V +G+GTNIQDNS+VHVAKSNL+GKV PTIIG+NVTVGHSA L GCTVE
Sbjct  78   YGCVLRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVE  137



>ref|NP_001137016.1| uncharacterized protein LOC100217184 [Zea mays]
 gb|ACF83081.1| unknown [Zea mays]
Length=222

 Score =   140 bits (354),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGSGASIW-YGCVLR  86


 Score =   105 bits (262),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVE  140



>tpg|DAA54233.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=222

 Score =   140 bits (353),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGSGASIW-YGCVLR  86


 Score =   105 bits (262),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTVGHSA L GCTVE
Sbjct  81   YGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVE  140



>gb|AFK40628.1| unknown [Lotus japonicus]
Length=193

 Score =   135 bits (341),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVG+ SSIW
Sbjct  61   VAPSASVIGDVQVGKGSSIW  80


 Score =   108 bits (271),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GKVLPTIIGNNVTVGHSA LHGCTVE
Sbjct  81   YGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPTIIGNNVTVGHSAVLHGCTVE  140



>ref|XP_010523601.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=276

 Score =   136 bits (342),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLG RLQG++Y  EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGYRLQGSHYLQEQLSRHRTLMNVFDKAPLVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ  R SSIW + C  R
Sbjct  61   VAPSASVIGDVQXXRASSIW-YGCVLR  86


 Score =   108 bits (270),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN +S+G+ TNIQDN+LVHVAKSN++GKVLPTIIG+NVTVGHSA +HGCT+E
Sbjct  81   YGCVLRGDVNGISVGSRTNIQDNALVHVAKSNISGKVLPTIIGDNVTVGHSAVIHGCTIE  140



>gb|ACG35255.1| transcription factor APFI [Zea mays]
Length=262

 Score =   141 bits (356),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQVG  +SIW + C  R
Sbjct  61   VAPSASLIGDVQVGSGASIW-YGCVLR  86


 Score =   102 bits (255),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTV HSA L GCTVE
Sbjct  81   YGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVCHSAVLQGCTVE  140



>gb|KFK28325.1| hypothetical protein AALP_AA8G501300 [Arabis alpina]
Length=257

 Score =   133 bits (335),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + +AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AFVAP
Sbjct  1    MAKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SASI GDV VGR SSIW
Sbjct  61   SASITGDVNVGRGSSIW  77


 Score =   110 bits (274),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GT+IQDN+L+HVAKSNL+GKVLPT+IG+NVT+GHSA LHGCTVE
Sbjct  78   YGCVLRGDANSISVGAGTSIQDNALIHVAKSNLSGKVLPTVIGDNVTIGHSAVLHGCTVE  137



>ref|XP_002890347.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66606.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score =   131 bits (329),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 75/111 (68%), Gaps = 25/111 (23%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  269
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1    MGTVGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKLLRNSSFHSDFEFVVSTAFT  60

Query  270  --LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
              +SRHR LMN+FDK P V +EAFVAPSAS+IGDVQ+GR SSIW + C  R
Sbjct  61   QLISRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVQIGRGSSIW-YGCVLR  110


 Score =   112 bits (280),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  105  YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  164



>gb|ACU22925.1| unknown [Glycine max]
Length=211

 Score =   134 bits (337),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VG WIRETGQA+DRLG RL G YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYSVGNWIRETGQAIDRLGSRLHGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+GR SSIW
Sbjct  61   VAPSASVIGDVQLGRGSSIW  80


 Score =   108 bits (271),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +G GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVE  140



>emb|CDY45234.1| BnaA07g12560D [Brassica napus]
Length=253

 Score =   131 bits (329),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IG+V VG  SSIW
Sbjct  63   SASLIGNVHVGPASSIW  79


 Score =   112 bits (279),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG+NVT+GHSA LHGCTVE
Sbjct  80   YGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIGDNVTIGHSAVLHGCTVE  139



>ref|XP_009103523.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Brassica 
rapa]
Length=253

 Score =   131 bits (329),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IG+V VG  SSIW
Sbjct  63   SASLIGNVHVGPASSIW  79


 Score =   112 bits (279),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG+NVT+GHSA LHGCTVE
Sbjct  80   YGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIGDNVTIGHSAVLHGCTVE  139



>gb|AAF79435.1|AC025808_17 F18O14.34 [Arabidopsis thaliana]
Length=298

 Score =   130 bits (326),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 74/110 (67%), Gaps = 24/110 (22%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  269
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKILRNSIFHSDFEFVKSEEFR  60

Query  270  -LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
             +SRHR LMN+FDK P V +EAFVAPSAS+IGDV +GR SSIW + C  R
Sbjct  61   LVSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSSIW-YGCVLR  109


 Score =   112 bits (279),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  104  YGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  163



>emb|CDY30772.1| BnaC07g16720D [Brassica napus]
Length=257

 Score =   131 bits (329),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKQAFVAP  62

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IG+V VG  SSIW
Sbjct  63   SASLIGNVHVGPASSIW  79


 Score =   110 bits (274),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG+NVT+GHSA LHGCTV+
Sbjct  80   YGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIGDNVTIGHSAVLHGCTVD  139



>ref|XP_002865062.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41321.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score =   138 bits (348),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP+ASI GDV VGR SSIW + C  R
Sbjct  61   VAPNASITGDVHVGRGSSIW-YGCVLR  86


 Score =   102 bits (254),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 11/71 (15%)
 Frame = +1

Query  397  YGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVG  543
            YGCVLR           GD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+G
Sbjct  81   YGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIG  140

Query  544  HSAALHGCTVE  576
            HSA LHGCTVE
Sbjct  141  HSAVLHGCTVE  151



>gb|ADQ43216.1| GAMMA CA3/carbonate dehydratase [Schrenkiella parvula]
Length=255

 Score =   139 bits (351),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQ SRHR LMN+FDK PSV +EAF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQ-SRHRTLMNVFDKAPSVDKEAF  59

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIGDV VGR SSIW
Sbjct  60   VAPSASIIGDVHVGRGSSIW  79


 Score =   100 bits (249),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 2/60 (3%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLR D NS+S+G GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVT+ HSA LHGCTVE
Sbjct  80   YGCVLR-DANSISVGAGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTI-HSAVLHGCTVE  137



>gb|AFK09615.1| gamma carbonic anhydrase 3 [Arabidopsis kamchatica]
 gb|AFK09617.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. halleri]
Length=269

 Score =   138 bits (348),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+ASI GDV VGR SSIW
Sbjct  61   VAPNASITGDVHVGRGSSIW  80


 Score =   101 bits (251),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 11/71 (15%)
 Frame = +1

Query  397  YGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVG  543
            YGCVLR           GD NS+++G GTNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+G
Sbjct  81   YGCVLRDIPVDLTTYSAGDANSITVGAGTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIG  140

Query  544  HSAALHGCTVE  576
            HSA LHGCTVE
Sbjct  141  HSAVLHGCTVE  151



>ref|NP_001241093.1| uncharacterized protein LOC100805278 [Glycine max]
 gb|ACU23511.1| unknown [Glycine max]
 gb|KHN22241.1| Hypothetical protein glysoja_021997 [Glycine soja]
Length=273

 Score =   126 bits (316),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VG WIR TGQA+DRLG  LQG YY  EQLSRHR LM++FDK P V  + F
Sbjct  1    MGTLGRAIYSVGNWIRGTGQAIDRLGSLLQGGYYVQEQLSRHRTLMDIFDKAPVVDEDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+GR SSIW
Sbjct  61   VAPSASVIGDVQLGRGSSIW  80


 Score =   113 bits (283),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +GTGTNIQDNSLVHVAKSNL+GKVLPTIIGNNVTVGHSA +HGCTVE
Sbjct  81   YGVVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVIHGCTVE  140



>ref|XP_011083663.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   133 bits (334),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MGSLGRA YT+G WIR TGQA+DR+GCRLQG+YYF EQLSRHR LM+L DK P V ++AF
Sbjct  1    MGSLGRAIYTLGNWIRVTGQAVDRVGCRLQGSYYFQEQLSRHRTLMDLLDKSPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            +AP AS+IGDVQVG+ SSIW
Sbjct  61   IAPGASVIGDVQVGQGSSIW  80


 Score =   106 bits (265),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GK LPTIIGNNVT+GHSA +HGCT+E
Sbjct  81   YGSVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLGGKELPTIIGNNVTIGHSAVIHGCTIE  140



>ref|XP_006393603.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
 gb|ESQ30889.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
Length=276

 Score =   128 bits (322),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G RLQG+ YF E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSRLQGSPYFQEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKRSSIW-YGCVLR  86


 Score =   110 bits (275),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL+GKV PTIIG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVQPTIIGDNVTVGHSAVIHGCTVE  140



>ref|NP_001078808.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 gb|AED98223.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=269

 Score =   136 bits (342),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+AS+ GDV VGR SSIW
Sbjct  61   VAPNASLSGDVHVGRGSSIW  80


 Score =   102 bits (254),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 11/71 (15%)
 Frame = +1

Query  397  YGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVG  543
            YGCVLR           GD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+G
Sbjct  81   YGCVLRDIPFDLMTDSAGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIG  140

Query  544  HSAALHGCTVE  576
            HSA LHGCTVE
Sbjct  141  HSAVLHGCTVE  151



>emb|CDY50984.1| BnaC02g48920D [Brassica napus]
Length=260

 Score =   132 bits (331),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M S+GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V +EA 
Sbjct  1    MASMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPIVDKEAL  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIG+V +G  SSIW
Sbjct  61   VAPSASIIGNVHLGPGSSIW  80


 Score =   105 bits (262),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N++++G GTNIQDNSLVHVAKSNL GKVLPT+IG+NVT+G+SA LHGCT+E
Sbjct  81   YGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPTLIGDNVTIGNSAVLHGCTLE  140



>gb|AFK09616.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. gemmifera]
Length=269

 Score =   136 bits (342),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLS HR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSTHRTLMNVFDKAPSVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+ASI GDV VGR SSIW
Sbjct  61   VAPNASITGDVHVGRGSSIW  80


 Score = 98.6 bits (244),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 11/71 (15%)
 Frame = +1

Query  397  YGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVG  543
            YGCVLR           GD NS+++G  TNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+G
Sbjct  81   YGCVLRDIPVDLTTYSAGDANSITVGARTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIG  140

Query  544  HSAALHGCTVE  576
            HSA LHGCTVE
Sbjct  141  HSAVLHGCTVE  151



>gb|AFK09618.1| gamma carbonic anhydrase 3 [Arabidopsis lyrata subsp. lyrata]
Length=268

 Score =   130 bits (328),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG++G+AFY VGFWIRETG+ALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGRALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+ASI GDV VGR  SIW
Sbjct  61   VAPNASITGDVHVGR-GSIW  79


 Score =   102 bits (253),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 11/71 (15%)
 Frame = +1

Query  397  YGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVG  543
            YGCVLR           GD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+G
Sbjct  80   YGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIG  139

Query  544  HSAALHGCTVE  576
            HSA LHGCTVE
Sbjct  140  HSAVLHGCTVE  150



>gb|ABK26184.1| unknown [Picea sitchensis]
Length=273

 Score =   128 bits (322),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+  Y  GF IRETGQA+DR GCRLQGN+ F EQLSRHR LMN+F+K PS+HR+ F
Sbjct  1    MGTLGKVIYMAGFLIRETGQAIDRFGCRLQGNHGFQEQLSRHRTLMNIFEKAPSLHRDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA+++GDV+VG+ SSIW
Sbjct  61   VAPSAAVMGDVKVGQGSSIW  80


 Score =   104 bits (259),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ +G+GTNIQDN+LVHVAK+N++GKVLPTIIGN VT+GH A LHGCTVE
Sbjct  81   YGSVLRGDVNSIMVGSGTNIQDNTLVHVAKTNISGKVLPTIIGNKVTIGHGAVLHGCTVE  140



>ref|XP_009612501.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=273

 Score =   118 bits (296),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGAIVRATGQALDRIGNRLQGSSYLEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDV VGR+SSIW + C  R
Sbjct  61   VAPGASVIGDVHVGRNSSIW-YGCVLR  86


 Score =   112 bits (280),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPTIIGNNVTVGHSA +HGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIE  140



>emb|CDY67628.1| BnaCnng55730D [Brassica napus]
Length=276

 Score =   121 bits (304),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   108 bits (270),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVLPTTIGDNVTVGHSAVIHGCTVE  140



>ref|XP_002894036.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70295.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score =   121 bits (303),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   108 bits (271),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT+IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVE  140



>ref|NP_175159.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|Q9C6B3.1|GCA2_ARATH RecName: Full=Gamma carbonic anhydrase 2, mitochondrial; Short=AtCA2; 
Short=GAMMA CA2; AltName: Full=Transcription factor 
APFI; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52641.1|AC079677_5 unknown protein; 6976-8939 [Arabidopsis thaliana]
 gb|AAK76653.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44984.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32144.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
Length=278

 Score =   121 bits (303),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   108 bits (271),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT+IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVE  140



>ref|XP_006304043.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
 gb|EOA36941.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
Length=306

 Score =   119 bits (297),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  29   MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  88

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDVQ+G+ SSIW + C  R
Sbjct  89   VAPGASVIGDVQIGKGSSIW-YGCVLR  114


 Score =   108 bits (271),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT+IG+NVTVGHSA +HGCTVE
Sbjct  109  YGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVE  168



>gb|AAK28403.1|AF249876_1 transcription factor APFI [Arabidopsis thaliana]
Length=278

 Score =   120 bits (302),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   106 bits (265),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDN+LVHVAK+ ++GKVLPT+IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNTLVHVAKTTISGKVLPTLIGDNVTVGHSAVIHGCTVE  140



>ref|XP_009771198.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Nicotiana 
sylvestris]
Length=273

 Score =   116 bits (290),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+ DK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGQALDRVGNRLQGSSYLEEHLSRHRTLMNILDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDV VGR+SSIW + C  R
Sbjct  61   VAPGASVIGDVHVGRNSSIW-YGCVLR  86


 Score =   111 bits (277),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+G+NIQDNSLVHVAKSN++ KVLPTIIGNNVTVGHSA +HGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGSNIQDNSLVHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIE  140



>ref|XP_010500247.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
 ref|XP_010479124.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
Length=278

 Score =   118 bits (295),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKSSSIW-YGCVLR  86


 Score =   108 bits (271),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT+IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVE  140



>ref|XP_010463232.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=195

 Score =   118 bits (296),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKSSSIW-YGCVLR  86


 Score =   108 bits (269),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT+IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVE  140



>ref|XP_004238283.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Solanum 
lycopersicum]
Length=273

 Score =   114 bits (285),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNVFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS+IGDV VGR+SSIW + C  R
Sbjct  61   VAPGASVIGDVHVGRNSSIW-YGCVLR  86


 Score =   112 bits (280),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPTIIGNNVTVGHSA +HGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIE  140



>ref|XP_009145039.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brassica 
rapa]
Length=276

 Score =   120 bits (301),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVLGDVQIGKGSSIW-YGCVLR  86


 Score =   105 bits (263),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKV PT IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPTTIGDNVTVGHSAVIHGCTVE  140



>emb|CDY55089.1| BnaA02g34770D [Brassica napus]
Length=258

 Score =   128 bits (321),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V ++AFVAP
Sbjct  1    MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPLVDKDAFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SASIIG+V +G  SSIW
Sbjct  61   SASIIGNVHLGPGSSIW  77


 Score = 98.2 bits (243),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N++++G GTNIQDNSLVHVAKSNL GKVLPT+IG+NVT+ +SA L GCT+E
Sbjct  78   YGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPTLIGDNVTIRNSALLLGCTLE  137



>ref|XP_006341958.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Solanum 
tuberosum]
Length=273

 Score =   113 bits (283),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP A++IGDV VGR+SSIW + C  R
Sbjct  61   VAPGATVIGDVHVGRNSSIW-YGCVLR  86


 Score =   112 bits (280),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPTIIGNNVTVGHSA +HGCT+E
Sbjct  81   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIE  140



>emb|CDY47592.1| BnaC08g04620D [Brassica napus]
Length=276

 Score =   115 bits (288),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWIRGSGQALDRVGSILQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   110 bits (274),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL+GKVLPT IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVLPTTIGDNVTVGHSAVIHGCTVE  140



>ref|NP_001066265.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|ABA95932.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29284.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|EAY82406.1| hypothetical protein OsI_37621 [Oryza sativa Indica Group]
 gb|EAZ19787.1| hypothetical protein OsJ_35366 [Oryza sativa Japonica Group]
 dbj|BAG96313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   119 bits (297),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P VH++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRVHKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   106 bits (265),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG+G+NIQDNSLVHVAK+N++GKVLPTIIGNNVT+GHSA LH CTVE
Sbjct  81   YGSILRGDVNSIHIGSGSNIQDNSLVHVAKANISGKVLPTIIGNNVTIGHSAVLHACTVE  140



>emb|CDY17034.1| BnaA08g03980D [Brassica napus]
Length=276

 Score =   115 bits (289),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWIRGSGQALDRVGSLLQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   109 bits (273),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPTTIGDNVTVGHSAVIHGCTVE  140



>gb|EYU45182.1| hypothetical protein MIMGU_mgv1a011728mg [Erythranthe guttata]
Length=272

 Score =   114 bits (285),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YT+G WIR TG+A+D++G  LQG+ Y  E LSRHR LM +FDK P V ++AF
Sbjct  1    MGTLGKAVYTLGNWIRGTGKAMDKVGSLLQGSSYIEEHLSRHRTLMEIFDKSPVVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            +AP AS+IGDVQVG+ +SIW
Sbjct  61   IAPGASVIGDVQVGQGASIW  80


 Score =   110 bits (275),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+SIG GTNIQDNSLVHVAKSNL+G VLPTIIGNNVTVGHSA +HGCT+E
Sbjct  81   YGSVLRGDVNSISIGYGTNIQDNSLVHVAKSNLSGNVLPTIIGNNVTVGHSAVIHGCTIE  140



>ref|XP_002463275.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
 gb|EER99796.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
Length=273

 Score =   117 bits (294),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPKIHRDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   105 bits (263),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG+GTNIQDNSLVHVAK+N +GKVLPTIIG+NVTVGHSA LH CT+E
Sbjct  81   YGSILRGDVNSIHIGSGTNIQDNSLVHVAKANFSGKVLPTIIGSNVTVGHSAVLHACTIE  140



>gb|KEH36170.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   115 bits (287),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDVQ+G+ SSIW
Sbjct  60   VAPSAAVIGDVQIGKGSSIW  79


 Score =   108 bits (270),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  80   YGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  139



>gb|ACJ85087.1| unknown [Medicago truncatula]
Length=226

 Score =   114 bits (286),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDVQ+G+ SSIW
Sbjct  60   VAPSAAVIGDVQIGKGSSIW  79


 Score =   108 bits (269),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  80   YGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  139



>ref|XP_006663861.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Oryza 
brachyantha]
Length=273

 Score =   118 bits (295),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   104 bits (259),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPTIIG+NVT+GHSA LH CT+E
Sbjct  81   YGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPTIIGSNVTIGHSAVLHACTIE  140



>emb|CDY23649.1| BnaA05g17800D [Brassica napus]
Length=277

 Score =   120 bits (302),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS++GDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVLGDVQIGKGSSIW-YGCVLR  86


 Score =   101 bits (251),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTV-GHSAALHGCTV  573
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKV PT IG+NVTV GHSA +HGCTV
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPTTIGDNVTVAGHSAVIHGCTV  140

Query  574  E  576
            E
Sbjct  141  E  141



>gb|KFK36155.1| hypothetical protein AALP_AA4G085200 [Arabis alpina]
Length=276

 Score =   117 bits (294),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  YTVG  IR TGQALDR+G  LQG + F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGKAIRVTGQALDRVGSTLQGGHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAPSAS+IGDVQ+G+ SSIW + C  R
Sbjct  61   VAPSASVIGDVQIGKGSSIW-YGCVLR  86


 Score =   103 bits (258),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++SIG+GTNIQDNSLVHVAK+NL+ K LPT IG+NVT+GHSA +H CTVE
Sbjct  81   YGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNLSNKSLPTTIGDNVTIGHSAVIHACTVE  140



>ref|NP_001169012.1| uncharacterized protein LOC100382844 [Zea mays]
 gb|ACN31405.1| unknown [Zea mays]
Length=273

 Score =   116 bits (291),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA +TVG WIR TGQA+DRLG  +QG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTIQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   104 bits (260),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPTIIG+NVTVGHSA LH CT+E
Sbjct  81   YGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIE  140



>gb|EAZ04886.1| hypothetical protein OsI_27068 [Oryza sativa Indica Group]
Length=273

 Score =   118 bits (296),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   102 bits (253),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG GTNIQDNSLVHV+K+N++GKVLPTIIGN VT+GHSA LH C VE
Sbjct  81   YGSILRGDVNSIHIGAGTNIQDNSLVHVSKANISGKVLPTIIGNRVTIGHSAVLHACIVE  140



>ref|XP_004958498.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Setaria 
italica]
Length=273

 Score =   117 bits (293),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   102 bits (254),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG+GTNIQDNSLVHV++SN++ KVLPTIIG+NVTVGHSA LH CT+E
Sbjct  81   YGSILRGDVNSIHIGSGTNIQDNSLVHVSRSNISRKVLPTIIGSNVTVGHSAVLHACTIE  140



>ref|XP_009107430.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 2, mitochondrial-like 
[Brassica rapa]
Length=276

 Score =   110 bits (274),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  YTVG WI  +GQALDR+G  L G++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWICGSGQALDRIGSLLXGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQ+G+ SSIW
Sbjct  61   VAPSASVIGDVQIGKGSSIW  80


 Score =   109 bits (272),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT IG+NVTVGHSA +HGCTVE
Sbjct  81   YGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPTTIGDNVTVGHSAVIHGCTVE  140



>gb|AFK41197.1| unknown [Medicago truncatula]
Length=272

 Score =   113 bits (283),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA Y+ G  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSAGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDVQ+G+ SSIW
Sbjct  60   VAPSAAVIGDVQIGKGSSIW  79


 Score =   106 bits (264),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+G VLPTIIG+NVTVGHSA LHGCTVE
Sbjct  80   YGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGMVLPTIIGDNVTVGHSAVLHGCTVE  139



>ref|XP_002968991.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
 ref|XP_002990654.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ08286.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ30107.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
Length=266

 Score =   123 bits (308),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +3

Query  168  GRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPS  347
            GRA Y +GFWIRETGQALDRLGCR+QGNY F EQL+RHR LMNL+DK P V    F+APS
Sbjct  3    GRALYQIGFWIRETGQALDRLGCRIQGNYIFREQLNRHRTLMNLYDKKPEVMENVFIAPS  62

Query  348  ASIIGDVQVGRHSSIW  395
            A++IGDV V   SSIW
Sbjct  63   ATLIGDVSVAGGSSIW  78


 Score = 95.9 bits (237),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVN + +G GTNIQDN+LVHVA++ ++GKV PTIIG+ VT+GH+A LH CTV+
Sbjct  79   YGCVLRGDVNEIRVGYGTNIQDNTLVHVARTGMSGKVAPTIIGDAVTIGHNAVLHACTVD  138



>ref|NP_001060439.1| Os07g0642900 [Oryza sativa Japonica Group]
 dbj|BAC16488.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAD30257.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAF22353.1| Os07g0642900 [Oryza sativa Japonica Group]
 gb|EAZ40840.1| hypothetical protein OsJ_25319 [Oryza sativa Japonica Group]
 dbj|BAG87352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   114 bits (285),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YT G WIR TGQA+DRLG  +QG     EQL RHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTAGKWIRGTGQAMDRLGSTIQGGLRVDEQLPRHRTIMNIFEKEPRIHKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGD+++G  SSIW
Sbjct  61   VAPSAAVIGDIEIGHGSSIW  80


 Score =   102 bits (253),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG GTNIQDNSLVHV+K+N++GKVLPTIIGN+VT+GHSA LH C VE
Sbjct  81   YGSILRGDVNSIHIGVGTNIQDNSLVHVSKANISGKVLPTIIGNSVTIGHSAVLHACIVE  140



>gb|EPS62312.1| hypothetical protein M569_12479, partial [Genlisea aurea]
Length=267

 Score =   108 bits (269),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+S+GTGTNIQDNSLVHVAKSN+ GK LPTIIGNNVTVGHSA +HGCT++
Sbjct  81   YGAVLRGDVNSISVGTGTNIQDNSLVHVAKSNIGGKELPTIIGNNVTVGHSAVIHGCTID  140


 Score =   105 bits (263),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A Y +G WIR  GQA+DRLG  +QG Y+  E +S+HR L+ L +K P V ++AF
Sbjct  1    MGTLGKAVYRLGSWIRVAGQAVDRLGSTVQGGYFVPETISKHRTLLALSEKTPIVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            +APS+S+IGDVQVG  SSIW
Sbjct  61   IAPSSSVIGDVQVGSGSSIW  80



>ref|XP_003562574.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brachypodium 
distachyon]
Length=275

 Score =   108 bits (271),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     E +SRHR +M +F+K P ++++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSAVQGGLRAEEHVSRHRTIMGIFEKEPRINKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSA++IGDV++G  SSIW
Sbjct  61   VAPSAAVIGDVEIGHGSSIW  80


 Score =   104 bits (259),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVN++ IG+G+NIQDNSLVHV+KSN++GKVLPTIIGN VTVGHSA LH CT+E
Sbjct  81   YGSILRGDVNTIQIGSGSNIQDNSLVHVSKSNISGKVLPTIIGNKVTVGHSAVLHACTIE  140



>ref|XP_001754319.1| predicted protein [Physcomitrella patens]
 gb|EDQ80769.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   129 bits (323),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            RA YTVGFWIRETGQALDR GCRLQGNY F E+LSRH+ L NLFDK P V  +AFVAPSA
Sbjct  4    RALYTVGFWIRETGQALDRAGCRLQGNYVFREELSRHKTLFNLFDKKPVVAEDAFVAPSA  63

Query  351  SIIGDVQVGRHSSIW  395
            S++GDVQVG  SSIW
Sbjct  64   SLVGDVQVGPKSSIW  78


 Score = 77.0 bits (188),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD + + +G+ TNIQD+SLV V  S   G   P +IGN VT+GHSA +H CTVE
Sbjct  79   YGCVLRGDASGIRVGSETNIQDHSLVSVGGSRFGGGHAPAVIGNRVTIGHSAVIHACTVE  138



>gb|KDO84602.1| hypothetical protein CISIN_1g0242242mg, partial [Citrus sinensis]
Length=86

 Score =   150 bits (378),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSASIIGDVQVGR SSIW
Sbjct  61   VAPSASIIGDVQVGRGSSIW  80



>gb|ACG33606.1| transcription factor APFI [Zea mays]
Length=250

 Score =   106 bits (264),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTVGHSA L GCTVE
Sbjct  69   YGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVE  128


 Score = 88.2 bits (217),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +3

Query  231  GCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCS  410
            G R  G Y+FHEQ+SRHR +MN+FDK P VH++AFVAPSAS+IGDVQVG  +SIW + C 
Sbjct  14   GRRGGGKYFFHEQISRHRTIMNIFDKTPHVHKDAFVAPSASLIGDVQVGSGASIW-YGCV  72

Query  411  TR  416
             R
Sbjct  73   LR  74



>gb|KJB17751.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=229

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LG+A YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPFVDRDAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAPSAS+IGDVQVGR SSIW
Sbjct  61   VAPSASVIGDVQVGRGSSIW  80



>ref|XP_001776500.1| predicted protein [Physcomitrella patens]
 gb|EDQ58633.1| predicted protein [Physcomitrella patens]
Length=268

 Score = 99.8 bits (247),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  +++G   R TGQALDRLG RLQG   F +++S+H+ ++++FDK P +   AF
Sbjct  1    MGTLGRVVFSLGKAARTTGQALDRLGSRLQGGNTFKDEVSKHQTVLSIFDKKPVIEESAF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP AS++G+V++G+ SS+W
Sbjct  61   VAPGASVVGEVEIGKQSSVW  80


 Score = 92.4 bits (228),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDV+ + +G+ TNIQDN++VHVAK+N++G V PT+IGN VT+GH++ LH CTVE
Sbjct  81   YGCVLRGDVHHIKVGSETNIQDNTVVHVAKTNVSGNVEPTVIGNRVTIGHNSVLHACTVE  140



>gb|KCW68230.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=241

 Score =   116 bits (290),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  49   YGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  108


 Score = 75.5 bits (184),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +3

Query  258  FHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
             H  +SRHR LMN+FDK P V ++AFVAPSASIIGDVQVGR SSIW + C  R
Sbjct  3    IHLSVSRHRTLMNIFDKAPVVDKDAFVAPSASIIGDVQVGRGSSIW-YGCVLR  54



>gb|EMT05905.1| hypothetical protein F775_31227 [Aegilops tauschii]
Length=94

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + +AFY VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IGDV+VG+ SSIW
Sbjct  61   SASLIGDVEVGQGSSIW  77



>ref|XP_002504597.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65855.1| predicted protein [Micromonas sp. RCC299]
Length=254

 Score = 99.0 bits (245),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + R  +++G  +RETGQALDR+GC +QG+  F E +S+HR +M +++K P++ R  F+AP
Sbjct  1    MSRFMFSIGTVLRETGQALDRIGCSMQGSNAFREAISKHRTIMGIYEKTPALPRAGFIAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IGDV +G  SS+W
Sbjct  61   SASVIGDVTIGEKSSVW  77


 Score = 89.0 bits (219),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ IG+ TNIQDN+++HVAK+N+ G   PTIIG+ VTVGH+A LH CTV+
Sbjct  78   YGAVLRGDVNSIRIGSQTNIQDNTVIHVAKTNVGGVAAPTIIGDRVTVGHNAILHACTVK  137



>ref|XP_001758123.1| predicted protein [Physcomitrella patens]
 gb|EDQ76945.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   102 bits (255),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGR  +++G   R TGQALDRLG RLQG Y F +++S+H+ ++ +F+K P +   AF
Sbjct  1    MGTLGRVVFSLGKAARSTGQALDRLGSRLQGGYVFKDEVSKHQTILGIFNKKPVIEESAF  60

Query  336  VAPSASIIGDVQVGRHSSIWVWMCSTR  416
            VAP AS++G+VQ+G +SSIW + C  R
Sbjct  61   VAPGASVVGEVQIGENSSIW-YGCVLR  86


 Score = 84.3 bits (207),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDV+ + +G  +NIQDN++V+V K+N++  + PTIIGN VT+GH++ LH CTVE
Sbjct  81   YGCVLRGDVHQIKVGAESNIQDNTVVNVPKTNVSSSIEPTIIGNRVTIGHNSVLHACTVE  140



>ref|XP_003059787.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55739.1| predicted protein [Micromonas pusilla CCMP1545]
Length=255

 Score = 94.7 bits (234),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + R  + +G  +RETGQALDR+GC  QG+  F E +S+HR +  +++KVP +    FVAP
Sbjct  1    MARVMHALGTALRETGQALDRIGCSFQGSNVFREAISKHRTIQQIYEKVPKLPAAGFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IGDV +G +SS+W
Sbjct  61   SASVIGDVTIGENSSVW  77


 Score = 87.8 bits (216),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVN VSIG+ TNIQDN++VHVAK+N+ G  LPT+IG+ VTVGH+A +H CT++
Sbjct  78   YGAVLRGDVNPVSIGSFTNIQDNAVVHVAKTNVGGVSLPTVIGDRVTVGHNAIIHACTIK  137



>gb|KJB43471.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=226

 Score =   116 bits (291),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  36   YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVE  95


 Score = 63.2 bits (152),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
            MN+FDK P V R+AFVAPSAS+IGDVQVGR SSIW
Sbjct  1    MNVFDKAPIVDRDAFVAPSASVIGDVQVGRSSSIW  35



>ref|XP_007136607.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08601.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
Length=134

 Score =   112 bits (281),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPT+IG+NVTVGHSA LHGCTVE
Sbjct  36   YGCVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVE  95


 Score = 62.8 bits (151),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
            MN+FDK P V ++AFVAPSAS+IGDVQVGR SSIW + C  R
Sbjct  1    MNIFDKAPVVDKDAFVAPSASVIGDVQVGRGSSIW-YGCVLR  41



>gb|AFW79497.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=218

 Score =   108 bits (271),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PTIIGNNVT+GHSA L GCTVE
Sbjct  36   YGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVE  95


 Score = 63.2 bits (152),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
            MN+FDK P VHR+AFVAPSAS+IGDVQVG+ +SIW + C  R
Sbjct  1    MNIFDKTPHVHRDAFVAPSASLIGDVQVGQGASIW-YGCVLR  41



>gb|ACV52585.1| transcription factor APFI-like protein, partial [Nicotiana benthamiana]
Length=152

 Score =   106 bits (264),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++G+V PT IG NVT+GHSA LHGCTVE
Sbjct  40   YGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGRVSPTTIGKNVTIGHSAVLHGCTVE  99


 Score = 65.1 bits (157),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  279  HRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
            HR LMNLFDKVP V ++AFVAPSASI+GDV +G  +SIW
Sbjct  1    HRTLMNLFDKVPVVDKDAFVAPSASIVGDVHIGHSASIW  39



>ref|XP_006305517.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38415.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=230

 Score =   110 bits (274),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSA LHGCTVE
Sbjct  36   YGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVE  95


 Score = 60.5 bits (145),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
            MN+FDK P V + AFVAPSAS+IGDVQ+GR SSIW + C  R
Sbjct  1    MNVFDKAPIVDKTAFVAPSASVIGDVQIGRGSSIW-YGCVLR  41



>gb|AFK37757.1| unknown [Medicago truncatula]
Length=149

 Score =   112 bits (279),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCV+RGDVN++S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  36   YGCVMRGDVNNISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVE  95


 Score = 58.5 bits (140),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
            MN+FDK P V ++AF+APSAS+IGDV +GR SSIW + C  R
Sbjct  1    MNVFDKAPVVGKDAFIAPSASVIGDVHIGRGSSIW-YGCVMR  41



>tpg|DAA63887.1| TPA: hypothetical protein ZEAMMB73_753225 [Zea mays]
Length=239

 Score =   105 bits (261),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPTIIG+NVTVGHSA LH CT+E
Sbjct  47   YGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIE  106


 Score = 65.5 bits (158),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  270  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
            +SRHR +MN+F+K P +HR+ FVAPSA++IGDV++G  SSIW
Sbjct  5    VSRHRTIMNIFEKEPRIHRDVFVAPSAAVIGDVEIGHGSSIW  46



>dbj|BAB10927.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
Length=213

 Score =   110 bits (276),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT+IG+NVT+GHSA LHGCTVE
Sbjct  36   YGCVLRGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVE  95


 Score = 55.1 bits (131),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWVWMCSTR  416
            MN+FDK P+V + AFVAP+AS+ GDV VGR SSIW + C  R
Sbjct  1    MNVFDKTPNVDKGAFVAPNASLSGDVHVGRGSSIW-YGCVLR  41



>ref|XP_011398885.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
 gb|KFM25989.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
Length=237

 Score = 97.8 bits (242),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  162  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  341
            SLG   Y +GF +RETGQALDR+G RLQG+Y F E+L+R R L NLF+  PS+  +AFVA
Sbjct  8    SLGYVVYRLGFALRETGQALDRVGSRLQGSYAFREELNRARPLQNLFNLKPSLGTDAFVA  67

Query  342  PSASIIGDVQVGRHSSIW  395
            P+AS+IGDV +G  SS++
Sbjct  68   PNASVIGDVTLGPRSSVF  85


 Score = 64.3 bits (155),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLR D  S+ +G GTNIQD SL+  A  ++      T IG NVT+GH  ++HG T+E
Sbjct  86   YGSVLRADSGSIKVGAGTNIQDGSLIRTAPQSIDEHAADTTIGANVTIGHQVSMHGVTLE  145



>ref|XP_005536976.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80940.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
Length=303

 Score = 86.7 bits (213),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ--LSRHRVLMNLFDKVPSVHREA-FVA  341
            R  Y +G+  RETGQALDR GC LQGN+ + E   LSRHR +MNL D+ P +  +  F+A
Sbjct  6    RFLYHLGYLARETGQALDRAGCFLQGNFAYREALYLSRHRQIMNLVDRKPIISPQVQFIA  65

Query  342  PSASIIGDVQVGRHSSIW  395
            P+A+IIGDV +G  SS+W
Sbjct  66   PNAAIIGDVAIGAASSVW  83


 Score = 72.8 bits (177),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAK-SNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG V+RGDVN V IG  TN+QD +++HVA       + LPT IGN VT+GH A LH C V
Sbjct  84   YGAVIRGDVNKVVIGERTNVQDRAVIHVASGGGKLERALPTFIGNEVTIGHGAILHACAV  143

Query  574  E  576
            E
Sbjct  144  E  144



>gb|EMT05784.1| hypothetical protein F775_31542 [Aegilops tauschii]
Length=229

 Score =   105 bits (262),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVNS+ IG+G+NIQDNSLVHVAK+N++GKVLPTIIG+NVTVGHSA LH CT+E
Sbjct  36   YGSVLRGDVNSIRIGSGSNIQDNSLVHVAKTNISGKVLPTIIGSNVTVGHSAVLHACTIE  95


 Score = 53.1 bits (126),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
            M++FDK P ++++ FVAPSAS+IGDV++G  SSIW
Sbjct  1    MSIFDKEPRINKDVFVAPSASVIGDVEIGHGSSIW  35



>ref|XP_008871299.1| hypothetical protein H310_07655 [Aphanomyces invadans]
 gb|ETW00274.1| hypothetical protein H310_07655 [Aphanomyces invadans]
Length=235

 Score = 87.4 bits (215),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            +A Y +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DKVP +  +++VAP+A
Sbjct  3    KAIYQLGRAVRETGQAVDRLGLRVLGSNLHREKFSRHRQVMALYDKVPMIAHDSWVAPNA  62

Query  351  SIIGDVQVGRHSSIW  395
            S+IGDV++   SSIW
Sbjct  63   SVIGDVEICNDSSIW  77


 Score = 69.3 bits (168),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD+N VSIG  TNIQD +++H + +   G    T IGNNVTVGH A L+ CT+E
Sbjct  78   YGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNNVTVGHGAILYSCTIE  137



>emb|CBI17490.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   105 bits (261),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YGCVLRGDVNS+SIG+GTNI+DN+LVHVA+S+L+GKVLPT IG+ VT+GH A LHGCTVE
Sbjct  38   YGCVLRGDVNSISIGSGTNIEDNALVHVARSSLSGKVLPTTIGDTVTIGHGAVLHGCTVE  97


 Score = 51.2 bits (121),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +3

Query  291  MNLFDKVPSVHREAFV--APSASIIGDVQVGRHSSIWVWMCSTR  416
            MNLFDK P V ++A V  AP+AS+IGDV+VG+ SSIW + C  R
Sbjct  1    MNLFDKAPVVAKDASVSVAPTASVIGDVKVGQRSSIW-YGCVLR  43



>ref|XP_009831264.1| hypothetical protein H257_07436 [Aphanomyces astaci]
 gb|ETV79423.1| hypothetical protein H257_07436 [Aphanomyces astaci]
Length=235

 Score = 84.3 bits (207),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            +A + +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DK P +  +++VAP+A
Sbjct  3    KAIFELGRAVRETGQAVDRLGLRVLGSSLHREKFSRHRQIMALYDKAPVIAHDSWVAPNA  62

Query  351  SIIGDVQVGRHSSIW  395
            S+IGDV++   SS+W
Sbjct  63   SVIGDVEICNDSSVW  77


 Score = 69.3 bits (168),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD+N VSIG  TNIQD +++H + +   G    T IGNNVTVGH A L+ CT+E
Sbjct  78   YGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNNVTVGHGAILYSCTIE  137



>ref|XP_005644680.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
 gb|EIE20136.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
Length=263

 Score = 80.5 bits (197),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVN + +G  TNIQD   VHVA+ N  GKV PT IGNNVTVGH A +H  TVE
Sbjct  80   YGAVLRGDVNHIVVGNNTNIQDGVTVHVARHNPQGKVAPTTIGNNVTVGHGAIIHAATVE  139


 Score = 73.6 bits (179),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            + F   G   R+TGQ LD +G ++QG Y + E +  H+ L     K P++   AFVAP+A
Sbjct  5    KIFKLFGSVARQTGQTLDSIGLKIQGQYGYKEGVPTHQTLQGYLGKRPTLGTGAFVAPNA  64

Query  351  SIIGDVQVGRHSSIW  395
            S+IGDV++G +SS+W
Sbjct  65   SVIGDVKLGNNSSVW  79



>ref|XP_005649920.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25376.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
Length=219

 Score = 94.7 bits (234),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  186  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  365
            +GF IRETGQALDRLGCRLQGN  F E + +HR +M+L  K  S+   AFVAPSA++IGD
Sbjct  8    LGFIIRETGQALDRLGCRLQGNNAFLEDVFQHRTVMSLGGKKASIGDGAFVAPSAAVIGD  67

Query  366  VQVGRHSSIW  395
            V +G+ SSIW
Sbjct  68   VTLGKRSSIW  77


 Score = 58.5 bits (140),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGD  +++IG  TN+QDN  V  +K+ L G    T IGN+VTVGHS  L   T+E
Sbjct  78   YGTVLRGDEGAITIGDNTNLQDNVSVRTSKAFLGGHAGATSIGNSVTVGHSVLLDTVTIE  137



>gb|KDO22056.1| hypothetical protein SPRG_12043 [Saprolegnia parasitica CBS 223.65]
Length=236

 Score = 88.6 bits (218),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2    LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  345  SASIIGDVQVGRHSSIW  395
            +AS+IGDV++   +S+W
Sbjct  62   NASVIGDVEICNDASVW  78


 Score = 63.9 bits (154),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD+N VSIG  TNIQD +++H + +   G      IGN+VTVGH   L+ CT+E
Sbjct  79   YGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIGNDVTVGHGCILYSCTIE  138



>ref|XP_008608997.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
 gb|EQC37477.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
Length=236

 Score = 88.6 bits (218),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2    LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  345  SASIIGDVQVGRHSSIW  395
            +AS+IGDV++   +S+W
Sbjct  62   NASVIGDVEICNDASVW  78


 Score = 63.9 bits (154),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD+N VSIG  TNIQD +++H + +   G      IGN+VTVGH   L+ CT+E
Sbjct  79   YGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIGNDVTVGHGCILYSCTIE  138



>emb|CCI47075.1| unnamed protein product [Albugo candida]
Length=236

 Score = 84.3 bits (207),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  180  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  359
            + VG   RETGQALDR+G ++ GN  + EQ SRHR ++NL+DK P++  + +VAP+A++I
Sbjct  7    FKVGRAFRETGQALDRVGLKVLGNNSYKEQFSRHRQIINLYDKQPAIAHDVWVAPNATVI  66

Query  360  GDVQVGRHSSIW  395
            GDV++   +S+W
Sbjct  67   GDVEICNDASVW  78


 Score = 66.6 bits (161),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  V+RGD+N+V+IG  TN+QD +++H +K N  G    T IGNNVT+GH   L+ CT+E
Sbjct  79   YNVVIRGDLNAVTIGNRTNVQDRTVIHTSKENSPGVPAGTSIGNNVTIGHGCVLYSCTIE  138



>ref|XP_006297478.1| hypothetical protein CARUB_v10013498mg [Capsella rubella]
 gb|EOA30376.1| hypothetical protein CARUB_v10013498mg [Capsella rubella]
Length=504

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP AS+IGD+ +G+ SSIW
Sbjct  61   VAPGASVIGDIHIGKGSSIW  80



>ref|XP_005850191.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
 gb|EFN58089.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
Length=230

 Score = 84.3 bits (207),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + R  + VG  +RETG ALDR G  LQG++ F E+LSRHR L  L  K PS+  + FVAP
Sbjct  1    MSRVLHAVGKALRETGLALDRAGATLQGSFAFREELSRHRSLAPLGGKSPSLGLDVFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            SA++IGDV++G ++S++
Sbjct  61   SAAVIGDVKLGDNASVF  77


 Score = 63.2 bits (152),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG V+R D  S+SIG  +N+QD  ++  A + L+G    T IG  VT+GH A+LHGCTV
Sbjct  78   YGSVIRADSGSISIGDKSNVQDGCVIRTASAFLSGHSADTTIGRMVTIGHQASLHGCTV  136



>ref|XP_011398930.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
 gb|KFM26034.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
Length=232

 Score = 79.0 bits (193),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG VLRGDVNS+S+G  TNIQDN LVHVAK N   + LPT IG++VTVGH A +H  T+
Sbjct  78   YGTVLRGDVNSISVGEKTNIQDNVLVHVAKHNAAHQELPTRIGSSVTVGHGAVIHAATL  136


 Score = 65.9 bits (159),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  356
              ++G  +R TG+A+D LG  LQG+  + E LS+ + ++      P++    F+APSAS+
Sbjct  5    LKSLGSVVRSTGKAIDSLGLALQGSLGYRETLSKAQTVLPYAGAKPAIADSVFIAPSASV  64

Query  357  IGDVQVGRHSSIW  395
            IG+V +G  SS+W
Sbjct  65   IGNVTLGSGSSVW  77



>dbj|GAM24838.1| hypothetical protein SAMD00019534_080130 [Acytostelium subglobosum 
LB1]
Length=244

 Score = 88.2 bits (217),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  162  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  341
            S+    Y +G  IR TG++LD+LGC LQGNY + E LSRH  +  L  KV S+ +E+F+A
Sbjct  4    SMKNIIYLIGDSIRSTGKSLDKLGCNLQGNYSYMENLSRHSRVTPLRGKVASLGKESFIA  63

Query  342  PSASIIGDVQVGRHSSIW  395
            PS+ +IG+V++G  SS+W
Sbjct  64   PSSCVIGNVEIGTKSSVW  81


 Score = 55.8 bits (133),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  VLR DVNS+ +G  T I D ++VH +  N      PT++GN V VG  A LH C +E
Sbjct  82   YNTVLRADVNSIVVGNETVISDRTVVHCSSENGPKGAQPTVVGNRVFVGPGAILHACVIE  141



>ref|XP_005847553.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
 gb|EFN55451.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
Length=261

 Score = 84.0 bits (206),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGDVNSV IG  TN+QDN LVHVAK N+ GK LPT IG+NVT+G  A +H  T+E
Sbjct  78   YGAVVRGDVNSVVIGDRTNVQDNVLVHVAKHNMAGKALPTQIGSNVTIGPGATIHAATIE  137


 Score = 58.2 bits (139),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  335
            M  L RA  T G  +R  G+ALD LG  +QG+  + E L++ + +     K P +    F
Sbjct  1    MSVLTRA--TAGL-LRGLGRALDGLGSAVQGSGAYKETLNKAQSVQAFAGKRPQLADSVF  57

Query  336  VAPSASIIGDVQVGRHSSIW  395
            VAP+AS++GDV++G  +SIW
Sbjct  58   VAPNASVVGDVKIGSGASIW  77



>emb|CCA20868.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=236

 Score = 77.8 bits (190),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  180  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  359
            + VG   RETGQALDR+G R+     + EQ SRHR ++NL DK P++  + +VAP+A++I
Sbjct  7    FKVGRAFRETGQALDRVGLRVLEKNSYKEQFSRHRQIINLSDKRPTIAHDVWVAPNATVI  66

Query  360  GDVQVGRHSSIW  395
            GDV++   +S+W
Sbjct  67   GDVEICNDASVW  78


 Score = 64.3 bits (155),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  V+RGD+N+V+IG  TN+QD +++H +K    G    T IGNNVT+GH   L+ CT+E
Sbjct  79   YNVVIRGDLNAVTIGNRTNVQDRTVIHTSKDTSPGIPAGTSIGNNVTIGHGCVLYSCTIE  138



>ref|XP_002673591.1| gamma carbonic dehydratase [Naegleria gruberi]
 gb|EFC40847.1| gamma carbonic dehydratase [Naegleria gruberi]
Length=257

 Score = 73.6 bits (179),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  180  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  359
            + +G   RE G+A+DR+GC LQG+  + E L+R R +M   +  PSV   +F+AP+AS+I
Sbjct  10   HLIGSLFREAGEAMDRVGCFLQGSLAYKEDLNRTRRVMKFKNFKPSVQPSSFIAPNASVI  69

Query  360  GDVQVGRHSSIW  395
            G V +G +SS+W
Sbjct  70   GSVSLGPNSSVW  81


 Score = 66.2 bits (160),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 8/63 (13%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKV---LPTIIGNNVTVGHSAALHGC  567
            Y  V+RGDVNS+ IG  TNIQD  ++H      TGKV    PTIIGNNVTV   A LH C
Sbjct  82   YNVVIRGDVNSIQIGENTNIQDRVIIHC-----TGKVGHEKPTIIGNNVTVESGAILHAC  136

Query  568  TVE  576
            T+E
Sbjct  137  TLE  139



>gb|KDD73982.1| hypothetical protein H632_c1679p0 [Helicosporidium sp. ATCC 50920]
Length=251

 Score = 95.1 bits (235),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            LG  FY +GF +RETGQALDR+G R++G++ F E+L+R R LMN+F K P + RE FVAP
Sbjct  9    LGYVFYRLGFALRETGQALDRVGSRMEGSWAFREELNRSRTLMNIFHKKPELGRETFVAP  68

Query  345  SASIIGDVQVGRHSSIW  395
            SAS+IG V +G  +S++
Sbjct  69   SASLIGRVTLGDQASVF  85


 Score = 43.9 bits (102),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 13/72 (18%)
 Frame = +1

Query  397  YGCVLRGDVNS-------------VSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  537
            YG VLR +V+S             +++G  TNIQD  ++      L      T++G++VT
Sbjct  86   YGSVLRDNVSSPPLPTPSTADKGRITVGPRTNIQDGVVIRTGPGCLGEHKCDTVLGSDVT  145

Query  538  VGHSAALHGCTV  573
            VGH AALHG  V
Sbjct  146  VGHLAALHGARV  157



>ref|XP_005766975.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
 gb|ABG37688.1| gamma carbonic anhydrase [Emiliania huxleyi]
 gb|EOD14546.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
Length=235

 Score = 86.3 bits (212),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            + R    VG  +R+TGQA++R+G R Q N+ F E++ RHR LMNLFD+ P +    FVAP
Sbjct  1    MKRVLVGVGKALRDTGQAVERMGMRAQDNWIFQEKICRHRALMNLFDQRPKLRPSVFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            +AS+IG+V V   SSIW
Sbjct  61   NASLIGNVSVMDESSIW  77


 Score = 52.0 bits (123),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD + V IG  ++I D S+V  A  N TG    T IG+ VTVG    L GCTV+
Sbjct  78   YGAVVRGDQSPVDIGGKSSIGDRSVVLSASVNPTGFAAKTSIGDWVTVGQGCVLRGCTVD  137



>ref|XP_009523979.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
 gb|EGZ21262.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
Length=236

 Score = 77.0 bits (188),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP+A
Sbjct  4    KVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAPNA  63

Query  351  SIIGDVQVGRHSSIW  395
            +++GDV++   +S++
Sbjct  64   TVVGDVEICNDASVF  78


 Score = 61.2 bits (147),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  V+RGD+N V IG  TN+QD +++H A S   G      IGN+VT+GH   L+ CTVE
Sbjct  79   YNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIGNDVTIGHGCTLYSCTVE  138



>ref|XP_001703237.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|EDO96533.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
Length=229

 Score = 82.4 bits (202),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  356
             + VGF +RE+GQAL+R+GCRLQG Y F E+L+RH  ++ +   VPS+ + ++VAPS  +
Sbjct  11   LHRVGFAMRESGQALERVGCRLQGVYSFEEKLNRHATVLPMRHNVPSLDKTSWVAPSGMV  70

Query  357  IGDVQVGRHSSIW  395
             G V +G +SS+W
Sbjct  71   SGSVTLGENSSVW  83


 Score = 55.5 bits (132),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG ++RGD   V +G+ +NIQD + V  A S  +G   P  IG+NV+VGH A L GCTV
Sbjct  84   YGAIVRGDFQPVVVGSNSNIQDAAYVG-ATSEFSG---PVTIGDNVSVGHGAVLKGCTV  138



>ref|XP_008890951.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETI56121.1| hypothetical protein F443_01293 [Phytophthora parasitica P1569]
 gb|ETK95912.1| hypothetical protein L915_01223 [Phytophthora parasitica]
 gb|ETL49292.1| hypothetical protein L916_01206 [Phytophthora parasitica]
 gb|ETM02344.1| hypothetical protein L917_01180 [Phytophthora parasitica]
 gb|ETM55585.1| hypothetical protein L914_01223 [Phytophthora parasitica]
 gb|ETN24946.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETO84854.1| hypothetical protein F444_01295 [Phytophthora parasitica P1976]
 gb|ETP25915.1| hypothetical protein F441_01271 [Phytophthora parasitica CJ01A1]
 gb|ETP53918.1| hypothetical protein F442_01235 [Phytophthora parasitica P10297]
Length=236

 Score = 76.6 bits (187),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP+A
Sbjct  4    KVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAPNA  63

Query  351  SIIGDVQVGRHSSIW  395
            +++GDV++   +S++
Sbjct  64   TVVGDVEICNDASVF  78


 Score = 60.8 bits (146),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  V+RGD+N V IG  TN+QD +++H A S   G      IGN+VT+GH   L+ CT+E
Sbjct  79   YNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIGNDVTIGHGCTLYSCTIE  138



>ref|XP_002908534.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61617.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=236

 Score = 76.3 bits (186),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP+A
Sbjct  4    KVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPRIAHDVWVAPNA  63

Query  351  SIIGDVQVGRHSSIW  395
            +++GDV++   +S++
Sbjct  64   TVVGDVEICNDASVF  78


 Score = 61.2 bits (147),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  V+RGD+N V IG  TN+QD +++H A S   G      IGN+VT+GH   L+ CTVE
Sbjct  79   YNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIGNDVTIGHGCTLYSCTVE  138



>gb|KCW68231.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=209

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = +1

Query  331  HLLHQVLLSLGMFKLEGIPLSGYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVL  510
            HL  +V L L M KL    LSG       DVNS+S+G+GTNIQDNSLVHVAKSNL+GKVL
Sbjct  2    HLWPRVPLLLEMCKLGEDHLSG-------DVNSISVGSGTNIQDNSLVHVAKSNLSGKVL  54

Query  511  PTIIGNNVTVGHSAALHGCTVE  576
            PTIIG+NVTVGHSA LHGCTVE
Sbjct  55   PTIIGDNVTVGHSAVLHGCTVE  76



>gb|AAS48195.1| mitochondrial NADH:ubiquinone oxidoreductase 27 kDa subunit [Chlamydomonas 
reinhardtii]
Length=216

 Score = 82.4 bits (202),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  356
             + VGF +RE+GQAL+R+GCRLQG Y F E+L+RH  ++ +   VPS+ + ++VAPS  +
Sbjct  11   LHRVGFAMRESGQALERVGCRLQGVYSFEEKLNRHATVLPMRHNVPSLDKTSWVAPSGMV  70

Query  357  IGDVQVGRHSSIW  395
             G V +G +SS+W
Sbjct  71   SGSVTLGENSSVW  83


 Score = 54.3 bits (129),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG ++RGD   V +G+ +NIQD + V  A S  +G   P  IG+NV+VGH A L GCTV
Sbjct  84   YGAIVRGDFQPVVVGSNSNIQDAAYVG-ATSEFSG---PVTIGDNVSVGHGAVLKGCTV  138



>gb|AAU93943.1| gamma-carbonic anhydrase, partial [Helicosporidium sp. ex Simulium 
jonesi]
Length=246

 Score = 70.1 bits (170),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGDV SVSIG+ T++QDN++VHVAK N    +  T IG++VTVGH A +H  T+E
Sbjct  67   YGAVVRGDVGSVSIGSHTSVQDNAMVHVAKHNAQNTLRGTSIGSHVTVGHGAVVHAATLE  126


 Score = 65.9 bits (159),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  198  IRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVG  377
            +R  G+A++ +G  +QG   + E L++ + L+    K PS+  E FVAPSAS+IGDV++G
Sbjct  1    LRGLGKAVESIGVMMQGTLAYRETLNKSQTLLTYNAKRPSLAAEVFVAPSASVIGDVKIG  60

Query  378  RHSSIW  395
              SS+W
Sbjct  61   ASSSVW  66



>gb|KJB43469.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=188

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 2/58 (3%)
 Frame = +1

Query  403  CVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            CV  GDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSA LHGCTVE
Sbjct  2    CV--GDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVE  57



>ref|XP_002948065.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
 gb|EFJ51053.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
Length=229

 Score = 80.1 bits (196),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  356
             + VGF +RE+G AL+R+GCRLQG Y F E+LSRH  ++ +  + PS+ + A+VAPS  +
Sbjct  11   LHRVGFAMRESGLALERVGCRLQGIYSFEEKLSRHASVLPMRYETPSIAKSAWVAPSGML  70

Query  357  IGDVQVGRHSSIW  395
             G+V +G  SS+W
Sbjct  71   SGNVSIGEGSSVW  83


 Score = 54.3 bits (129),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG ++RGD   V++G  +NIQD + V  A         P  IGNNV+VGH A L GCT+
Sbjct  84   YGAIVRGDFQPVTVGNNSNIQDAAYVGAASEFSP----PVNIGNNVSVGHGAVLKGCTI  138



>dbj|BAF32946.1| putative gamma-type carbonic anhydrase [Pleurochrysis haptonemofera]
Length=234

 Score = 86.7 bits (213),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L R    VG  +R+TGQA++R+GCR Q N+ F+E   RHR +MNL+D+ P V + AF+AP
Sbjct  2    LKRVAVGVGKALRDTGQAIERMGCRAQDNFIFNEPYCRHRAVMNLYDQRPRVAQGAFIAP  61

Query  345  SASIIGDVQVGRHSSIW  395
            +A++IG+V +   +SIW
Sbjct  62   NAAVIGNVDIEPRTSIW  78


 Score = 47.0 bits (110),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD +++ IG  ++I D S+V  +  N TG    T IG+ V +G    L  CT+E
Sbjct  79   YGAVIRGDQSNIFIGGESSIGDRSVVQSSTVNPTGFSARTCIGDWVKIGQGCVLRACTIE  138



>gb|KHG18626.1| Protein YrdA [Gossypium arboreum]
 gb|KHG19737.1| Protein YrdA [Gossypium arboreum]
Length=191

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  415  GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            GDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IGNNVTVGHSA LHGCTVE
Sbjct  5    GDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVE  58



>ref|XP_005703463.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
 gb|EME26943.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
Length=280

 Score = 74.3 bits (181),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  183  TVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIG  362
            T G  +R++GQALD++G + QG Y + E LSRH  +  + DK P +  + FVAP+AS+IG
Sbjct  10   TTGNLLRKSGQALDKVGEQFQGVYAYKELLSRHHRMRAILDKKPLLSSQVFVAPNASVIG  69

Query  363  DVQVGRHSSIW  395
             V++G +SS+W
Sbjct  70   TVELGPNSSVW  80


 Score = 57.8 bits (138),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 6/66 (9%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAK--SNLTGKVL----PTIIGNNVTVGHSAAL  558
            YG ++RGDV SVSIG  TN+QD + +H++K  S   G +L     T+IG+ V++GH A +
Sbjct  81   YGAIVRGDVASVSIGENTNVQDRACIHLSKGDSMFQGGLLNNCTETVIGSRVSIGHGAII  140

Query  559  HGCTVE  576
            HG  ++
Sbjct  141  HGAHIQ  146



>gb|KDO84603.1| hypothetical protein CISIN_1g0242241mg, partial [Citrus sinensis]
Length=183

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  418  DVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            DVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IG+NVTVGHSA LHGCTVE
Sbjct  1    DVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVE  53



>gb|ETI49161.1| hypothetical protein F443_06919 [Phytophthora parasitica P1569]
 gb|ETK89052.1| hypothetical protein L915_06794 [Phytophthora parasitica]
 gb|ETL42459.1| hypothetical protein L916_06736 [Phytophthora parasitica]
 gb|ETL95631.1| hypothetical protein L917_06603 [Phytophthora parasitica]
 gb|ETM48826.1| hypothetical protein L914_06698 [Phytophthora parasitica]
 gb|ETO77896.1| hypothetical protein F444_06984 [Phytophthora parasitica P1976]
 gb|ETP18931.1| hypothetical protein F441_06922 [Phytophthora parasitica CJ01A1]
Length=251

 Score = 66.6 bits (161),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IG+NVTVG +A +H CT++
Sbjct  76   YNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPAAIVHACTIQ  132


 Score = 63.2 bits (152),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  368
            G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEESVFVAPNASVIGDV  66

Query  369  QVGRHSSIW  395
            +VG+ SSIW
Sbjct  67   KVGKGSSIW  75



>ref|XP_005713311.1| carbonic anhydrase, gamma type [Chondrus crispus]
 emb|CDF33509.1| carbonic anhydrase, gamma type [Chondrus crispus]
Length=263

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            RA Y  G  IRETGQALDR+G RLQG Y F EQLSRHR +MNL D  P +  + F+APSA
Sbjct  3    RAAYAAGMMIRETGQALDRVGSRLQGKYAFIEQLSRHRQVMNLRDSKPIISSDVFLAPSA  62

Query  351  SIIGDVQVGRHSSIW  395
            S+IG+V++   SS+W
Sbjct  63   SVIGNVELHASSSVW  77



>ref|XP_008903478.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETN10960.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETP46878.1| hypothetical protein F442_06954 [Phytophthora parasitica P10297]
Length=251

 Score = 66.2 bits (160),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IG+NVTVG +A +H CT++
Sbjct  76   YNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPAAIVHACTIQ  132


 Score = 62.0 bits (149),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  368
            G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNASVIGDV  66

Query  369  QVGRHSSIW  395
            +VG+ SSIW
Sbjct  67   KVGKGSSIW  75



>ref|XP_002997211.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69573.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=251

 Score = 68.6 bits (166),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IGNNVTVG +A +H CT++
Sbjct  76   YNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGNNVTVGPAAIVHACTIQ  132


 Score = 59.7 bits (143),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  368
            G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+A++IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKLAYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNAAVIGDV  66

Query  369  QVGRHSSIW  395
            +VG+ SSIW
Sbjct  67   KVGKGSSIW  75



>ref|XP_009516211.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
 gb|EGZ28936.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
Length=251

 Score = 66.6 bits (161),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y   +RGDVN ++IG  TNIQD ++VHVAK +   + +PT IGNNVTVG +A +H CT++
Sbjct  76   YNATVRGDVNHITIGENTNIQDQAVVHVAKIH---QDIPTKIGNNVTVGPNAIVHACTIQ  132


 Score = 61.2 bits (147),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  368
            G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKLTYTEHLNPSTRAVKNLGRAPKFEEGVFVAPNASVIGDV  66

Query  369  QVGRHSSIW  395
            +VG+ SSIW
Sbjct  67   KVGKGSSIW  75



>emb|CCA17668.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=254

 Score = 63.2 bits (152),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 45/59 (76%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG  LRGD+N ++IG  TN+ +++++HVAK +   + +PTI+GN+VT+G S+ +H CT+
Sbjct  79   YGATLRGDINHITIGENTNVLESAIIHVAKIH---RDIPTIVGNHVTIGPSSIIHACTI  134


 Score = 62.8 bits (151),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L   F  +G  IR  GQ+LDR G  L+GN  + E L+     ++   + P +   AF+AP
Sbjct  2    LKNGFEAIGKSIRSFGQSLDRTGVLLEGNASYIEHLNPSTRCVSNAGRRPKMEAAAFIAP  61

Query  345  SASIIGDVQVGRHSSIW  395
            +AS+IG+V +G+ SS+W
Sbjct  62   NASVIGEVTIGKGSSVW  78



>ref|XP_008672301.1| PREDICTED: uncharacterized protein LOC100217184 isoform X2 [Zea 
mays]
 tpg|DAA54234.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=214

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 61/89 (69%), Gaps = 9/89 (10%)
 Frame = +1

Query  337  LHQVLLSLGMFKLE-GIPLSGYGCVLRG--------DVNSVSIGTGTNIQDNSLVHVAKS  489
            L + + ++G +  E G  L   GC L+G        D N + IG+GTNIQDNSL+HVAKS
Sbjct  4    LGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQRDANIIQIGSGTNIQDNSLIHVAKS  63

Query  490  NLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            NL+GKV PT IGNNVTVGHSA L GCTVE
Sbjct  64   NLSGKVFPTTIGNNVTVGHSAVLQGCTVE  92


 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  156  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ  269
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQ  38



>dbj|GAM26691.1| hypothetical protein SAMD00019534_098660 [Acytostelium subglobosum 
LB1]
Length=242

 Score = 82.4 bits (202),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  356
            F  +G  IR TG+ALDRLGC +QGNY + E+L+RH  +M     +  + REAF+AP++S+
Sbjct  6    FAVLGDSIRSTGKALDRLGCSIQGNYAYIEKLNRHSRVMPFRGNIAHLGREAFIAPNSSV  65

Query  357  IGDVQVGRHSSIW  395
            IG V++G  SS+W
Sbjct  66   IGSVRIGHQSSVW  78


 Score = 43.1 bits (100),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 6/60 (10%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  VLRGD N++ IGT + I D ++++  +         T IG NV VG  A L+GC+++
Sbjct  79   YNTVLRGDTNAIIIGTNSIISDRTVINATRDK------QTTIGTNVYVGPGAILNGCSID  132



>emb|CCI50078.1| unnamed protein product [Albugo candida]
Length=254

 Score = 64.3 bits (155),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG  LRGD+N ++IG  TN+ D +++HVAK +   + +PTIIGN+VT+G S+ +H CT+
Sbjct  79   YGATLRGDINHITIGNHTNVLDAAIIHVAKIH---RDIPTIIGNHVTIGPSSIIHACTI  134


 Score = 60.8 bits (146),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L      +G  IR  GQ+LDR G  L+G+  + E L+     +N   + P +   AF+AP
Sbjct  2    LKNGLEAIGKSIRSFGQSLDRTGVLLEGSASYTEHLNPSTRCVNNAGRRPKLEAAAFIAP  61

Query  345  SASIIGDVQVGRHSSIW  395
            +AS+IG+V VG  SS+W
Sbjct  62   NASVIGEVNVGSGSSVW  78



>ref|XP_008610617.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
 gb|EQC35855.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
Length=249

 Score = 66.6 bits (161),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG  +RGDVN ++IG  TN+QD +++H AK        PT+IGNNVT+G SA +H C +
Sbjct  74   YGATVRGDVNHITIGDNTNVQDQAVIHAAK---IANDFPTVIGNNVTIGPSAVIHACKI  129


 Score = 57.8 bits (138),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +3

Query  186  VGFWIRETGQALDRLGCRLQGNYYFHEQL-SRHRVLMNLFDKVPSVHREAFVAPSASIIG  362
            +G  +R  GQ+LD++G  L+G   + E+L    R++ N  +K P +   AFVAP+AS++G
Sbjct  4    LGKTLRSLGQSLDKVGVALEGRLTYTERLVPSTRLVANAGNK-PVLAEGAFVAPNASVVG  62

Query  363  DVQVGRHSSIW  395
            +V +G+ SS+W
Sbjct  63   EVSIGKGSSVW  73



>ref|XP_004351419.1| trimeric LpxA-like domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG14903.1| trimeric LpxA-like domain-containing protein [Dictyostelium fasciculatum]
Length=249

 Score = 72.4 bits (176),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L   FY VG  +R TG+ALD +G  +QGNY + EQL+R   +  L  K+  + +++FVAP
Sbjct  2    LKNVFYLVGDAVRSTGKALDVVGRNMQGNYAYVEQLNRQSRVTPLRGKLAHLGKDSFVAP  61

Query  345  SASIIGDVQVGRHSSIW  395
            ++S+IG V +G +S++W
Sbjct  62   NSSVIGQVTIGNNSALW  78


 Score = 51.6 bits (122),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  V+RGDVN +++G  T+I D +++H +  N       T IG+ V VG  A LHGC +E
Sbjct  79   YNTVVRGDVNQITVGNETSIGDRTVIHASSKNGPKGEQATQIGSRVLVGSGAILHGCVIE  138



>gb|EWM27773.1| Trimeric LpxA [Nannochloropsis gaditana]
Length=263

 Score = 70.1 bits (170),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  350
            +   T+G  +RETGQALDR G    G+    E  SRHR + NLFD+ P V   AFV+PSA
Sbjct  34   KGLDTLGKALRETGQALDRTGMEALGSDKHKELWSRHRQVSNLFDQRPRVASNAFVSPSA  93

Query  351  SIIGDVQVGRHSSIW  395
            +++G+V +    SIW
Sbjct  94   TVVGEVSLWDKVSIW  108


 Score = 52.4 bits (124),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGD NSV IG  TN+QD++++    S  +G      IGN VT+GHSA +   T+E
Sbjct  109  YGAVIRGDRNSVKIGNCTNVQDHAVICTVPSLDSGFPATVDIGNLVTIGHSATITSATIE  168



>ref|XP_636871.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q54JC2.1|Y2881_DICDI RecName: Full=Uncharacterized protein DDB_G0288155 [Dictyostelium 
discoideum]
 gb|EAL63365.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
Length=246

 Score = 77.4 bits (189),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  356
            F  +G  ++ TG  L R GC++QG+Y + E+L+RH  L    D  P V +++F+AP+ASI
Sbjct  7    FGILGEVVKNTGLILHRTGCKMQGDYAYVEKLNRHTRLTAFGDNAPIVGQKSFIAPNASI  66

Query  357  IGDVQVGRHSSIW  395
            IGDV +G+ SSIW
Sbjct  67   IGDVVIGKESSIW  79


 Score = 45.1 bits (105),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            Y  VLRGDVNS+ IG  T + D ++VH + +   G   PT IG+ V +G  + +H  T+
Sbjct  80   YNAVLRGDVNSIHIGDKTVVSDRTVVHCSSNGPLGPK-PTQIGDKVYIGPGSIVHAATI  137



>ref|XP_008862851.1| hypothetical protein H310_01513 [Aphanomyces invadans]
 gb|ETW09046.1| hypothetical protein H310_01513 [Aphanomyces invadans]
Length=249

 Score = 64.3 bits (155),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG  +RGDVN+++IG  TNIQD ++VH AK        PTIIGNNVT+G  A +H   +
Sbjct  74   YGATVRGDVNAITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGPKAIIHAAKI  129


 Score = 56.2 bits (134),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +3

Query  186  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  365
            +G  +R  GQ LD++G  ++G   + E+L     L+N     P++    FVAP+AS+IG+
Sbjct  4    IGNTLRAFGQKLDKVGVSIEGALSYTERLVPSTRLVNHGGHKPALASTTFVAPNASVIGE  63

Query  366  VQVGRHSSIW  395
            V +G+ SS+W
Sbjct  64   VSIGQGSSVW  73



>ref|XP_009149442.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 1, mitochondrial 
[Brassica rapa]
Length=191

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  418  DVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            DVN+VS+G+GTNIQDNSLVHVAKS L GKV PTIIG+NV +GHSA LHGCTVE
Sbjct  13   DVNTVSVGSGTNIQDNSLVHVAKSYLIGKVPPTIIGDNVIIGHSALLHGCTVE  65



>gb|KIY95938.1| transferase [Monoraphidium neglectum]
Length=283

 Score = 63.5 bits (153),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKS-NLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG  LRGDVN+++IG  TNIQDN ++HVA+    T     T+IG+NVTV H A +H  T+
Sbjct  101  YGATLRGDVNAITIGERTNIQDNVVIHVARHVPSTAAPRATVIGSNVTVAHGALVHAATI  160


 Score = 56.6 bits (135),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKV------PSVHR  326
            LG+  Y +G  +R TG+ALD +G  +QG Y    +L  +   + L          P    
Sbjct  18   LGKVLYGIGSVLRGTGKALDSVGSSIQGPYGVQAELPPNTAWLPLIANPQVSIVEPVKGP  77

Query  327  EAFVAPSASIIGDVQVGRHSSIW  395
            + FVA +A+I+G+V +G+ SSIW
Sbjct  78   DVFVAQNATILGNVSIGKGSSIW  100



>ref|XP_004333657.1| GAMMA CA3 (GAMMA CARBONIC ANHYDRASE 3), putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR11644.1| GAMMA CA3 (GAMMA CARBONIC ANHYDRASE 3), putative [Acanthamoeba 
castellanii str. Neff]
Length=282

 Score = 73.9 bits (180),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 58/118 (49%), Gaps = 41/118 (35%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ-------------------------  269
            L R  Y +G  +RET  ALDR+GCRLQGNY F E+                         
Sbjct  2    LKRFSYVLGNTVRETAYALDRVGCRLQGNYAFTEERTFLPPRIDIGTPPHFGTYAYVPLW  61

Query  270  ----------------LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
                            +SRHR +M L+DK P++ ++ F+AP+AS+IG V +G  +++W
Sbjct  62   LWIMDWAGLGVDDDETVSRHRRVMGLYDKQPAISQDVFIAPNASVIGSVSLGEGANVW  119


 Score = 45.8 bits (107),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG VLRGDVN +S+G  ++I + S+VH A   LT  + PT IG+NV VG    LHGCT+E
Sbjct  120  YGSVLRGDVNDISVGKKSSIGNRSVVH-ASGGLT-TLAPTKIGDNVVVGDGVVLHGCTLE  177



>emb|CBN79571.1| gamma carbonic anhydrase [Ectocarpus siliculosus]
Length=304

 Score = 60.1 bits (144),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            YG V+RGDVN V IG G+++ D+++VHVA   L G   PTI+GNNV +G  A +H CT++
Sbjct  78   YGSVVRGDVNHVVIGAGSSVGDSAVVHVA--GLAGN-KPTIVGNNVVIGPRATIHACTLK  134


 Score = 59.7 bits (143),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  344
            L +A   VG   R  G++LD +G  L+ + Y  + L+  R + +   KVPS  + +FVAP
Sbjct  2    LNQAKTAVGMAARRVGRSLDGMGAALETHPYTEKLLASTRSVGH-KGKVPSTAQASFVAP  60

Query  345  SASIIGDVQVGRHSSIW  395
            +AS+IGDV+VG  +S+W
Sbjct  61   NASVIGDVKVGEGASLW  77



>ref|XP_009821152.1| hypothetical protein H257_00264 [Aphanomyces astaci]
 gb|ETV88752.1| hypothetical protein H257_00264 [Aphanomyces astaci]
Length=249

 Score = 64.3 bits (155),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            YG  +RGDVN+++IG  TNIQD ++VH AK        PTIIGNNVT+G +A +H   +
Sbjct  74   YGATVRGDVNTITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGPNAIIHAAKI  129


 Score = 55.1 bits (131),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +3

Query  186  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  365
            +G  +R  GQ LD++G  ++G   + E+L     L+      P++    FVAP+AS+IG+
Sbjct  4    LGNTLRAFGQKLDKVGVSIEGALTYTERLVPSTRLVKFAGHKPTLAATTFVAPNASVIGE  63

Query  366  VQVGRHSSIW  395
            V +G+ SS+W
Sbjct  64   VSIGQGSSVW  73



>gb|EFA76939.1| trimeric LpxA-like domain-containing protein [Polysphondylium 
pallidum PN500]
Length=223

 Score = 63.2 bits (152),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  240  LQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
            +QGNY + E+L+RH  +M L  K+ ++ R +FVAP++S+IGDVQ+G  SS+W
Sbjct  1    MQGNYAYVEKLNRHSRIMPLRGKIATLGRNSFVAPNSSVIGDVQIGNQSSVW  52


 Score = 55.1 bits (131),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTVE  576
            Y  VLRGDVNS+ IG  + I D S+VH +  N      PT++GN V VG  + +H C +E
Sbjct  53   YNTVLRGDVNSIVIGDESVISDRSVVHCSSGNGPKGAQPTVVGNRVYVGPGSIIHACKIE  112



>emb|CBK21456.2| unnamed protein product [Blastocystis hominis]
Length=202

 Score = 62.4 bits (150),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  237  RLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIW  395
            R++G   F +  SRHR +M L+DK P+V+ +AFVAP+AS+IGDV++   SS+W
Sbjct  2    RMEGVQDFLKLFSRHRPIMGLYDKRPAVNTDAFVAPNASVIGDVKMAAGSSVW  54


 Score = 55.8 bits (133),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +1

Query  397  YGCVLRGDVNSVSIGTGTNIQDNS-LVHVAKSNLTGKVLPTIIGNNVTVGHSAALHGCTV  573
            Y  V+RGD+N+V+IG  TN+QD + L    KS+ +   L   IGNNVT+GH+A L+ C V
Sbjct  55   YNAVVRGDINTVTIGENTNVQDRAVLASAKKSHCSDGTLK--IGNNVTIGHAAILNACQV  112

Query  574  E  576
            +
Sbjct  113  D  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985