BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018B01

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595011.1|  PREDICTED: eukaryotic translation initiation...    235   4e-71   Nicotiana tomentosiformis
ref|XP_006366213.1|  PREDICTED: eukaryotic translation initiation...    231   2e-69   Solanum tuberosum [potatoes]
emb|CDP16167.1|  unnamed protein product                                231   2e-69   Coffea canephora [robusta coffee]
ref|XP_004245267.1|  PREDICTED: eukaryotic translation initiation...    229   7e-69   Solanum lycopersicum
ref|XP_007012067.1|  RNA polymerase I-associated factor PAF67 iso...    223   3e-67   
ref|XP_002535481.1|  conserved hypothetical protein                     220   6e-67   
ref|XP_007012066.1|  RNA polymerase I-associated factor PAF67 iso...    223   1e-66   
ref|XP_007012064.1|  RNA polymerase I-associated factor PAF67 iso...    223   1e-66   
ref|XP_007012063.1|  RNA polymerase I-associated factor PAF67 iso...    223   2e-66   
ref|XP_007012065.1|  RNA polymerase I-associated factor PAF67 iso...    223   2e-66   
ref|XP_002308615.2|  hypothetical protein POPTR_0006s25800g             223   3e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011019644.1|  PREDICTED: eukaryotic translation initiation...    222   6e-66   Populus euphratica
ref|XP_011026651.1|  PREDICTED: eukaryotic translation initiation...    220   9e-66   Populus euphratica
ref|XP_006450640.1|  hypothetical protein CICLE_v10007989mg             221   1e-65   Citrus clementina [clementine]
ref|XP_007222482.1|  hypothetical protein PRUPE_ppa004079mg             220   3e-65   Prunus persica
ref|XP_008220046.1|  PREDICTED: eukaryotic translation initiation...    220   4e-65   Prunus mume [ume]
ref|XP_002324243.1|  hypothetical protein POPTR_0018s00670g             219   7e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006394822.1|  hypothetical protein EUTSA_v10003996mg             219   9e-65   Eutrema salsugineum [saltwater cress]
ref|XP_008347630.1|  PREDICTED: eukaryotic translation initiation...    216   1e-64   
ref|XP_011090287.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    218   1e-64   Sesamum indicum [beniseed]
ref|XP_006394821.1|  hypothetical protein EUTSA_v10004012mg             218   2e-64   Eutrema salsugineum [saltwater cress]
ref|XP_004291198.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64   Fragaria vesca subsp. vesca
ref|XP_010249694.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008357416.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64   
emb|CDX88194.1|  BnaA06g27850D                                          217   4e-64   
emb|CDX80534.1|  BnaC07g29100D                                          217   4e-64   
ref|XP_008378102.1|  PREDICTED: eukaryotic translation initiation...    217   5e-64   
ref|XP_002872179.1|  hypothetical protein ARALYDRAFT_489426             216   9e-64   
ref|XP_009367906.1|  PREDICTED: eukaryotic translation initiation...    216   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_003636390.1|  Eukaryotic translation initiation factor 3 s...    216   1e-63   
gb|KJB65718.1|  hypothetical protein B456_010G110200                    215   1e-63   Gossypium raimondii
gb|KJB65717.1|  hypothetical protein B456_010G110200                    216   1e-63   Gossypium raimondii
ref|XP_010519900.1|  PREDICTED: eukaryotic translation initiation...    216   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_010100268.1|  hypothetical protein L484_007265                   216   2e-63   Morus notabilis
gb|KJB54834.1|  hypothetical protein B456_009G051100                    214   2e-63   Gossypium raimondii
ref|XP_004501183.1|  PREDICTED: eukaryotic translation initiation...    215   3e-63   Cicer arietinum [garbanzo]
ref|XP_009413816.1|  PREDICTED: eukaryotic translation initiation...    215   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP34205.1|  hypothetical protein JCGZ_07776                         214   4e-63   Jatropha curcas
ref|XP_010668069.1|  PREDICTED: eukaryotic translation initiation...    214   5e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009151095.1|  PREDICTED: eukaryotic translation initiation...    214   6e-63   Brassica rapa
gb|KCW81539.1|  hypothetical protein EUGRSUZ_C02897                     214   7e-63   Eucalyptus grandis [rose gum]
gb|KJB54836.1|  hypothetical protein B456_009G051100                    214   9e-63   Gossypium raimondii
ref|XP_010049085.1|  PREDICTED: eukaryotic translation initiation...    214   9e-63   Eucalyptus grandis [rose gum]
gb|EYU20458.1|  hypothetical protein MIMGU_mgv1a004619mg                213   1e-62   Erythranthe guttata [common monkey flower]
gb|KHG17679.1|  Eukaryotic translation initiation factor 3 subunit L    213   1e-62   Gossypium arboreum [tree cotton]
ref|XP_007137185.1|  hypothetical protein PHAVU_009G106900g             213   2e-62   Phaseolus vulgaris [French bean]
ref|XP_006578214.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62   Glycine max [soybeans]
ref|XP_003526476.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62   Glycine max [soybeans]
ref|XP_010915834.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62   Elaeis guineensis
ref|XP_010925869.1|  PREDICTED: eukaryotic translation initiation...    212   2e-62   
ref|XP_002284115.1|  PREDICTED: eukaryotic translation initiation...    212   4e-62   Vitis vinifera
ref|XP_009419787.1|  PREDICTED: eukaryotic translation initiation...    212   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925868.1|  PREDICTED: eukaryotic translation initiation...    211   4e-62   Elaeis guineensis
ref|XP_011081819.1|  PREDICTED: eukaryotic translation initiation...    212   4e-62   Sesamum indicum [beniseed]
ref|XP_008800463.1|  PREDICTED: eukaryotic translation initiation...    212   4e-62   Phoenix dactylifera
ref|XP_006287441.1|  hypothetical protein CARUB_v10000647mg             212   4e-62   
ref|XP_010925867.1|  PREDICTED: eukaryotic translation initiation...    212   5e-62   Elaeis guineensis
ref|NP_680222.1|  RNA polymerase I-associated factor PAF67              211   6e-62   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93836.1|  hypothetical protein                                   211   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136214.1|  PREDICTED: eukaryotic translation initiation...    211   6e-62   Cucumis sativus [cucumbers]
ref|XP_008466039.1|  PREDICTED: eukaryotic translation initiation...    211   8e-62   Cucumis melo [Oriental melon]
ref|XP_006290036.1|  hypothetical protein CARUB_v10003670mg             211   1e-61   
ref|XP_010254082.1|  PREDICTED: eukaryotic translation initiation...    209   7e-61   Nelumbo nucifera [Indian lotus]
gb|AAN31908.1|  unknown protein                                         208   7e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61195.1|  hypothetical protein M569_13603                         208   8e-61   Genlisea aurea
gb|KFK22378.1|  hypothetical protein AALP_AAs56077U000100               196   2e-60   Arabis alpina [alpine rockcress]
ref|XP_010421430.1|  PREDICTED: eukaryotic translation initiation...    206   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010493831.1|  PREDICTED: eukaryotic translation initiation...    205   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002885738.1|  hypothetical protein ARALYDRAFT_319240             196   4e-56   
ref|XP_003565952.1|  PREDICTED: eukaryotic translation initiation...    191   2e-54   Brachypodium distachyon [annual false brome]
emb|CDM82375.1|  unnamed protein product                                190   7e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006833328.1|  hypothetical protein AMTR_s00109p00071210          189   2e-53   Amborella trichopoda
ref|XP_001777172.1|  predicted protein                                  184   2e-51   
ref|XP_001783486.1|  predicted protein                                  183   3e-51   
ref|XP_004967411.1|  PREDICTED: eukaryotic translation initiation...    182   4e-51   Setaria italica
ref|XP_002454893.1|  hypothetical protein SORBIDRAFT_03g000920          177   6e-49   Sorghum bicolor [broomcorn]
ref|XP_006643941.1|  PREDICTED: eukaryotic translation initiation...    176   1e-48   Oryza brachyantha
gb|AFW80484.1|  hypothetical protein ZEAMMB73_715495                    174   8e-48   
ref|NP_001145811.1|  uncharacterized protein LOC100279318               174   9e-48   Zea mays [maize]
ref|XP_002968842.1|  hypothetical protein SELMODRAFT_146079             172   5e-47   
ref|XP_008673489.1|  PREDICTED: eukaryotic translation initiation...    169   7e-46   
dbj|BAD81321.1|  putative eukaryotic translation initiation facto...    160   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042483.1|  Os01g0229100                                       161   3e-43   
gb|EEC70234.1|  hypothetical protein OsI_01004                          161   3e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001054968.1|  Os05g0227700                                       155   4e-41   
gb|EEC78744.1|  hypothetical protein OsI_18958                          155   4e-41   Oryza sativa Indica Group [Indian rice]
gb|AAT77307.1|  unknown protein                                         155   5e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KIZ06502.1|  hypothetical protein MNEG_1449                          147   5e-38   Monoraphidium neglectum
ref|XP_003061585.1|  predicted protein                                  147   8e-38   Micromonas pusilla CCMP1545
gb|EMT29163.1|  hypothetical protein F775_30790                         145   5e-37   
ref|XP_002509169.1|  predicted protein                                  144   8e-37   Micromonas commoda
ref|XP_005645053.1|  hypothetical protein COCSUDRAFT_54338              139   2e-35   Coccomyxa subellipsoidea C-169
ref|XP_006654164.1|  PREDICTED: eukaryotic translation initiation...    135   6e-34   Oryza brachyantha
ref|XP_001691635.1|  predicted protein                                  131   2e-32   Chlamydomonas reinhardtii
ref|XP_005849793.1|  hypothetical protein CHLNCDRAFT_57223              131   2e-32   Chlorella variabilis
gb|KDD75677.1|  RNA polymerase I-associated factor PAF67                131   3e-32   Helicosporidium sp. ATCC 50920
ref|XP_005773357.1|  hypothetical protein EMIHUDRAFT_463792             125   1e-30   Emiliania huxleyi CCMP1516
ref|XP_002949019.1|  hypothetical protein VOLCADRAFT_73984              126   1e-30   Volvox carteri f. nagariensis
ref|XP_005706478.1|  hypothetical protein Gasu_27420                    123   2e-29   Galdieria sulphuraria
ref|XP_001420552.1|  predicted protein                                  122   2e-29   Ostreococcus lucimarinus CCE9901
ref|XP_011444762.1|  PREDICTED: eukaryotic translation initiation...    122   6e-29   Crassostrea gigas
ref|XP_001630146.1|  predicted protein                                  121   8e-29   Nematostella vectensis
ref|XP_011395819.1|  Eukaryotic translation initiation factor 3 s...    120   2e-28   Auxenochlorella protothecoides
dbj|GAN05046.1|  eukaryotic translation initiation factor 3 subun...    119   8e-28   Mucor ambiguus
gb|EIE77654.1|  hypothetical protein RO3G_02358                         118   9e-28   Rhizopus delemar RA 99-880
gb|ESA14939.1|  hypothetical protein GLOINDRAFT_24425                   118   1e-27   
gb|EPB85480.1|  hypothetical protein HMPREF1544_07753                   117   2e-27   Mucor circinelloides f. circinelloides 1006PhL
emb|CCJ28091.1|  unnamed protein product                                119   2e-27   Pneumocystis jirovecii
dbj|BAK07615.1|  predicted protein                                      116   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEP10774.1|  hypothetical protein                                   115   9e-27   Parasitella parasitica
ref|XP_004344304.2|  eukaryotic translation initiation factor 3         115   2e-26   Capsaspora owczarzaki ATCC 30864
emb|CEG65880.1|  Putative Eukaryotic translation initiation facto...    115   2e-26   Rhizopus microsporus
ref|XP_009014305.1|  hypothetical protein HELRODRAFT_185444             115   2e-26   Helobdella robusta
ref|XP_011273777.1|  hypothetical protein BN7_3948                      113   5e-26   Wickerhamomyces ciferrii
ref|XP_011503899.1|  PREDICTED: eukaryotic translation initiation...    113   5e-26   Ceratosolen solmsi marchali
ref|XP_002736781.1|  PREDICTED: eukaryotic translation initiation...    112   2e-25   Saccoglossus kowalevskii
ref|XP_002591162.1|  hypothetical protein BRAFLDRAFT_287258             111   4e-25   Branchiostoma floridae
ref|XP_004932950.1|  PREDICTED: eukaryotic translation initiation...    111   4e-25   Bombyx mori [silk moth]
gb|ELT93773.1|  hypothetical protein CAPTEDRAFT_152273                  111   5e-25   Capitella teleta
gb|AGM32740.1|  RNA polymerase I-associated factor PAF67                107   1e-24   Coptotermes formosanus
gb|KFH65880.1|  hypothetical protein MVEG_07983                         109   2e-24   Mortierella verticillata NRRL 6337
gb|ETE71168.1|  Eukaryotic translation initiation factor 3 subunit L    108   4e-24   Ophiophagus hannah
ref|XP_003385511.1|  PREDICTED: eukaryotic translation initiation...    108   5e-24   
gb|EHJ64982.1|  putative eukaryotic translation initiation factor 3     108   6e-24   
ref|XP_007434464.1|  PREDICTED: eukaryotic translation initiation...    108   7e-24   Python bivittatus
gb|EIE89576.1|  hypothetical protein RO3G_14287                         107   1e-23   Rhizopus delemar RA 99-880
ref|XP_003727128.1|  PREDICTED: eukaryotic translation initiation...    107   1e-23   
ref|XP_795841.2|  PREDICTED: eukaryotic translation initiation fa...    107   1e-23   Strongylocentrotus purpuratus [purple urchin]
emb|CEF99744.1|  Translation initiation factor 3 complex subunit L      106   2e-23   Ostreococcus tauri
gb|KFU98436.1|  Eukaryotic translation initiation factor 3 subunit L    105   2e-23   Pterocles gutturalis
ref|XP_010074072.1|  PREDICTED: eukaryotic translation initiation...    105   2e-23   Pterocles gutturalis
ref|XP_011337689.1|  PREDICTED: eukaryotic translation initiation...    106   3e-23   Ooceraea biroi
gb|EGI70009.1|  Eukaryotic translation initiation factor 3 subunit L    105   4e-23   Acromyrmex echinatior
ref|XP_005039809.1|  PREDICTED: eukaryotic translation initiation...    106   4e-23   Ficedula albicollis
ref|XP_011172791.1|  PREDICTED: eukaryotic translation initiation...    105   4e-23   Solenopsis invicta [imported red fire ant]
ref|XP_011065299.1|  PREDICTED: eukaryotic translation initiation...    105   4e-23   Acromyrmex echinatior
emb|CDS09409.1|  hypothetical protein LRAMOSA10769                      105   4e-23   Lichtheimia ramosa
ref|XP_004451669.1|  PREDICTED: eukaryotic translation initiation...    102   4e-23   
gb|KFP49293.1|  Eukaryotic translation initiation factor 3 subunit L    104   4e-23   Cathartes aura
ref|XP_011252594.1|  PREDICTED: eukaryotic translation initiation...    105   5e-23   Camponotus floridanus
gb|EFN70839.1|  Eukaryotic translation initiation factor 3 subuni...    105   5e-23   Camponotus floridanus
emb|CDK25674.1|  unnamed protein product                                105   6e-23   Kuraishia capsulata CBS 1993
ref|XP_009663621.1|  PREDICTED: eukaryotic translation initiation...    105   6e-23   Struthio camelus australis
ref|XP_005101845.1|  PREDICTED: eukaryotic translation initiation...    105   6e-23   
ref|XP_005101846.1|  PREDICTED: eukaryotic translation initiation...    105   7e-23   
gb|KFP91933.1|  Eukaryotic translation initiation factor 3 subunit L    104   9e-23   Apaloderma vittatum
ref|XP_008634828.1|  PREDICTED: eukaryotic translation initiation...    105   9e-23   
ref|XP_005446835.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   9e-23   
gb|KFV19153.1|  Eukaryotic translation initiation factor 3 subunit L    104   9e-23   Tauraco erythrolophus
gb|KFU83581.1|  Eukaryotic translation initiation factor 3 subunit L    105   1e-22   Chaetura pelagica
gb|KFQ12757.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Leptosomus discolor
gb|EOB03942.1|  Eukaryotic translation initiation factor 3 subuni...    104   1e-22   Anas platyrhynchos [duck]
gb|KFQ24519.1|  Eukaryotic translation initiation factor 3 subunit L    105   1e-22   Merops nubicus
gb|KFM02149.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Aptenodytes forsteri
gb|KFO61273.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Corvus brachyrhynchos
gb|KGL83796.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Tinamus guttatus
ref|XP_008948320.1|  PREDICTED: eukaryotic translation initiation...    105   1e-22   Merops nubicus
ref|XP_002198918.1|  PREDICTED: eukaryotic translation initiation...    105   1e-22   Taeniopygia guttata
gb|KFV94330.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Fulmarus glacialis
gb|KFW87339.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Manacus vitellinus
gb|KFW73179.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Pygoscelis adeliae
ref|XP_008929890.1|  PREDICTED: eukaryotic translation initiation...    105   1e-22   
ref|XP_010134484.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Buceros rhinoceros silvestris
gb|KFR13278.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Opisthocomus hoazin [hoatzin]
gb|KFQ49039.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Pelecanus crispus
gb|KFV75696.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Struthio camelus australis
ref|XP_005150417.1|  PREDICTED: eukaryotic translation initiation...    105   1e-22   Melopsittacus undulatus
gb|KFP56635.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Cariama cristata
ref|XP_010222472.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Tinamus guttatus
ref|XP_010154288.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Eurypyga helias
gb|KFV68894.1|  Eukaryotic translation initiation factor 3 subunit L    105   1e-22   Picoides pubescens
ref|XP_005514772.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Columba livia [carrier pigeon]
gb|KFO89757.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Buceros rhinoceros silvestris
ref|NP_001012553.1|  eukaryotic translation initiation factor 3 s...    104   1e-22   Gallus gallus [bantam]
ref|XP_005016066.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   
gb|KFP38786.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Chlamydotis macqueenii
gb|KFQ20375.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Mesitornis unicolor
ref|XP_005421984.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   
gb|KFQ45813.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Nestor notabilis
ref|XP_010203293.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   1e-22   Colius striatus
gb|KFV39542.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Tyto alba [Schleiereule]
ref|XP_009951253.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   1e-22   Leptosomus discolor
gb|KFR08886.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Nipponia nippon
ref|XP_009986435.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Tauraco erythrolophus
ref|XP_009580499.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Fulmarus glacialis
ref|XP_009693369.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Cariama cristata
ref|XP_010007524.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   1e-22   Nestor notabilis
ref|XP_009808556.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Gavia stellata
ref|XP_010192463.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Mesitornis unicolor
gb|KFO81701.1|  Eukaryotic translation initiation factor 3 subunit L    104   1e-22   Cuculus canorus
ref|XP_009491962.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Pelecanus crispus
ref|XP_010409202.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Corvus cornix cornix
ref|XP_010171584.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   1e-22   Antrostomus carolinensis
dbj|BAG57085.1|  unnamed protein product                                101   1e-22   Homo sapiens [man]
ref|XP_010291773.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Phaethon lepturus
ref|XP_005232975.1|  PREDICTED: eukaryotic translation initiation...    105   1e-22   
ref|XP_010003703.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Chaetura pelagica
ref|XP_009566703.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Cuculus canorus
ref|XP_009074070.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Acanthisitta chloris
ref|XP_009288372.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Aptenodytes forsteri
ref|XP_003707707.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Megachile rotundata
ref|XP_010303092.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Balearica regulorum gibbericeps
ref|XP_009330944.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Pygoscelis adeliae
ref|XP_009964570.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Tyto alba [Schleiereule]
ref|XP_001601481.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Nasonia vitripennis
ref|XP_009874065.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   1e-22   Apaloderma vittatum
gb|KFM78528.1|  Eukaryotic translation initiation factor 3 subunit L    103   1e-22   Stegodyphus mimosarum
ref|XP_009936110.1|  PREDICTED: eukaryotic translation initiation...    104   1e-22   Opisthocomus hoazin [hoatzin]
ref|XP_009473560.1|  PREDICTED: eukaryotic translation initiation...    104   2e-22   Nipponia nippon
ref|XP_009880194.1|  PREDICTED: eukaryotic translation initiation...    104   2e-22   Charadrius vociferus
ref|XP_009501133.1|  PREDICTED: eukaryotic translation initiation...    104   2e-22   Phalacrocorax carbo [common cormorant]
ref|XP_010127677.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    104   2e-22   Chlamydotis macqueenii
dbj|BAE88430.1|  unnamed protein product                                102   2e-22   Macaca fascicularis [crab eating macaque]
ref|XP_004662214.1|  PREDICTED: eukaryotic translation initiation...    102   2e-22   
ref|XP_008177541.1|  PREDICTED: eukaryotic translation initiation...    103   2e-22   Chrysemys picta bellii
ref|XP_006724323.1|  PREDICTED: eukaryotic translation initiation...    103   2e-22   Homo sapiens [man]
ref|XP_001090065.1|  PREDICTED: eukaryotic translation initiation...    103   2e-22   
emb|CAG30322.1|  dJ1014D13.1                                            103   3e-22   Homo sapiens [man]
ref|XP_008567995.1|  PREDICTED: eukaryotic translation initiation...    103   3e-22   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003905570.1|  PREDICTED: eukaryotic translation initiation...    103   3e-22   Papio anubis [baboon]
dbj|BAG51631.1|  unnamed protein product                                103   3e-22   Homo sapiens [man]
ref|XP_006757481.1|  PREDICTED: eukaryotic translation initiation...    103   3e-22   Myotis davidii
gb|EHH20219.1|  hypothetical protein EGK_03027                          103   3e-22   Macaca mulatta [rhesus macaque]
ref|XP_006166301.1|  PREDICTED: eukaryotic translation initiation...    103   3e-22   
gb|EDL04675.1|  eukaryotic translation initiation factor 3, subun...    103   3e-22   Mus musculus [mouse]
ref|XP_006865333.1|  PREDICTED: eukaryotic translation initiation...    103   3e-22   Chrysochloris asiatica
ref|XP_008142863.1|  PREDICTED: eukaryotic translation initiation...    103   3e-22   Eptesicus fuscus
ref|NP_988980.1|  eukaryotic translation initiation factor 3 subu...    103   3e-22   Xenopus tropicalis [western clawed frog]
pdb|3J8B|L  Chain L, Model Of The Human Eif3 Pci-mpn Octamer Dock...    103   3e-22   Homo sapiens [man]
gb|EFB26726.1|  hypothetical protein PANDA_002501                       103   3e-22   Ailuropoda melanoleuca
emb|CAC84554.1|  67 kDa polymerase-associated factor PAF67              103   3e-22   Mus musculus [mouse]
ref|XP_007069166.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   
ref|XP_004065481.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    103   4e-22   
dbj|BAE40238.1|  unnamed protein product                                103   4e-22   Mus musculus [mouse]
ref|NP_660121.2|  eukaryotic translation initiation factor 3 subu...    103   4e-22   Mus musculus [mouse]
ref|XP_008849507.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   
ref|XP_005379287.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Chinchilla lanigera
ref|XP_004373903.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Trichechus manatus latirostris
ref|XP_001514662.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001128679.1|  eukaryotic translation initiation factor 3 s...    103   4e-22   Pan troglodytes
gb|KIY69436.1|  hypothetical protein CYLTODRAFT_420727                  103   4e-22   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_003821622.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Pan paniscus [bonobo]
ref|XP_010611532.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Fukomys damarensis [Damara mole rat]
ref|XP_003989299.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Felis catus [cat]
ref|XP_003510323.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Cricetulus griseus [Chinese hamsters]
ref|XP_002743807.2|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Callithrix jacchus [common marmoset]
gb|EDM15826.1|  eukaryotic translation initiation factor 3, subun...    103   4e-22   Rattus norvegicus [brown rat]
ref|NP_001238869.1|  eukaryotic translation initiation factor 3, ...    103   4e-22   Canis lupus familiaris [dogs]
ref|XP_007519391.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Erinaceus europaeus [common hedgehog]
ref|XP_005883277.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Myotis brandtii
ref|XP_004700301.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004610560.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Sorex araneus [Eurasian shrew]
ref|XP_004437897.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003772386.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Sarcophilus harrisii
ref|XP_003470527.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Cavia porcellus [guinea pig]
dbj|BAD96216.1|  eukaryotic translation initiation factor 3 subun...    103   4e-22   Homo sapiens [man]
ref|NP_057175.1|  eukaryotic translation initiation factor 3 subu...    103   4e-22   Homo sapiens [man]
ref|XP_001365166.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Monodelphis domestica
dbj|BAD96249.1|  eukaryotic translation initiation factor 3 subun...    103   4e-22   Homo sapiens [man]
ref|XP_006026013.1|  PREDICTED: eukaryotic translation initiation...    103   4e-22   Alligator sinensis
gb|AAQ13507.1|AF109359_1  MSTP005                                       103   4e-22   Homo sapiens [man]
gb|EHH65826.1|  hypothetical protein EGM_02673                          103   4e-22   Macaca fascicularis [crab eating macaque]
ref|XP_003804137.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    103   5e-22   
ref|XP_011147809.1|  PREDICTED: eukaryotic translation initiation...    102   5e-22   Harpegnathos saltator
ref|XP_010611524.1|  PREDICTED: eukaryotic translation initiation...    103   5e-22   Fukomys damarensis [Damara mole rat]
ref|XP_004743258.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    103   5e-22   
ref|XP_004786999.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    103   6e-22   
ref|XP_006677453.1|  hypothetical protein BATDEDRAFT_34692              102   7e-22   Batrachochytrium dendrobatidis JAM81
ref|NP_001080345.1|  eukaryotic translation initiation factor 3 s...    102   7e-22   Xenopus laevis [clawed frog]
gb|ELK35000.1|  Eukaryotic translation initiation factor 3 subunit L    102   7e-22   Myotis davidii
gb|EMP27035.1|  Eukaryotic translation initiation factor 3 subunit L    103   7e-22   Chelonia mydas [green seaturtle]
dbj|BAE39691.1|  unnamed protein product                                102   9e-22   Mus musculus [mouse]
gb|ELV11710.1|  Eukaryotic translation initiation factor 3 subunit L    103   1e-21   Tupaia chinensis
gb|EFX81880.1|  hypothetical protein DAPPUDRAFT_223934                  102   1e-21   Daphnia pulex
ref|XP_010583751.1|  PREDICTED: eukaryotic translation initiation...    101   1e-21   Haliaeetus leucocephalus
ref|XP_007165699.1|  PREDICTED: eukaryotic translation initiation...    101   1e-21   Balaenoptera acutorostrata scammoni
gb|KFP94178.1|  Eukaryotic translation initiation factor 3 subunit L    101   2e-21   Haliaeetus albicilla
ref|XP_005681118.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|XP_009917022.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   Haliaeetus albicilla
ref|XP_010843384.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|NP_001030373.1|  eukaryotic translation initiation factor 3 s...    101   2e-21   
ref|XP_005955681.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|XP_004007031.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|XP_006890191.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
gb|EPY88367.1|  eukaryotic translation initiation factor 3 subunit L    101   2e-21   
ref|XP_008118509.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|XP_007872226.1|  hypothetical protein PNEG_00353                    100   2e-21   
ref|XP_004312203.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|NP_648553.1|  CG5642                                                100   2e-21   
ref|XP_002723576.1|  PREDICTED: eukaryotic translation initiation...    101   2e-21   
ref|XP_002476968.1|  predicted protein                                96.7    3e-21   
ref|XP_008494724.1|  PREDICTED: eukaryotic translation initiation...    100   4e-21   
gb|KFO95955.1|  Eukaryotic translation initiation factor 3 subunit L    100   4e-21   
ref|XP_006119038.1|  PREDICTED: eukaryotic translation initiation...    100   4e-21   
ref|XP_006638823.1|  PREDICTED: eukaryotic translation initiation...    100   4e-21   
ref|XP_010781725.1|  PREDICTED: eukaryotic translation initiation...    100   4e-21   
gb|KDQ16687.1|  hypothetical protein BOTBODRAFT_186346                  100   4e-21   
ref|XP_002094551.1|  GE20146                                            100   4e-21   
ref|XP_001972502.1|  GG13851                                            100   5e-21   
ref|XP_002156786.1|  PREDICTED: eukaryotic translation initiation...  99.8    5e-21   
emb|CAG04740.1|  unnamed protein product                                100   5e-21   
ref|XP_004883512.1|  PREDICTED: eukaryotic translation initiation...    100   5e-21   
gb|KDN52505.1|  hypothetical protein K437DRAFT_254088                   100   6e-21   
ref|XP_004334134.1|  eukaryotic translation initiation factor 3 s...  99.8    6e-21   
ref|XP_624438.1|  PREDICTED: eukaryotic translation initiation fa...  99.8    6e-21   
ref|XP_003398805.1|  PREDICTED: eukaryotic translation initiation...  99.8    6e-21   
ref|NP_001231015.1|  eukaryotic translation initiation factor 3 s...  99.8    8e-21   
ref|XP_002030238.1|  GM24677                                          99.4    8e-21   
gb|KFB42215.1|  AGAP006130-PA-like protein                            99.4    9e-21   
gb|EMS65810.1|  hypothetical protein TRIUR3_05807                       100   9e-21   
ref|XP_008041424.1|  eukaryotic translation initiation factor 3 s...  99.8    9e-21   
ref|XP_502363.1|  YALI0D03399p                                        99.0    9e-21   
ref|XP_006068075.1|  PREDICTED: eukaryotic translation initiation...    100   1e-20   
gb|KDR15818.1|  Eukaryotic translation initiation factor 3 subunit L  99.4    1e-20   
gb|EJT99664.1|  hypothetical protein DACRYDRAFT_69406                 99.0    1e-20   
ref|XP_007363371.1|  eukaryotic translation initiation factor 3 s...  99.0    2e-20   
emb|CDQ84343.1|  unnamed protein product                              98.6    2e-20   
ref|NP_001167411.1|  Eukaryotic translation initiation factor 3 s...  98.6    2e-20   
ref|XP_006799034.1|  PREDICTED: eukaryotic translation initiation...  98.6    2e-20   
gb|KDQ23325.1|  hypothetical protein PLEOSDRAFT_1059518               99.0    2e-20   
ref|XP_316190.3|  AGAP006130-PA                                       98.2    2e-20   
ref|XP_008283532.1|  PREDICTED: eukaryotic translation initiation...  98.6    2e-20   
ref|XP_007238562.1|  PREDICTED: eukaryotic translation initiation...  98.6    2e-20   
ref|XP_005927170.1|  PREDICTED: eukaryotic translation initiation...  98.2    2e-20   
ref|XP_004559734.1|  PREDICTED: eukaryotic translation initiation...  98.2    2e-20   
ref|XP_003441099.1|  PREDICTED: eukaryotic translation initiation...  98.2    2e-20   
emb|CDO75286.1|  hypothetical protein BN946_scf184334.g4              98.6    2e-20   
dbj|BAM18026.1|  eukaryotic translation initiation factor 3 subun...  98.2    2e-20   
ref|XP_010897229.1|  PREDICTED: eukaryotic translation initiation...  98.2    2e-20   
ref|NP_998293.1|  eukaryotic translation initiation factor 3 subu...  98.2    3e-20   
ref|XP_011310320.1|  PREDICTED: eukaryotic translation initiation...  98.2    3e-20   
gb|KDE08021.1|  hypothetical protein MVLG_01723                       98.2    3e-20   
ref|XP_010737501.1|  PREDICTED: eukaryotic translation initiation...  98.2    3e-20   
gb|KIP11312.1|  hypothetical protein PHLGIDRAFT_28012                 98.2    3e-20   
ref|XP_005806164.1|  PREDICTED: eukaryotic translation initiation...  98.2    3e-20   
ref|XP_002007366.1|  GI12903                                          97.8    3e-20   
ref|XP_007579317.1|  PREDICTED: eukaryotic translation initiation...  97.8    3e-20   
ref|NP_001279102.1|  eukaryotic translation initiation factor 3, ...  97.8    3e-20   
gb|AFK10695.1|  Eukaryotic translation initiation factor 3 subunit L  97.8    4e-20   
ref|XP_008428313.1|  PREDICTED: eukaryotic translation initiation...  97.8    4e-20   
ref|XP_001851152.1|  eukaryotic translation initiation factor 3       97.4    4e-20   
gb|KIM54748.1|  hypothetical protein SCLCIDRAFT_1221767               98.2    4e-20   
ref|XP_002065918.1|  GK20774                                          97.4    4e-20   
ref|XP_004077546.1|  PREDICTED: eukaryotic translation initiation...  97.8    4e-20   
emb|CDQ66978.1|  unnamed protein product                              98.2    4e-20   
gb|KIO11562.1|  hypothetical protein M404DRAFT_994309                 97.4    6e-20   
ref|XP_008325793.1|  PREDICTED: eukaryotic translation initiation...  97.1    6e-20   
ref|XP_002046733.1|  GJ13043                                          97.1    6e-20   
ref|XP_003963717.1|  PREDICTED: eukaryotic translation initiation...  97.1    7e-20   
ref|XP_007387310.1|  eukaryotic translation initiation factor 3 s...  97.1    8e-20   
gb|ADQ64554.1|  hypothetical protein                                  93.2    9e-20   
ref|XP_009493711.1|  hypothetical protein H696_01539                  96.7    9e-20   
ref|XP_008544466.1|  PREDICTED: eukaryotic translation initiation...  96.3    1e-19   
ref|XP_001649423.1|  AAEL014715-PA                                    96.3    1e-19   
gb|KII85604.1|  hypothetical protein PLICRDRAFT_44932                 96.7    1e-19   
gb|KIK26199.1|  hypothetical protein PISMIDRAFT_676352                96.7    1e-19   
gb|KJA17217.1|  hypothetical protein HYPSUDRAFT_146790                96.7    1e-19   
gb|EMD36536.1|  hypothetical protein CERSUDRAFT_106375                96.3    1e-19   
gb|EPT04825.1|  hypothetical protein FOMPIDRAFT_1112341               96.3    1e-19   
gb|KIM43598.1|  hypothetical protein M413DRAFT_443513                 95.9    2e-19   
gb|KIK96620.1|  hypothetical protein PAXRUDRAFT_825766                96.3    2e-19   
ref|XP_007774424.1|  eukaryotic translation initiation factor 3 s...  95.9    2e-19   
gb|KIM76905.1|  hypothetical protein PILCRDRAFT_825908                95.9    2e-19   
ref|XP_001732666.1|  hypothetical protein MGL_0441                    95.1    2e-19   
emb|CCM04357.1|  predicted protein                                    95.5    2e-19   
ref|XP_001983909.1|  GH15308                                          95.1    3e-19   
ref|XP_007323294.1|  hypothetical protein SERLADRAFT_478264           95.1    3e-19   
gb|KIK42865.1|  hypothetical protein CY34DRAFT_804438                 95.1    3e-19   
gb|KDR70267.1|  hypothetical protein GALMADRAFT_255163                95.1    4e-19   
ref|XP_007354304.1|  hypothetical protein AURDEDRAFT_116753           94.7    4e-19   
ref|XP_009552883.1|  hypothetical protein HETIRDRAFT_482200           94.7    5e-19   
gb|ETN59043.1|  eukaryotic translation initiation factor 3            94.4    6e-19   
ref|XP_007878016.1|  hypothetical protein PFL1_02313                  94.7    6e-19   
ref|XP_001956027.1|  GF25000                                          94.4    6e-19   
gb|KIJ56384.1|  hypothetical protein M422DRAFT_73174                  94.4    6e-19   
ref|XP_003338166.2|  hypothetical protein PGTG_19774                  94.7    6e-19   
ref|XP_011204641.1|  PREDICTED: eukaryotic translation initiation...  94.0    7e-19   
ref|XP_007306770.1|  hypothetical protein STEHIDRAFT_62056            94.4    7e-19   
gb|KIJ98955.1|  hypothetical protein K443DRAFT_680315                 94.4    7e-19   
gb|KDQ52880.1|  hypothetical protein JAAARDRAFT_197946                94.4    7e-19   
ref|XP_007870028.1|  hypothetical protein GLOTRDRAFT_112411           94.4    8e-19   
ref|XP_971137.1|  PREDICTED: eukaryotic translation initiation fa...  93.6    9e-19   
ref|XP_001889536.1|  predicted protein                                93.6    1e-18   
gb|AEE63367.1|  unknown                                               93.2    2e-18   
ref|XP_007397985.1|  hypothetical protein PHACADRAFT_259556           93.2    2e-18   
gb|KIJ12736.1|  hypothetical protein PAXINDRAFT_156845                93.2    2e-18   
ref|XP_001835038.1|  eukaryotic translation initiation factor 3 s...  93.2    2e-18   
gb|ADO33009.1|  eukaryotic translation initiation factor 3 subunit L  92.8    2e-18   
ref|XP_007407064.1|  hypothetical protein MELLADRAFT_47280            93.2    2e-18   
ref|XP_007855427.1|  eukaryotic translation initiation factor 3 s...  92.8    2e-18   
emb|CBQ70634.1|  conserved hypothetical protein                       93.2    2e-18   
ref|XP_011189020.1|  PREDICTED: eukaryotic translation initiation...  92.4    2e-18   
gb|KIR46306.1|  eukaryotic translation initiation factor 3 subunit L  92.8    2e-18   
gb|KIR85248.1|  eukaryotic translation initiation factor 3 subunit L  92.8    2e-18   
ref|XP_003193348.1|  eukaryotic translation initiation factor 3 s...  92.8    2e-18   
gb|KIS02399.1|  eukaryotic translation initiation factor 3 subunit L  92.8    2e-18   
gb|KGB78747.1|  eukaryotic translation initiation factor 3 subunit 6  92.8    3e-18   
gb|KFP10230.1|  Eukaryotic translation initiation factor 3 subunit L  91.7    3e-18   
gb|EST06180.1|  hypothetical protein PSEUBRA_SCAF3g03686              92.8    3e-18   
gb|KIR59609.1|  eukaryotic translation initiation factor 3 subunit L  92.8    3e-18   
dbj|GAK63125.1|  eukaryotic translation initiation factor 3 subun...  92.8    3e-18   
gb|ETS60939.1|  hypothetical protein PaG_04865                        92.8    3e-18   
emb|CCF54420.1|  uncharacterized protein UHOR_01850                   92.4    3e-18   
ref|XP_568056.1|  Eukaryotic translation initiation factor 3 subu...  92.4    3e-18   
gb|AFR94370.1|  translation initiation factor 3 subunit L             92.4    3e-18   
dbj|GAC72556.1|  hypothetical protein PANT_7d00160                    92.4    3e-18   
ref|XP_773551.1|  hypothetical protein CNBI1650                       92.4    3e-18   
ref|XP_009860082.1|  PREDICTED: eukaryotic translation initiation...  89.7    3e-18   
ref|XP_001951507.1|  PREDICTED: eukaryotic translation initiation...  91.7    4e-18   
dbj|GAC97023.1|  hypothetical protein PHSY_004607                     92.0    4e-18   
gb|ENN76019.1|  hypothetical protein YQE_07396                        92.8    5e-18   
gb|EMS25206.1|  eukaryotic translation initiation factor 3 subunit L  91.7    5e-18   
ref|XP_009513941.1|  hypothetical protein PHYSODRAFT_551923           91.3    5e-18   
gb|ETP45500.1|  hypothetical protein F442_08111                       91.3    5e-18   
ref|XP_008904925.1|  hypothetical protein PPTG_11378                  90.9    6e-18   
ref|XP_002896755.1|  eukaryotic translation initiation factor 3 s...  90.9    6e-18   
ref|XP_003026666.1|  hypothetical protein SCHCODRAFT_70999            91.7    6e-18   
ref|XP_006456128.1|  hypothetical protein AGABI2DRAFT_195366          91.7    6e-18   
ref|XP_007331552.1|  hypothetical protein AGABI1DRAFT_114981          91.7    6e-18   
ref|XP_009646036.1|  PREDICTED: eukaryotic translation initiation...  90.9    6e-18   
ref|XP_001353350.1|  GA19025                                          91.3    7e-18   
ref|XP_002021092.1|  GL25016                                          91.3    7e-18   
emb|CCI41645.1|  unnamed protein product                              92.4    7e-18   
gb|ACN94772.1|  GA19025                                               91.3    7e-18   
ref|XP_011387162.1|  hypothetical protein UMAG_01228                  91.7    7e-18   
ref|XP_007261852.1|  eukaryotic translation initiation factor 3 s...  91.3    7e-18   
gb|ETK87591.1|  hypothetical protein L915_07997                       90.9    8e-18   
gb|ETL41039.1|  hypothetical protein L916_07920                       90.5    8e-18   
ref|XP_004519066.1|  PREDICTED: eukaryotic translation initiation...  90.5    1e-17   
gb|KIL62792.1|  hypothetical protein M378DRAFT_80673                  90.9    1e-17   
ref|XP_004634659.1|  PREDICTED: eukaryotic translation initiation...  90.5    1e-17   
emb|CCA22083.1|  eukaryotic translation initiation factor 3 subun...  90.9    1e-17   
ref|XP_004650653.1|  PREDICTED: eukaryotic translation initiation...  90.1    1e-17   
ref|XP_003082144.1|  RNA polymerase I-associated factor-PAF67 (ISS)   89.7    1e-17   
ref|XP_005718965.1|  Translation initiation factor eIF3, subunit L    89.7    2e-17   
dbj|GAA98241.1|  hypothetical protein E5Q_04924                       90.1    2e-17   
gb|KIJ60780.1|  hypothetical protein HYDPIDRAFT_43113                 87.8    3e-17   
emb|CDI52166.1|  related to eIF3l-translation initiation factor 3...  89.7    3e-17   
ref|XP_007003346.1|  hypothetical protein TREMEDRAFT_43212            89.7    3e-17   
gb|EGU12444.1|  Eukaryotic translation initiation factor 3 subunit L  90.5    3e-17   
emb|CCA69627.1|  probable eukaryotic translation initiation facto...  89.4    4e-17   
ref|XP_002120603.1|  PREDICTED: eukaryotic translation initiation...  89.0    4e-17   
gb|EJT45214.1|  eukaryotic translation initiation factor 3 subunit 6  89.0    5e-17   
gb|KIM22893.1|  hypothetical protein M408DRAFT_332664                 89.0    6e-17   
ref|XP_008607788.1|  hypothetical protein SDRG_03919                  87.8    7e-17   
gb|EJW86353.1|  eukaryotic translation initiation factor 3 subunit L  86.3    7e-17   
gb|KIY52190.1|  hypothetical protein FISHEDRAFT_35668                 87.8    1e-16   
ref|XP_009834418.1|  hypothetical protein, variant                    85.9    1e-16   
gb|EKD00556.1|  eukaryotic translation initiation factor 3 subunit 6  88.2    1e-16   
emb|CDR45882.1|  CYFA0S20e01266g1_1                                   87.0    2e-16   
gb|ERG82893.1|  eukaryotic translation initiation factor 3 subunit l  87.0    2e-16   
gb|KDN37504.1|  hypothetical protein RSAG8_10103                      87.0    2e-16   
ref|XP_011295894.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  86.7    2e-16   
gb|KDO25740.1|  hypothetical protein SPRG_09039                       86.3    2e-16   
ref|XP_009834417.1|  hypothetical protein H257_09764                  86.3    2e-16   
ref|XP_003136188.1|  eukaryotic translation initiation factor 3 s...  86.7    3e-16   
emb|CDQ01157.1|  Protein Bm2278, isoform c                            86.3    3e-16   
emb|CBY18339.1|  unnamed protein product                              85.9    4e-16   
emb|CEL54771.1|  Eukaryotic translation initiation factor 3 subun...  86.3    4e-16   
gb|EUC55025.1|  eukaryotic translation initiation factor 3 subunit L  85.5    7e-16   
gb|KEP45784.1|  eukaryotic translation initiation factor 3 subunit L  85.5    8e-16   
emb|CDS30484.1|  eukaryotic translation initiation factor 3           85.1    8e-16   
emb|CDJ06188.1|  eukaryotic translation initiation factor 3           85.1    9e-16   
gb|EUB60017.1|  Eukaryotic translation initiation factor 3 subunit L  85.1    9e-16   
gb|AAX27774.2|  SJCHGC05529 protein                                   81.3    2e-15   
ref|XP_008876128.1|  hypothetical protein H310_11299                  84.0    2e-15   
gb|KIK62547.1|  hypothetical protein GYMLUDRAFT_42013                 84.0    3e-15   
emb|CCD80123.1|  hypothetical protein Smp_064530                      80.9    3e-15   
gb|KHN75659.1|  Eukaryotic translation initiation factor 3 subunit L  83.2    4e-15   
emb|CAX74532.1|  Eukaryotic translation initiation factor 3 subun...  82.8    5e-15   
emb|CAX74530.1|  Eukaryotic translation initiation factor 3 subun...  82.8    5e-15   
ref|XP_005039810.1|  PREDICTED: eukaryotic translation initiation...  82.4    7e-15   
ref|XP_005322487.1|  PREDICTED: eukaryotic translation initiation...  80.9    1e-14   
ref|XP_001896613.1|  hypothetical protein                             81.3    2e-14   
emb|CAX74531.1|  Eukaryotic translation initiation factor 3 subun...  81.3    2e-14   
ref|XP_005488658.1|  PREDICTED: eukaryotic translation initiation...  81.3    2e-14   
ref|XP_005150418.1|  PREDICTED: eukaryotic translation initiation...  81.3    2e-14   
ref|XP_003932927.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
dbj|BAG63674.1|  unnamed protein product                              80.9    2e-14   
ref|XP_009566704.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_007519392.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_004700302.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_004373901.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|NP_001229852.1|  eukaryotic translation initiation factor 3 s...  80.9    2e-14   
ref|XP_003364345.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_005883276.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_004437898.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_004610559.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_005379288.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_005067033.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_003470528.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_003772387.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_006026014.1|  PREDICTED: eukaryotic translation initiation...  79.3    7e-14   
ref|XP_005681119.1|  PREDICTED: eukaryotic translation initiation...  79.3    7e-14   
ref|XP_005955682.1|  PREDICTED: eukaryotic translation initiation...  79.3    8e-14   
ref|XP_006890192.1|  PREDICTED: eukaryotic translation initiation...  79.3    8e-14   
ref|XP_004007032.1|  PREDICTED: eukaryotic translation initiation...  79.0    8e-14   
ref|XP_005663841.1|  PREDICTED: eukaryotic translation initiation...  79.0    8e-14   
ref|XP_004279516.1|  PREDICTED: eukaryotic translation initiation...  79.0    9e-14   
ref|XP_005818635.1|  hypothetical protein GUITHDRAFT_149171           74.7    1e-13   



>ref|XP_009595011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L {ECO:0000255|HAMAP-Rule:MF_03011}-like [Nicotiana tomentosiformis]
 ref|XP_009782140.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Nicotiana sylvestris]
Length=517

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 5/130 (4%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA SY+YEDG +   QQ  DS+   YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYE+
Sbjct  1    MAASYEYEDGGF---QQQPDSA--GYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYES  55

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSERMFK+TPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  56   SFQTLSERMFKETPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  115

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  116  YCSLFQVVLH  125



>ref|XP_006366213.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Solanum tuberosum]
Length=517

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 5/130 (4%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA  Y+YE+G Y    Q +D+    YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYET
Sbjct  1    MAAPYEYEEGGYP---QQTDAV--GYDPNFVPDSVKSFVAHLYRHIREKNVYEIHQMYET  55

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSERMFK+TPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTL+QRIDSWDN
Sbjct  56   SFQTLSERMFKETPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLRQRIDSWDN  115

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  116  YCSLFQVVLH  125



>emb|CDP16167.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 114/130 (88%), Gaps = 4/130 (3%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA  YDYEDG     QQ S     SYDP++VPDPVKSFV HLYRHIREKNVYEIHQMYE 
Sbjct  1    MAMPYDYEDGH----QQQSGPDSLSYDPSFVPDPVKSFVVHLYRHIREKNVYEIHQMYEN  56

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSERMFKD PWPSVDAVAP+VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  57   SFQTLSERMFKDVPWPSVDAVAPFVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  116

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  117  YCSLFQVVLH  126



>ref|XP_004245267.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Solanum lycopersicum]
Length=517

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 5/130 (4%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA  Y+YE+G Y    Q +D+    YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYET
Sbjct  1    MAAPYEYEEGGYP---QETDAV--GYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYET  55

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSERMFK+TPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTL+QRIDSWDN
Sbjct  56   SFQTLSERMFKETPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLRQRIDSWDN  115

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  116  YCSLFQVVLH  125



>ref|XP_007012067.1| RNA polymerase I-associated factor PAF67 isoform 5 [Theobroma 
cacao]
 gb|EOY29686.1| RNA polymerase I-associated factor PAF67 isoform 5 [Theobroma 
cacao]
Length=409

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MAT+YDYE+   +  + H       YDPN+VPD VKSFVGHLYRHIREKNVYEIHQMYE 
Sbjct  1    MATNYDYEEAPANYDETHRQDL--GYDPNFVPDSVKSFVGHLYRHIREKNVYEIHQMYEI  58

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  59   SFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  118

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  119  YCSLFQVVLH  128



>ref|XP_002535481.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26902.1| conserved hypothetical protein [Ricinus communis]
Length=347

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 116/136 (85%), Gaps = 6/136 (4%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSD--SSLE----SYDPNYVPDPVKSFVGHLYRHIREKNVYEI  337
            M+ +YDY+D +    + + D  S  +     YDPNYVPD VKSFV HLYRHIREKNVYEI
Sbjct  1    MSATYDYDDTTGGAGRSNYDEQSGFQRQELGYDPNYVPDSVKSFVVHLYRHIREKNVYEI  60

Query  338  HQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQR  517
            HQMYETSFQ+LSER+FK+TPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQR
Sbjct  61   HQMYETSFQTLSERLFKETPWPSVDAVAHYVDNDHVFCLLYREMWFRHLYARLSPTLKQR  120

Query  518  IDSWDNYCNLFQVVLH  565
            IDSWDNYC+LFQVVLH
Sbjct  121  IDSWDNYCSLFQVVLH  136



>ref|XP_007012066.1| RNA polymerase I-associated factor PAF67 isoform 4 [Theobroma 
cacao]
 gb|EOY29685.1| RNA polymerase I-associated factor PAF67 isoform 4 [Theobroma 
cacao]
Length=463

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MAT+YDYE+   +  + H       YDPN+VPD VKSFVGHLYRHIREKNVYEIHQMYE 
Sbjct  1    MATNYDYEEAPANYDETHRQDL--GYDPNFVPDSVKSFVGHLYRHIREKNVYEIHQMYEI  58

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  59   SFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  118

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  119  YCSLFQVVLH  128



>ref|XP_007012064.1| RNA polymerase I-associated factor PAF67 isoform 2, partial [Theobroma 
cacao]
 gb|EOY29683.1| RNA polymerase I-associated factor PAF67 isoform 2, partial [Theobroma 
cacao]
Length=497

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MAT+YDYE+   +  + H       YDPN+VPD VKSFVGHLYRHIREKNVYEIHQMYE 
Sbjct  1    MATNYDYEEAPANYDETHRQDL--GYDPNFVPDSVKSFVGHLYRHIREKNVYEIHQMYEI  58

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  59   SFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  118

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  119  YCSLFQVVLH  128



>ref|XP_007012063.1| RNA polymerase I-associated factor PAF67 isoform 1 [Theobroma 
cacao]
 gb|EOY29682.1| RNA polymerase I-associated factor PAF67 isoform 1 [Theobroma 
cacao]
Length=520

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MAT+YDYE+   +  + H       YDPN+VPD VKSFVGHLYRHIREKNVYEIHQMYE 
Sbjct  1    MATNYDYEEAPANYDETHRQDL--GYDPNFVPDSVKSFVGHLYRHIREKNVYEIHQMYEI  58

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  59   SFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  118

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  119  YCSLFQVVLH  128



>ref|XP_007012065.1| RNA polymerase I-associated factor PAF67 isoform 3 [Theobroma 
cacao]
 gb|EOY29684.1| RNA polymerase I-associated factor PAF67 isoform 3 [Theobroma 
cacao]
Length=519

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MAT+YDYE+   +  + H       YDPN+VPD VKSFVGHLYRHIREKNVYEIHQMYE 
Sbjct  1    MATNYDYEEAPANYDETHRQDL--GYDPNFVPDSVKSFVGHLYRHIREKNVYEIHQMYEI  58

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  59   SFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  118

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  119  YCSLFQVVLH  128



>ref|XP_002308615.2| hypothetical protein POPTR_0006s25800g [Populus trichocarpa]
 gb|EEE92138.2| hypothetical protein POPTR_0006s25800g [Populus trichocarpa]
Length=519

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA SYDYED   +  +   ++  + YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYET
Sbjct  1    MAASYDYED---APSRHDEETGPQGYDPNFVPDSVKSFVTHLYRHIREKNVYEIHQMYET  57

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+ +FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  58   SFQTLSDHLFKDTPWPSVDAVANYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  117

Query  536  YCNLFQVVLH  565
            YC LFQVVLH
Sbjct  118  YCGLFQVVLH  127



>ref|XP_011019644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Populus euphratica]
Length=519

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 3/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA SYDYED   +  +   ++  + YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYET
Sbjct  1    MAASYDYED---APSRYDEETGPQGYDPNFVPDSVKSFVTHLYRHIREKNVYEIHQMYET  57

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+ +FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  58   SFQTLSDHLFKDTPWPSVDAVANYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  117

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  118  YCSLFQVVLH  127



>ref|XP_011026651.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Populus euphratica]
Length=456

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 5/134 (4%)
 Frame = +2

Query  167  TSTMATSYDYEDGSYSTKQQHSD-SSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQ  343
            ++TMAT++DY+D       +H + + L+ YDPN+VPD VKSFV HLYRHIREKNVY+I++
Sbjct  9    STTMATTFDYDDAP----SRHDELTGLDGYDPNFVPDSVKSFVTHLYRHIREKNVYDIYE  64

Query  344  MYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRID  523
            MYETSFQ+LS+R FKD PWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQRID
Sbjct  65   MYETSFQTLSDRFFKDIPWPSVDAVANYVDNDHVFCLLYREMWFRHLYARLSPTLKQRID  124

Query  524  SWDNYCNLFQVVLH  565
            SWDNYC+LFQVVLH
Sbjct  125  SWDNYCSLFQVVLH  138



>ref|XP_006450640.1| hypothetical protein CICLE_v10007989mg [Citrus clementina]
 ref|XP_006476083.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Citrus sinensis]
 gb|ESR63880.1| hypothetical protein CICLE_v10007989mg [Citrus clementina]
 gb|KDO79737.1| hypothetical protein CISIN_1g009775mg [Citrus sinensis]
Length=526

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 113/135 (84%), Gaps = 9/135 (7%)
 Frame = +2

Query  179  ATSYDYED------GSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIH  340
            A SYDYED      GS   +    D     YDPN+VPD VKSFV HLYRHIREKNVYEIH
Sbjct  3    AASYDYEDAPADYDGSADARASSQDLG---YDPNFVPDSVKSFVVHLYRHIREKNVYEIH  59

Query  341  QMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRI  520
            QMYETSFQSLS+R+FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQRI
Sbjct  60   QMYETSFQSLSDRLFKDTPWPSVDAVAHYVDNDHVFCLLYREMWFRHLYARLSPTLKQRI  119

Query  521  DSWDNYCNLFQVVLH  565
            DSWDNYC+LFQVVLH
Sbjct  120  DSWDNYCSLFQVVLH  134



>ref|XP_007222482.1| hypothetical protein PRUPE_ppa004079mg [Prunus persica]
 gb|EMJ23681.1| hypothetical protein PRUPE_ppa004079mg [Prunus persica]
Length=531

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 10/138 (7%)
 Frame = +2

Query  182  TSYDYED--GSY----STKQQHSDSSLES----YDPNYVPDPVKSFVGHLYRHIREKNVY  331
             +YDYED  G+Y    +T++Q S  +  S    YDPN+VPD VKSFV HLYRHIREKNVY
Sbjct  2    AAYDYEDAPGTYDETSATQRQASSGAPPSQDLGYDPNFVPDSVKSFVVHLYRHIREKNVY  61

Query  332  EIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLK  511
            EIHQMYETSFQ+LS+R+FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLK
Sbjct  62   EIHQMYETSFQTLSDRLFKDTPWPSVDAVAHYVDNDHVFCLLYREMWFRHLYARLSPTLK  121

Query  512  QRIDSWDNYCNLFQVVLH  565
            QRIDSWDNYC+LFQVVLH
Sbjct  122  QRIDSWDNYCSLFQVVLH  139



>ref|XP_008220046.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Prunus mume]
Length=531

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 119/138 (86%), Gaps = 10/138 (7%)
 Frame = +2

Query  182  TSYDYED--GSY----STKQQHSDSSLES----YDPNYVPDPVKSFVGHLYRHIREKNVY  331
             +YDYED  G+Y    +T++Q S  +  S    YDPN+VPD VKSFV HLYRHIREKNVY
Sbjct  2    AAYDYEDAPGTYDETSATQRQASSGAPPSQDLGYDPNFVPDSVKSFVVHLYRHIREKNVY  61

Query  332  EIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLK  511
            EIHQMYETSFQ+LS+R+FKDTPWPSVDAVA Y+DNDHVFCLLYREMWFRHLYARLSPTLK
Sbjct  62   EIHQMYETSFQTLSDRLFKDTPWPSVDAVAHYIDNDHVFCLLYREMWFRHLYARLSPTLK  121

Query  512  QRIDSWDNYCNLFQVVLH  565
            QRIDSWDNYC+LFQVVLH
Sbjct  122  QRIDSWDNYCSLFQVVLH  139



>ref|XP_002324243.1| hypothetical protein POPTR_0018s00670g [Populus trichocarpa]
 gb|EEF02808.1| hypothetical protein POPTR_0018s00670g [Populus trichocarpa]
Length=519

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 3/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MAT+YDY+D      +Q   +  + YDPN+VPD VKSFV HLYRHIREKNVY+I++MYET
Sbjct  1    MATTYDYDDAPTRHDEQ---TGPDGYDPNFVPDSVKSFVTHLYRHIREKNVYDIYEMYET  57

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R FKD+PWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN
Sbjct  58   SFQTLSDRFFKDSPWPSVDAVANYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  117

Query  536  YCNLFQVVLH  565
            YCNLFQVVLH
Sbjct  118  YCNLFQVVLH  127



>ref|XP_006394822.1| hypothetical protein EUTSA_v10003996mg [Eutrema salsugineum]
 gb|ESQ32108.1| hypothetical protein EUTSA_v10003996mg [Eutrema salsugineum]
Length=523

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 3/132 (2%)
 Frame = +2

Query  176  MATSYDYEDG--SYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA++YD+ED   +Y   Q+ S     +YDPN+VPD VKSFV H+YRHIREKNVYEIHQM 
Sbjct  1    MASNYDFEDAPANYDDSQRQSGQD-TAYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMC  59

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            ETSFQ+LSER+FKDTPWP V+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+
Sbjct  60   ETSFQTLSERLFKDTPWPCVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSY  119

Query  530  DNYCNLFQVVLH  565
            DNYC+LFQVVLH
Sbjct  120  DNYCSLFQVVLH  131



>ref|XP_008347630.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Malus domestica]
Length=412

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 119/137 (87%), Gaps = 9/137 (7%)
 Frame = +2

Query  182  TSYDYED-GSY----STKQQHSD----SSLESYDPNYVPDPVKSFVGHLYRHIREKNVYE  334
             +YDY+D G+Y    +T++Q S     SS   YDPN+VPD VKSFV HLYR+IREKNVYE
Sbjct  2    AAYDYDDAGTYDETSATQRQPSSGAPPSSDLGYDPNFVPDSVKSFVVHLYRYIREKNVYE  61

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  514
            IHQMYETSFQ+LS+R+FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQ
Sbjct  62   IHQMYETSFQTLSDRLFKDTPWPSVDAVADYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  121

Query  515  RIDSWDNYCNLFQVVLH  565
            RIDSWDNYC+LFQVVLH
Sbjct  122  RIDSWDNYCSLFQVVLH  138



>ref|XP_011090287.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L-like [Sesamum indicum]
Length=510

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/105 (93%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +2

Query  251  YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            YDPNYVPD VKSFV H+YRHIREKNVYEIHQMYETSFQS+S+R FKD PWPSVDAVAPYV
Sbjct  19   YDPNYVPDSVKSFVVHMYRHIREKNVYEIHQMYETSFQSISDRFFKDAPWPSVDAVAPYV  78

Query  431  DNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            DNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH
Sbjct  79   DNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  123



>ref|XP_006394821.1| hypothetical protein EUTSA_v10004012mg [Eutrema salsugineum]
 gb|ESQ32107.1| hypothetical protein EUTSA_v10004012mg [Eutrema salsugineum]
Length=516

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 6/130 (5%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA++Y+++D       Q  DS   +YDPN+VPD VKSFV H+YRHIREKNVYEIHQM ET
Sbjct  1    MASNYEFDDA------QRQDSQDTAYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMCET  54

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSER+FKDTPWP V+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  55   SFQTLSERLFKDTPWPCVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  114

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  115  YCSLFQVVLH  124



>ref|XP_004291198.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +2

Query  182  TSYDYEDGSYSTKQQHSDSSLE--SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
             +YD+++ S + +Q  SD+  +   YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYET
Sbjct  2    AAYDFDEPSATHRQASSDAPSQEPGYDPNHVPDSVKSFVVHLYRHIREKNVYEIHQMYET  61

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ++SER FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARL PTLKQRIDSWDN
Sbjct  62   SFQAISERFFKDTPWPSVDAVAHYVDNDHVFCLLYREMWFRHLYARLQPTLKQRIDSWDN  121

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  122  YCSLFQVVLH  131



>ref|XP_010249694.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Nelumbo nucifera]
Length=525

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 114/136 (84%), Gaps = 9/136 (7%)
 Frame = +2

Query  176  MATSYDYEDG------SYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEI  337
            MATSYD++DG          +QQ  D     YDPN+VPD VK+FV HLYRHIREKNVYEI
Sbjct  1    MATSYDFDDGVGYEDMGGGYRQQPQDLG---YDPNFVPDAVKTFVVHLYRHIREKNVYEI  57

Query  338  HQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQR  517
            HQMYE SFQ LS+RMFK++PWPSVDAVAPYVDNDHVFCLLY+EMWFRHLYARL+PT KQR
Sbjct  58   HQMYEGSFQKLSDRMFKESPWPSVDAVAPYVDNDHVFCLLYQEMWFRHLYARLAPTPKQR  117

Query  518  IDSWDNYCNLFQVVLH  565
            IDSWDNYC+LFQVVLH
Sbjct  118  IDSWDNYCSLFQVVLH  133



>ref|XP_008357416.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Malus domestica]
Length=508

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 119/137 (87%), Gaps = 9/137 (7%)
 Frame = +2

Query  182  TSYDYED-GSY----STKQQHSD----SSLESYDPNYVPDPVKSFVGHLYRHIREKNVYE  334
             +YDY+D G+Y    +T++Q S     SS   YDPN+VPD VKSFV HLYR+IREKNVYE
Sbjct  2    AAYDYDDAGTYDETSATQRQPSSGAPPSSDLGYDPNFVPDSVKSFVVHLYRYIREKNVYE  61

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  514
            IHQMYETSFQ+LS+R+FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQ
Sbjct  62   IHQMYETSFQTLSDRLFKDTPWPSVDAVADYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  121

Query  515  RIDSWDNYCNLFQVVLH  565
            RIDSWDNYC+LFQVVLH
Sbjct  122  RIDSWDNYCSLFQVVLH  138



>emb|CDX88194.1| BnaA06g27850D [Brassica napus]
Length=523

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 3/132 (2%)
 Frame = +2

Query  176  MATSYDYED--GSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            M T+YD+ED   +Y   Q+        YDPN+VPD VKSFV H+YRHIREKNVYEIHQM 
Sbjct  1    MTTTYDFEDTPSNYDDVQRQGGQD-AVYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMC  59

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            ETSFQ+LSER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+
Sbjct  60   ETSFQTLSERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSY  119

Query  530  DNYCNLFQVVLH  565
            DNYC+LFQVVLH
Sbjct  120  DNYCSLFQVVLH  131



>emb|CDX80534.1| BnaC07g29100D [Brassica napus]
Length=523

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 3/132 (2%)
 Frame = +2

Query  176  MATSYDYED--GSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            M T+YD+ED   +Y   Q+        YDPN+VPD VKSFV H+YRHIREKNVYEIHQM 
Sbjct  1    MTTTYDFEDTPSNYDDVQRQGGQD-AVYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMC  59

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            ETSFQ+LSER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+
Sbjct  60   ETSFQTLSERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSY  119

Query  530  DNYCNLFQVVLH  565
            DNYC+LFQVVLH
Sbjct  120  DNYCSLFQVVLH  131



>ref|XP_008378102.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Malus domestica]
Length=530

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 119/137 (87%), Gaps = 9/137 (7%)
 Frame = +2

Query  182  TSYDYED-GSY----STKQQHSD----SSLESYDPNYVPDPVKSFVGHLYRHIREKNVYE  334
             +YDY+D G+Y    +T++Q S     SS   YDPN+VPD VKSFV HLYR+IREKNVYE
Sbjct  2    AAYDYDDAGTYDETSATQRQPSSGAPPSSDLGYDPNFVPDSVKSFVVHLYRYIREKNVYE  61

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  514
            IHQMYETSFQ+LS+R+FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQ
Sbjct  62   IHQMYETSFQTLSDRLFKDTPWPSVDAVADYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  121

Query  515  RIDSWDNYCNLFQVVLH  565
            RIDSWDNYC+LFQVVLH
Sbjct  122  RIDSWDNYCSLFQVVLH  138



>ref|XP_002872179.1| hypothetical protein ARALYDRAFT_489426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48438.1| hypothetical protein ARALYDRAFT_489426 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA++Y+YE+G  ++ ++ S      YDPN V D VKSFV H+YRHIREKNVYEIHQM ET
Sbjct  1    MASNYEYEEGPAASNERESGGE-SGYDPNIVADSVKSFVVHMYRHIREKNVYEIHQMCET  59

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQS+SER+FK+TPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  60   SFQSISERLFKETPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  119

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  120  YCSLFQVVLH  129



>ref|XP_009367906.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Pyrus x bretschneideri]
Length=530

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 9/137 (7%)
 Frame = +2

Query  182  TSYDYED-GSY----STKQQHSD----SSLESYDPNYVPDPVKSFVGHLYRHIREKNVYE  334
             +YDY+D G+Y    +T++Q S     SS   YDPN+VPD VK+FV HLYRHIREKNVYE
Sbjct  2    AAYDYDDAGNYDETSATQRQTSSGAPPSSDLGYDPNFVPDSVKAFVVHLYRHIREKNVYE  61

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  514
            IHQMYE+SFQ++S+R+FKDTPWPSVDAVA YVDNDHVFCLLYREMWFRHLYARLSPTLKQ
Sbjct  62   IHQMYESSFQTISDRLFKDTPWPSVDAVAHYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  121

Query  515  RIDSWDNYCNLFQVVLH  565
            RIDSWDNYC+LFQVVLH
Sbjct  122  RIDSWDNYCSLFQVVLH  138



>ref|XP_003636390.1| Eukaryotic translation initiation factor 3 subunit L [Medicago 
truncatula]
 gb|KEH36023.1| RNA polymerase I-associated factor PAF67 [Medicago truncatula]
Length=511

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPDPVK+FV HLYRHIREKNVYEIHQMYETSFQ+LSER FKDTPWPSVDAVA Y
Sbjct  14   GYDPNFVPDPVKTFVVHLYRHIREKNVYEIHQMYETSFQTLSERFFKDTPWPSVDAVAQY  73

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARL+PTL+QRIDSWDNYC+LFQVVLH
Sbjct  74   VDNDHVFCLLYREMWFRHLYARLTPTLRQRIDSWDNYCSLFQVVLH  119



>gb|KJB65718.1| hypothetical protein B456_010G110200 [Gossypium raimondii]
Length=489

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = +2

Query  176  MATSYDYEDGSYS-TKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYE  352
            MAT+YDYE+   +  + +H D     YDPN+VPD V+SFV HLYRHIREKNVYEIHQMYE
Sbjct  1    MATTYDYEEAPATYDEGRHQDLG---YDPNFVPDSVRSFVVHLYRHIREKNVYEIHQMYE  57

Query  353  TSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWD  532
             SFQ+LS+R+FKDTPWPSVDAV+ YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWD
Sbjct  58   ISFQTLSDRLFKDTPWPSVDAVSHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWD  117

Query  533  NYCNLFQVVLH  565
            NYC+LFQVVLH
Sbjct  118  NYCSLFQVVLH  128



>gb|KJB65717.1| hypothetical protein B456_010G110200 [Gossypium raimondii]
Length=520

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = +2

Query  176  MATSYDYEDGSYS-TKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYE  352
            MAT+YDYE+   +  + +H D     YDPN+VPD V+SFV HLYRHIREKNVYEIHQMYE
Sbjct  1    MATTYDYEEAPATYDEGRHQDLG---YDPNFVPDSVRSFVVHLYRHIREKNVYEIHQMYE  57

Query  353  TSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWD  532
             SFQ+LS+R+FKDTPWPSVDAV+ YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSWD
Sbjct  58   ISFQTLSDRLFKDTPWPSVDAVSHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSWD  117

Query  533  NYCNLFQVVLH  565
            NYC+LFQVVLH
Sbjct  118  NYCSLFQVVLH  128



>ref|XP_010519900.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Tarenaya hassleriana]
Length=527

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQH----SDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQ  343
            MA +Y+YED   S  + H           YDPNYVPD VKSFV H+YRHIREKNVYEIHQ
Sbjct  1    MANNYEYEDAPSSYDEAHRLGGGPGQDAGYDPNYVPDSVKSFVVHMYRHIREKNVYEIHQ  60

Query  344  MYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRID  523
            MYETSFQ+LS+R+FKDTPWPSV+A+AP+VDNDHVFCLLYREMWFRHLYARLSPT KQRID
Sbjct  61   MYETSFQTLSDRLFKDTPWPSVEAIAPFVDNDHVFCLLYREMWFRHLYARLSPTPKQRID  120

Query  524  SWDNYCNLFQVVLH  565
            S+DNYC+LFQVVLH
Sbjct  121  SYDNYCSLFQVVLH  134



>ref|XP_010100268.1| hypothetical protein L484_007265 [Morus notabilis]
 gb|EXB82275.1| hypothetical protein L484_007265 [Morus notabilis]
Length=551

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YEDGSYSTKQQHSDSSLE--SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQS  367
            YE+ S + +   + SS +   YDPNYVPD VKSFV HLYRHIREKNVYEIHQMYETSFQ+
Sbjct  13   YEESSATQRGSQTPSSGQDLGYDPNYVPDSVKSFVVHLYRHIREKNVYEIHQMYETSFQT  72

Query  368  LSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNL  547
            LSER+FKDTPWPSVDAVAP VDNDHVFCLLYREMWFRHLYARL+PTLKQRIDSWDNY +L
Sbjct  73   LSERLFKDTPWPSVDAVAPCVDNDHVFCLLYREMWFRHLYARLTPTLKQRIDSWDNYISL  132

Query  548  FQVVLH  565
            FQVVLH
Sbjct  133  FQVVLH  138



>gb|KJB54834.1| hypothetical protein B456_009G051100 [Gossypium raimondii]
Length=455

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 6/132 (5%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLE--SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA +YDY++   +    + D++ +   YDPN+VPD VKSFV HLYRHIREKNVYEIHQMY
Sbjct  1    MAANYDYDEAPAT----YDDANRQELGYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMY  56

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSW
Sbjct  57   EISFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSW  116

Query  530  DNYCNLFQVVLH  565
            DNYC+LFQVVLH
Sbjct  117  DNYCSLFQVVLH  128



>ref|XP_004501183.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cicer arietinum]
Length=513

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 4/117 (3%)
 Frame = +2

Query  227  HSDSSLES----YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDT  394
            H +  L+S    YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYETSFQ+LSER+FKDT
Sbjct  5    HEEQRLQSQDLGYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYETSFQTLSERLFKDT  64

Query  395  PWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            PWPSVDAVA YVDNDHVFCLLYREMWFRHLYARL+PTL+QRIDSWDNYC+LFQVVLH
Sbjct  65   PWPSVDAVAHYVDNDHVFCLLYREMWFRHLYARLTPTLRQRIDSWDNYCSLFQVVLH  121



>ref|XP_009413816.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Musa acuminata subsp. malaccensis]
Length=530

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 116/137 (85%), Gaps = 7/137 (5%)
 Frame = +2

Query  176  MATSYDYEDGSYSTK------QQHSDSSLE-SYDPNYVPDPVKSFVGHLYRHIREKNVYE  334
            MA+SYDY+DGS  ++        H  +S + SYDPN+VPD VK+FV HLYRHIREKNVYE
Sbjct  1    MASSYDYDDGSLESRYGRPPSAGHGGASTDLSYDPNFVPDSVKTFVVHLYRHIREKNVYE  60

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  514
            IHQMYE SFQ LS+RMF+D PWPSV+A+APYVDNDHVFCLLYREMWFRH+YARLSPT +Q
Sbjct  61   IHQMYEGSFQRLSDRMFRDNPWPSVEAIAPYVDNDHVFCLLYREMWFRHVYARLSPTGRQ  120

Query  515  RIDSWDNYCNLFQVVLH  565
            R++SWDNYC+LF VVLH
Sbjct  121  RVESWDNYCSLFGVVLH  137



>gb|KDP34205.1| hypothetical protein JCGZ_07776 [Jatropha curcas]
Length=525

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYETSFQ+LSER+FK+TPWPSVDAVA Y
Sbjct  28   GYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYETSFQTLSERLFKETPWPSVDAVAHY  87

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYC+LFQVVLH
Sbjct  88   VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCSLFQVVLH  133



>ref|XP_010668069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA  YDY+D    T    S +    YDP +VPD VKSFV HLYRHIREKNVYEIHQMYE 
Sbjct  1    MAAPYDYDD---RTLPPPSSADNGGYDPTFVPDSVKSFVVHLYRHIREKNVYEIHQMYEN  57

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SF +LS+RMFKDTPWPSVDA+AP+VDNDHVFCLLYREMWFRHLYARL PTLKQRIDSWDN
Sbjct  58   SFHTLSDRMFKDTPWPSVDAIAPFVDNDHVFCLLYREMWFRHLYARLQPTLKQRIDSWDN  117

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  118  YCSLFQVVLH  127



>ref|XP_009151095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Brassica rapa]
Length=523

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 113/132 (86%), Gaps = 3/132 (2%)
 Frame = +2

Query  176  MATSYDYED--GSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            M T+YD+ED   +Y   Q+        YDPN+VPD VKSFV H+YRHIREKNVYEIHQM 
Sbjct  1    MTTTYDFEDTPSNYDDVQRQGGQD-AVYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMC  59

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            ETSFQ+LSER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+
Sbjct  60   ETSFQTLSERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSY  119

Query  530  DNYCNLFQVVLH  565
            DNYC+LF VVLH
Sbjct  120  DNYCSLFPVVLH  131



>gb|KCW81539.1| hypothetical protein EUGRSUZ_C02897 [Eucalyptus grandis]
Length=505

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 9/139 (6%)
 Frame = +2

Query  176  MATSYDYED--GSYSTKQQHSDSSLE-------SYDPNYVPDPVKSFVGHLYRHIREKNV  328
            MA SY+Y+D  G Y    +   ++          YDPN+VPD VKSFV HLYRHIREKNV
Sbjct  1    MAASYEYDDAPGGYDDGHRQPQAAAAPSQADAAGYDPNFVPDSVKSFVVHLYRHIREKNV  60

Query  329  YEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTL  508
            YEIHQMYETSFQ+LS+R+FKDTPWPSV+AVA YVDNDHVFCLLYREMW+RHLYARLSPTL
Sbjct  61   YEIHQMYETSFQTLSDRLFKDTPWPSVEAVAHYVDNDHVFCLLYREMWYRHLYARLSPTL  120

Query  509  KQRIDSWDNYCNLFQVVLH  565
            KQRIDSWDNYC+LFQVVLH
Sbjct  121  KQRIDSWDNYCSLFQVVLH  139



>gb|KJB54836.1| hypothetical protein B456_009G051100 [Gossypium raimondii]
Length=520

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 6/132 (5%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLE--SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA +YDY++   +    + D++ +   YDPN+VPD VKSFV HLYRHIREKNVYEIHQMY
Sbjct  1    MAANYDYDEAPAT----YDDANRQELGYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMY  56

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSW
Sbjct  57   EISFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSW  116

Query  530  DNYCNLFQVVLH  565
            DNYC+LFQVVLH
Sbjct  117  DNYCSLFQVVLH  128



>ref|XP_010049085.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Eucalyptus grandis]
 gb|KCW81540.1| hypothetical protein EUGRSUZ_C02897 [Eucalyptus grandis]
Length=531

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 9/139 (6%)
 Frame = +2

Query  176  MATSYDYED--GSYSTKQQHSDSSLE-------SYDPNYVPDPVKSFVGHLYRHIREKNV  328
            MA SY+Y+D  G Y    +   ++          YDPN+VPD VKSFV HLYRHIREKNV
Sbjct  1    MAASYEYDDAPGGYDDGHRQPQAAAAPSQADAAGYDPNFVPDSVKSFVVHLYRHIREKNV  60

Query  329  YEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTL  508
            YEIHQMYETSFQ+LS+R+FKDTPWPSV+AVA YVDNDHVFCLLYREMW+RHLYARLSPTL
Sbjct  61   YEIHQMYETSFQTLSDRLFKDTPWPSVEAVAHYVDNDHVFCLLYREMWYRHLYARLSPTL  120

Query  509  KQRIDSWDNYCNLFQVVLH  565
            KQRIDSWDNYC+LFQVVLH
Sbjct  121  KQRIDSWDNYCSLFQVVLH  139



>gb|EYU20458.1| hypothetical protein MIMGU_mgv1a004619mg [Erythranthe guttata]
Length=518

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = +2

Query  206  SYSTKQ-QHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERM  382
            SY  +Q    +S+   YDPNYVPD VKSFV H+YRHIREKNVYEIHQMYETSFQS+SER+
Sbjct  6    SYEAEQPAAGESASTGYDPNYVPDSVKSFVVHMYRHIREKNVYEIHQMYETSFQSISERL  65

Query  383  FKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVL  562
            FKD+PWPSVDAVA YVDNDHVFCLLYREMW+RHLYARLSPT KQRIDSWDNYC+LFQVVL
Sbjct  66   FKDSPWPSVDAVASYVDNDHVFCLLYREMWYRHLYARLSPTPKQRIDSWDNYCSLFQVVL  125

Query  563  H  565
            H
Sbjct  126  H  126



>gb|KHG17679.1| Eukaryotic translation initiation factor 3 subunit L [Gossypium 
arboreum]
Length=520

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 6/132 (5%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLE--SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA +YDY++   +    + D++ +   YDPN+VPD VKSFV HLYRHIREKNVYEIHQMY
Sbjct  1    MAANYDYDEAPAT----YDDANRQDLGYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMY  56

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ+LS+R+FKDTPWPSVDAVA YVDND VFCLLYREMWFRHLYARLSPTLKQRIDSW
Sbjct  57   EISFQTLSDRLFKDTPWPSVDAVAHYVDNDQVFCLLYREMWFRHLYARLSPTLKQRIDSW  116

Query  530  DNYCNLFQVVLH  565
            DNYC+LFQVVLH
Sbjct  117  DNYCSLFQVVLH  128



>ref|XP_007137185.1| hypothetical protein PHAVU_009G106900g [Phaseolus vulgaris]
 gb|ESW09179.1| hypothetical protein PHAVU_009G106900g [Phaseolus vulgaris]
Length=513

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYE+SFQ+LSER+FKDTPWPSVDAVA Y
Sbjct  16   GYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYESSFQTLSERLFKDTPWPSVDAVAHY  75

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARL+PTL+QRIDSWDNYC+LFQVVLH
Sbjct  76   VDNDHVFCLLYREMWFRHLYARLTPTLRQRIDSWDNYCSLFQVVLH  121



>ref|XP_006578214.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Glycine max]
Length=514

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYE+SFQ+LSER+FKDTPWPSVDAVA Y
Sbjct  17   GYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYESSFQTLSERLFKDTPWPSVDAVAHY  76

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARL+PTL+QRIDSWDNYC+LFQVVLH
Sbjct  77   VDNDHVFCLLYREMWFRHLYARLTPTLRQRIDSWDNYCSLFQVVLH  122



>ref|XP_003526476.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Glycine max]
Length=516

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPD VKSFV HLYRHIREKNVYEIHQMYE+SFQ+LSER+FKDTPWPSVDAVA Y
Sbjct  19   GYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYESSFQTLSERLFKDTPWPSVDAVAHY  78

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARL+PTL+QRIDSWDNYC+LFQVVLH
Sbjct  79   VDNDHVFCLLYREMWFRHLYARLTPTLRQRIDSWDNYCSLFQVVLH  124



>ref|XP_010915834.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Elaeis guineensis]
Length=525

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 3/133 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQ---QHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQM  346
            MA+SY+Y+D SY ++      S +S + YDPN+VPD VK+FV HLYRHIREKNVYEIHQM
Sbjct  1    MASSYEYDDPSYDSRSYPPSSSQASDQGYDPNFVPDSVKTFVVHLYRHIREKNVYEIHQM  60

Query  347  YETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS  526
            YE SFQ LS+RMF+++PWPSV+AVAPYVDNDHVFCLLYREMWFRH+YARLSPT +QR++S
Sbjct  61   YEGSFQRLSDRMFRESPWPSVEAVAPYVDNDHVFCLLYREMWFRHVYARLSPTGRQRVES  120

Query  527  WDNYCNLFQVVLH  565
            WDNYC+LF VVLH
Sbjct  121  WDNYCSLFGVVLH  133



>ref|XP_010925869.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X3 [Elaeis guineensis]
Length=477

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQ--QHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA+SYDY++ SY ++     S +S   YDPN+VPD VK+FV HLYRHIREKNVYEIHQMY
Sbjct  1    MASSYDYDEPSYDSRSYPPSSQASDVGYDPNFVPDSVKTFVVHLYRHIREKNVYEIHQMY  60

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ LS+RMF+++PWPSV+AVAPYVDNDHVFCLLYREMWFRH+YARLSPT +QRI+SW
Sbjct  61   EGSFQRLSDRMFRESPWPSVEAVAPYVDNDHVFCLLYREMWFRHVYARLSPTGRQRIESW  120

Query  530  DNYCNLFQVVLH  565
            DNYC+LF VVLH
Sbjct  121  DNYCSLFGVVLH  132



>ref|XP_002284115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Vitis vinifera]
Length=517

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 5/130 (4%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA+SYD+ED      Q  S      YDPNYVPD V++FV HLYRHIREKNVYEIHQMYE+
Sbjct  1    MASSYDHED-----VQSQSQVDPLGYDPNYVPDSVRTFVVHLYRHIREKNVYEIHQMYES  55

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LS+R+FK+TPWPSVDAVA +VDNDHVFCLLYREMW+RHLYARLSPT KQRIDSWDN
Sbjct  56   SFQTLSDRLFKETPWPSVDAVAHHVDNDHVFCLLYREMWYRHLYARLSPTAKQRIDSWDN  115

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  116  YCSLFQVVLH  125



>ref|XP_009419787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Musa acuminata subsp. malaccensis]
Length=530

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 115/137 (84%), Gaps = 7/137 (5%)
 Frame = +2

Query  176  MATSYDYEDGSYSTK-------QQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYE  334
            MA+SYDY+D S  ++        Q S  + + YDPN+VPD VK+FV HLYRHIREKNVYE
Sbjct  1    MASSYDYDDASLDSRYTRPPSAGQGSAGTDQGYDPNFVPDSVKTFVVHLYRHIREKNVYE  60

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQ  514
            IHQMY+ SFQ LS+RMF+++PWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPT +Q
Sbjct  61   IHQMYDGSFQRLSDRMFRESPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTGRQ  120

Query  515  RIDSWDNYCNLFQVVLH  565
            R++SWDNYC+LF VVLH
Sbjct  121  RVESWDNYCSLFSVVLH  137



>ref|XP_010925868.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X2 [Elaeis guineensis]
Length=499

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQ--QHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA+SYDY++ SY ++     S +S   YDPN+VPD VK+FV HLYRHIREKNVYEIHQMY
Sbjct  1    MASSYDYDEPSYDSRSYPPSSQASDVGYDPNFVPDSVKTFVVHLYRHIREKNVYEIHQMY  60

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ LS+RMF+++PWPSV+AVAPYVDNDHVFCLLYREMWFRH+YARLSPT +QRI+SW
Sbjct  61   EGSFQRLSDRMFRESPWPSVEAVAPYVDNDHVFCLLYREMWFRHVYARLSPTGRQRIESW  120

Query  530  DNYCNLFQVVLH  565
            DNYC+LF VVLH
Sbjct  121  DNYCSLFGVVLH  132



>ref|XP_011081819.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Sesamum indicum]
Length=518

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPNYVPD VKSFV H+YRHIREKNVYEIHQMYE SFQS+S+R+FKD+PWPSVDAVAPY
Sbjct  21   GYDPNYVPDSVKSFVVHMYRHIREKNVYEIHQMYENSFQSISDRLFKDSPWPSVDAVAPY  80

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARLSPT KQRIDSWDNYC+LFQVVLH
Sbjct  81   VDNDHVFCLLYREMWFRHLYARLSPTPKQRIDSWDNYCSLFQVVLH  126



>ref|XP_008800463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Phoenix dactylifera]
Length=524

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLE--SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA+SYDY++ SY  +     S +   +YDPN+VPD VK+FV HLYRHIREKNVYEIHQMY
Sbjct  1    MASSYDYDEPSYDNRSYPPSSQVSDVAYDPNFVPDSVKTFVVHLYRHIREKNVYEIHQMY  60

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ LSERMF++ PWPSV+AVAPYVDNDHVFCLLYREMWFRH+YARLSPT +QRI+SW
Sbjct  61   EGSFQRLSERMFRENPWPSVEAVAPYVDNDHVFCLLYREMWFRHVYARLSPTGRQRIESW  120

Query  530  DNYCNLFQVVLH  565
            DNYC+LF VVLH
Sbjct  121  DNYCSLFGVVLH  132



>ref|XP_006287441.1| hypothetical protein CARUB_v10000647mg, partial [Capsella rubella]
 gb|EOA20339.1| hypothetical protein CARUB_v10000647mg, partial [Capsella rubella]
Length=544

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA SY+Y+D   +   +        YDPN+VPD VKSFV H+YRHIREKNVYEIHQM ET
Sbjct  24   MAASYEYDDAP-AANYEGESGGEGGYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMCET  82

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSER+FK+TPWP V+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  83   SFQTLSERLFKETPWPCVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  142

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  143  YCSLFQVVLH  152



>ref|XP_010925867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X1 [Elaeis guineensis]
Length=524

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQ--QHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA+SYDY++ SY ++     S +S   YDPN+VPD VK+FV HLYRHIREKNVYEIHQMY
Sbjct  1    MASSYDYDEPSYDSRSYPPSSQASDVGYDPNFVPDSVKTFVVHLYRHIREKNVYEIHQMY  60

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            E SFQ LS+RMF+++PWPSV+AVAPYVDNDHVFCLLYREMWFRH+YARLSPT +QRI+SW
Sbjct  61   EGSFQRLSDRMFRESPWPSVEAVAPYVDNDHVFCLLYREMWFRHVYARLSPTGRQRIESW  120

Query  530  DNYCNLFQVVLH  565
            DNYC+LF VVLH
Sbjct  121  DNYCSLFGVVLH  132



>ref|NP_680222.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
 ref|NP_680223.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
 gb|AED93480.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
 gb|AED93481.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
Length=514

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 8/130 (6%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA+S +YE+G    +          YDPN VPD VKSFV H+YRHIR+KNVYEIHQM ET
Sbjct  1    MASSNEYEEGPGERE--------SGYDPNMVPDSVKSFVSHMYRHIRDKNVYEIHQMCET  52

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQS+SER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  53   SFQSISERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  112

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  113  YCSLFQVVLH  122



>dbj|BAD93836.1| hypothetical protein [Arabidopsis thaliana]
Length=514

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 8/130 (6%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA+S +YE+G    +          YDPN VPD VKSFV H+YRHIR+KNVYEIHQM ET
Sbjct  1    MASSNEYEEGPGERE--------SGYDPNMVPDSVKSFVSHMYRHIRDKNVYEIHQMCET  52

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQS+SER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  53   SFQSISERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  112

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  113  YCSLFQVVLH  122



>ref|XP_004136214.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cucumis sativus]
 ref|XP_004163195.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cucumis sativus]
 gb|KGN60334.1| hypothetical protein Csa_3G895800 [Cucumis sativus]
Length=528

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPD VKSFV HLYRHIREKNVYE HQMYETSFQSLS+R+FKDTPWPSVDAVA +
Sbjct  30   GYDPNFVPDSVKSFVVHLYRHIREKNVYETHQMYETSFQSLSDRLFKDTPWPSVDAVAHF  89

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYC+LFQVVLH
Sbjct  90   VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCSLFQVVLH  135



>ref|XP_008466039.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cucumis melo]
Length=528

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 112/134 (84%), Gaps = 6/134 (4%)
 Frame = +2

Query  182  TSYDYED--GSYSTKQQHSDSSLES----YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQ  343
             SYDY+D   +Y   +    SS       YDPN+VPD VKSFV HLYRHIREKNVYE HQ
Sbjct  2    ASYDYDDSRANYDDPRHAPVSSPAGQDIGYDPNFVPDSVKSFVVHLYRHIREKNVYETHQ  61

Query  344  MYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRID  523
            MYETSFQSLS+R+FKDTPWPSVDAVA +VDNDHVFCLLYREMWFRHLYARLSPTLKQRID
Sbjct  62   MYETSFQSLSDRLFKDTPWPSVDAVAHFVDNDHVFCLLYREMWFRHLYARLSPTLKQRID  121

Query  524  SWDNYCNLFQVVLH  565
            SWDNYC+LFQVVLH
Sbjct  122  SWDNYCSLFQVVLH  135



>ref|XP_006290036.1| hypothetical protein CARUB_v10003670mg [Capsella rubella]
 gb|EOA22934.1| hypothetical protein CARUB_v10003670mg [Capsella rubella]
Length=523

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA +Y+Y+D   +   +        YDPN+VPD VKSFV H+YRHIREKNVYEIHQM ET
Sbjct  1    MAANYEYDDAP-AANYEGESGGEGGYDPNFVPDSVKSFVVHMYRHIREKNVYEIHQMCET  59

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQ+LSER+FK+TPWP V+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  60   SFQTLSERLFKETPWPCVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  119

Query  536  YCNLFQVVLH  565
            YC+LFQVVLH
Sbjct  120  YCSLFQVVLH  129



>ref|XP_010254082.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Nelumbo nucifera]
Length=524

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPN+VPD VK+FV HLYRHIREKNVYEIHQMYE SFQ LS+RMFKD+PWPSVDAVAPY
Sbjct  27   GYDPNFVPDSVKTFVVHLYRHIREKNVYEIHQMYEGSFQKLSDRMFKDSPWPSVDAVAPY  86

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLY+EMWFRHLYARL+PT KQRIDSWDNYC+LFQVVLH
Sbjct  87   VDNDHVFCLLYQEMWFRHLYARLTPTPKQRIDSWDNYCSLFQVVLH  132



>gb|AAN31908.1| unknown protein [Arabidopsis thaliana]
Length=514

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 8/130 (6%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA+S +YE+G    +          YDPN VPD VKSFV H+YRHIR+KNVYEIHQM ET
Sbjct  1    MASSNEYEEGPGERE--------SGYDPNMVPDSVKSFVSHMYRHIRDKNVYEIHQMCET  52

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SFQS+SER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DN
Sbjct  53   SFQSISERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDN  112

Query  536  YCNLFQVVLH  565
            YC+LF VVLH
Sbjct  113  YCSLFPVVLH  122



>gb|EPS61195.1| hypothetical protein M569_13603, partial [Genlisea aurea]
Length=497

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  248  SYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPY  427
             YDPNYVPD VKSFV H+YR+IREKNV+++HQMYETSFQS+S+R FKDTPWPSV+AVAP+
Sbjct  1    GYDPNYVPDSVKSFVVHIYRYIREKNVFDVHQMYETSFQSISDRFFKDTPWPSVEAVAPF  60

Query  428  VDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            VDNDHVFCLLYREMWFRHLYARLSPTL+QR+DSWDNYCNLFQVVLH
Sbjct  61   VDNDHVFCLLYREMWFRHLYARLSPTLRQRLDSWDNYCNLFQVVLH  106



>gb|KFK22378.1| hypothetical protein AALP_AAs56077U000100, partial [Arabis alpina]
Length=124

 Score =   196 bits (497),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYST--KQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMY  349
            MA++Y+Y+D + ++  + Q        YDPN VPD VKSFV H+YRHIREKNVYEIHQM 
Sbjct  1    MASNYEYDDAAPASYDEAQRQGGQDGGYDPNVVPDSVKSFVVHMYRHIREKNVYEIHQMC  60

Query  350  ETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSW  529
            ETSFQ+LSER+FKDTPWPSV+A+APYVDNDHVFCLLYREMWFRHLYARLSPTL+QR+DS+
Sbjct  61   ETSFQTLSERLFKDTPWPSVEAIAPYVDNDHVFCLLYREMWFRHLYARLSPTLQQRLDSY  120

Query  530  DNYC  541
            DNYC
Sbjct  121  DNYC  124



>ref|XP_010421430.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Camelina sativa]
Length=516

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +2

Query  254  DPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVD  433
            DPNYV D VKSFV H+YRHIREKNVYEIHQM ETSFQSLSER+FK+TPWPSV+A+APYVD
Sbjct  22   DPNYVADSVKSFVVHMYRHIREKNVYEIHQMCETSFQSLSERLFKETPWPSVEAIAPYVD  81

Query  434  NDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            NDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DNYC+LFQVVLH
Sbjct  82   NDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDNYCSLFQVVLH  125



>ref|XP_010493831.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Camelina sativa]
Length=516

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +2

Query  254  DPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVD  433
            DPNYV D VKSFV H+YRHIREKNVYEIHQM ETSFQSLSER+FK+TPWPSV+A+APYVD
Sbjct  22   DPNYVADSVKSFVVHMYRHIREKNVYEIHQMCETSFQSLSERLFKETPWPSVEAIAPYVD  81

Query  434  NDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            NDHVFCLLYREMWFRHLYARLSPTLKQRIDS+DNYC+LFQVVLH
Sbjct  82   NDHVFCLLYREMWFRHLYARLSPTLKQRIDSYDNYCSLFQVVLH  125



>ref|XP_002885738.1| hypothetical protein ARALYDRAFT_319240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61997.1| hypothetical protein ARALYDRAFT_319240 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VPD VKSFV H+YRHIR+KNVYEIHQM ETSFQS+SER+FK+TPWPSV+A+APYVDNDHV
Sbjct  2    VPDSVKSFVVHMYRHIRDKNVYEIHQMCETSFQSISERLFKETPWPSVEAIAPYVDNDHV  61

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            FCLLYREMWFRHLYARLSPTLKQRIDS+DNYC+LFQVVLH
Sbjct  62   FCLLYREMWFRHLYARLSPTLKQRIDSYDNYCSLFQVVLH  101



>ref|XP_003565952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Brachypodium distachyon]
Length=521

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA++YD EDG+      H   + ++YDPNYVPD VK+FV HLYRHIR+KNVYEIHQMYE 
Sbjct  1    MASAYDREDGT--APPSHGGGAADAYDPNYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEG  58

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWD  532
             FQ LSER+F+DTPWPS +AVAPY D DHVF LLYRE+W+RH YARLSP T   R +SW+
Sbjct  59   GFQRLSERLFRDTPWPSAEAVAPYCDGDHVFLLLYRELWYRHAYARLSPLTASHRSESWN  118

Query  533  NYCNLFQVVLH  565
            NYC+LF VVLH
Sbjct  119  NYCDLFSVVLH  129



>emb|CDM82375.1| unnamed protein product [Triticum aestivum]
Length=522

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA++YD EDG  +  Q H     ++YDPNYVPD VK+FV HLYRHIR+KNVYEIHQMYE 
Sbjct  1    MASAYDREDG-LAPPQPHGGGPADAYDPNYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEG  59

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWD  532
             FQ LS+R+F+DTPWPS +AVAPY D DHVF LLYRE+W+RH YARLSP T   R +SW+
Sbjct  60   GFQRLSDRLFRDTPWPSAEAVAPYCDGDHVFLLLYRELWYRHAYARLSPLTASHRSESWN  119

Query  533  NYCNLFQVVLH  565
            NYC+LF VVLH
Sbjct  120  NYCDLFSVVLH  130



>ref|XP_006833328.1| hypothetical protein AMTR_s00109p00071210 [Amborella trichopoda]
 gb|ERM98606.1| hypothetical protein AMTR_s00109p00071210 [Amborella trichopoda]
Length=521

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  251  YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            Y+P +VPD VK+FV  LYRHIREKNVYEI+QMYE SF  LSER+FKD PWPSV+A+AP+V
Sbjct  25   YNPMFVPDSVKTFVVILYRHIREKNVYEIYQMYEGSFHKLSERLFKDCPWPSVEAIAPHV  84

Query  431  DNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            DNDHVFCLLY+EMW+RHLYARLSPTL+ RI+SWDNYCNLFQVVLH
Sbjct  85   DNDHVFCLLYQEMWYRHLYARLSPTLQHRIESWDNYCNLFQVVLH  129



>ref|XP_001777172.1| predicted protein [Physcomitrella patens]
 gb|EDQ58057.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 103/129 (80%), Gaps = 7/129 (5%)
 Frame = +2

Query  200  DGSYSTKQQHSDS--SLESYDP-----NYVPDPVKSFVGHLYRHIREKNVYEIHQMYETS  358
            D SY  + +  D    L+  +P     NYVPD V++FV +LYRHIREKNVYEIHQMYE S
Sbjct  14   DDSYDDRPEFRDGFRDLQPLEPGFDTTNYVPDVVRTFVVYLYRHIREKNVYEIHQMYEGS  73

Query  359  FQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNY  538
            FQ LS+R+FK + WP+V+ +APYV+NDHVFCLLY+EMWFRH+YARL PTL+QR DSWDNY
Sbjct  74   FQKLSDRLFKQSKWPAVEMIAPYVENDHVFCLLYKEMWFRHVYARLQPTLEQRCDSWDNY  133

Query  539  CNLFQVVLH  565
            CNLFQV+LH
Sbjct  134  CNLFQVILH  142



>ref|XP_001783486.1| predicted protein [Physcomitrella patens]
 gb|EDQ51676.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  PNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDN  436
             NYVPD V++FV +LYRHIREKNVYEIHQMYE SFQ LS+R+FK + WP VD +APYV+N
Sbjct  40   ANYVPDVVRTFVVYLYRHIREKNVYEIHQMYEGSFQKLSDRLFKQSNWPIVDMIAPYVEN  99

Query  437  DHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            DHVFCLLY+EMWFRH+YARL PTL+QR DSWDNYCNLFQV+LH
Sbjct  100  DHVFCLLYKEMWFRHVYARLQPTLEQRCDSWDNYCNLFQVILH  142



>ref|XP_004967411.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Setaria italica]
Length=520

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 100/131 (76%), Gaps = 4/131 (3%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA  YD EDG      QH+    ++YDPNYVPD VK+FV HLYRHIR+KNVYEIHQMYE 
Sbjct  1    MAAPYDREDGLAPAPPQHAP---DAYDPNYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEG  57

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWD  532
             FQ LS+R+F+D PWPS +AVAPY D DHVF LLYRE+W+RH +ARLSP T   R +SW 
Sbjct  58   GFQRLSDRLFRDAPWPSAEAVAPYCDGDHVFLLLYRELWYRHAHARLSPLTAAHRAESWT  117

Query  533  NYCNLFQVVLH  565
            NYC+LF VVLH
Sbjct  118  NYCDLFSVVLH  128



>ref|XP_002454893.1| hypothetical protein SORBIDRAFT_03g000920 [Sorghum bicolor]
 gb|EES00013.1| hypothetical protein SORBIDRAFT_03g000920 [Sorghum bicolor]
Length=521

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +2

Query  179  ATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETS  358
            A  YD EDG   +   H+    ++YDPNYVPD VK+FV HLYRHIR+KNVYEIHQMYE  
Sbjct  3    AAPYDREDGLPPSVPPHAA---DAYDPNYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEGG  59

Query  359  FQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWDN  535
            FQ LS+R+F+D PWPS +AVAPY D DHVF LLYRE+W+RH +ARLSP T   R +SW N
Sbjct  60   FQRLSDRLFRDAPWPSAEAVAPYCDGDHVFLLLYRELWYRHAHARLSPLTAAHRAESWTN  119

Query  536  YCNLFQVVLH  565
            YC+LF VVLH
Sbjct  120  YCDLFSVVLH  129



>ref|XP_006643941.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Oryza brachyantha]
Length=525

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +2

Query  179  ATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETS  358
            A  Y+ EDG          +  E+YDP+YVPD VK+FV HLYRH+REKNVYEIHQMYE  
Sbjct  3    AAGYEREDGGGGGGGGPGAAGREAYDPSYVPDSVKTFVTHLYRHVREKNVYEIHQMYEGG  62

Query  359  FQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTL--KQRIDSWD  532
            FQ LS+R+F+D PWPS +AVAPY D DHVF LLYRE+W+RH YARL P L   +R +SW 
Sbjct  63   FQRLSDRLFRDAPWPSAEAVAPYCDGDHVFLLLYRELWYRHAYARLPPPLAAARRAESWA  122

Query  533  NYCNLFQVVLH  565
            NYC+LF VVLH
Sbjct  123  NYCDLFSVVLH  133



>gb|AFW80484.1| hypothetical protein ZEAMMB73_715495 [Zea mays]
Length=522

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  179  ATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETS  358
            A  YD EDG   +   H+   +++YDP+YVPD VK+FV HLYRHIR+KNVYEIHQMYE  
Sbjct  3    AAPYDREDGLQPSAPPHA---VDAYDPSYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEGG  59

Query  359  FQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWDN  535
            FQ LS+R+F+D PWPS +AVAPY D D VF LLYRE+W+RH +ARLSP T   R +SW N
Sbjct  60   FQRLSDRLFRDAPWPSAEAVAPYCDGDPVFLLLYRELWYRHAHARLSPLTAAHRAESWTN  119

Query  536  YCNLFQVVLH  565
            YC+LF+VVLH
Sbjct  120  YCDLFRVVLH  129



>ref|NP_001145811.1| uncharacterized protein LOC100279318 [Zea mays]
 gb|ACG29834.1| eukaryotic translation initiation factor 3 subunit 6-interacting 
protein [Zea mays]
 gb|ACL52635.1| unknown [Zea mays]
 gb|AFW80485.1| eukaryotic translation initiation factor 3 subunit 6-interacting 
protein [Zea mays]
Length=521

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  179  ATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETS  358
            A  YD EDG   +   H+   +++YDP+YVPD VK+FV HLYRHIR+KNVYEIHQMYE  
Sbjct  3    AAPYDREDGLQPSAPPHA---VDAYDPSYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEGG  59

Query  359  FQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWDN  535
            FQ LS+R+F+D PWPS +AVAPY D D VF LLYRE+W+RH +ARLSP T   R +SW N
Sbjct  60   FQRLSDRLFRDAPWPSAEAVAPYCDGDPVFLLLYRELWYRHAHARLSPLTAAHRAESWTN  119

Query  536  YCNLFQVVLH  565
            YC+LF+VVLH
Sbjct  120  YCDLFRVVLH  129



>ref|XP_002968842.1| hypothetical protein SELMODRAFT_146079 [Selaginella moellendorffii]
 ref|XP_002974131.1| hypothetical protein SELMODRAFT_149527 [Selaginella moellendorffii]
 gb|EFJ25086.1| hypothetical protein SELMODRAFT_149527 [Selaginella moellendorffii]
 gb|EFJ29958.1| hypothetical protein SELMODRAFT_146079 [Selaginella moellendorffii]
Length=531

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA  Y+  DG    +  + +   +++ P+YVPD VKSFVG+LYR IREKNVYE+HQMYE+
Sbjct  1    MAAGYE-RDGYGGYEDSYDERPDDAHPPDYVPDYVKSFVGYLYRSIREKNVYEVHQMYES  59

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            SF  LSER F  + WPS + VAPYVDNDHVFCLLY+EM++RH+YA+L+ T ++R++SWDN
Sbjct  60   SFSKLSERFFSKSHWPSAELVAPYVDNDHVFCLLYKEMYYRHVYAKLNVTFQERLESWDN  119

Query  536  YCNLFQVVLH  565
            YCNLF V+LH
Sbjct  120  YCNLFTVILH  129



>ref|XP_008673489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Zea mays]
 tpg|DAA52773.1| TPA: hypothetical protein ZEAMMB73_316507 [Zea mays]
Length=522

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  179  ATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETS  358
            A  YD EDG   +   H+ +   +YDPNYVPD VK+FV HLYRHIR+KNVYEIHQMYE  
Sbjct  3    AAHYDREDGLPPSAPPHAAAD--AYDPNYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEGG  60

Query  359  FQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWDN  535
            FQ LS+R+F+D  WPS +AV+PY D DHVF LLYRE+W+RH +ARLSP T   R +SW N
Sbjct  61   FQRLSDRLFRDVFWPSAEAVSPYCDGDHVFLLLYRELWYRHAHARLSPLTAAHRAESWTN  120

Query  536  YCNLFQVVLH  565
            YC+LF VVLH
Sbjct  121  YCDLFSVVLH  130



>dbj|BAD81321.1| putative eukaryotic translation initiation factor 3 subunit 6 
interacting protein [Oryza sativa Japonica Group]
 dbj|BAD82420.1| putative eukaryotic translation initiation factor 3 subunit 6 
interacting protein [Oryza sativa Japonica Group]
Length=290

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 8/113 (7%)
 Frame = +2

Query  251  YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            YDP+YVPD VK+FV H+YRH+R+KNVYEIHQMYE  FQ LS+R+F+D PWP+ +AV+PY 
Sbjct  17   YDPSYVPDSVKTFVAHMYRHVRDKNVYEIHQMYEGGFQRLSDRLFRDAPWPAAEAVSPYC  76

Query  431  DNDHVFCLLYREMWFRHLYAR-------LSP-TLKQRIDSWDNYCNLFQVVLH  565
            D DHVF LLYRE+W+RH YAR        +P T  QR +SW NYC+LF VVLH
Sbjct  77   DGDHVFLLLYRELWYRHAYARASSSSSSSAPLTAGQRAESWANYCDLFSVVLH  129



>ref|NP_001042483.1| Os01g0229100 [Oryza sativa Japonica Group]
 dbj|BAD81320.1| putative eukaryotic translation initiation factor 3 subunit 6 
interacting protein [Oryza sativa Japonica Group]
 dbj|BAD82419.1| putative eukaryotic translation initiation factor 3 subunit 6 
interacting protein [Oryza sativa Japonica Group]
 dbj|BAF04397.1| Os01g0229100 [Oryza sativa Japonica Group]
 gb|EEE54164.1| hypothetical protein OsJ_00976 [Oryza sativa Japonica Group]
Length=521

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 8/113 (7%)
 Frame = +2

Query  251  YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            YDP+YVPD VK+FV H+YRH+R+KNVYEIHQMYE  FQ LS+R+F+D PWP+ +AV+PY 
Sbjct  17   YDPSYVPDSVKTFVAHMYRHVRDKNVYEIHQMYEGGFQRLSDRLFRDAPWPAAEAVSPYC  76

Query  431  DNDHVFCLLYREMWFRHLYAR-------LSP-TLKQRIDSWDNYCNLFQVVLH  565
            D DHVF LLYRE+W+RH YAR        +P T  QR +SW NYC+LF VVLH
Sbjct  77   DGDHVFLLLYRELWYRHAYARASSSSSSSAPLTAGQRAESWANYCDLFSVVLH  129



>gb|EEC70234.1| hypothetical protein OsI_01004 [Oryza sativa Indica Group]
Length=528

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 8/113 (7%)
 Frame = +2

Query  251  YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            YDP+YVPD VK+FV H+YRH+R+KNVYEIHQMYE  FQ LS+R+F+D PWP+ +AV+PY 
Sbjct  17   YDPSYVPDSVKTFVAHMYRHVRDKNVYEIHQMYEGGFQRLSDRLFRDAPWPAAEAVSPYC  76

Query  431  DNDHVFCLLYREMWFRHLYAR-------LSP-TLKQRIDSWDNYCNLFQVVLH  565
            D DHVF LLYRE+W+RH YAR        +P T  QR +SW NYC+LF VVLH
Sbjct  77   DGDHVFLLLYRELWYRHAYARASSSSSSSAPLTAGQRAESWANYCDLFSVVLH  129



>ref|NP_001054968.1| Os05g0227700 [Oryza sativa Japonica Group]
 dbj|BAF16882.1| Os05g0227700 [Oryza sativa Japonica Group]
 dbj|BAG90475.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91072.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62812.1| hypothetical protein OsJ_17615 [Oryza sativa Japonica Group]
Length=529

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 3/136 (2%)
 Frame = +2

Query  167  TSTMATSY--DYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIH  340
             S+ A ++  D ED +  +       ++ +YDP+YVPD VK+FV HLYRHIR++NVYE H
Sbjct  2    ASSAAAAFYRDREDAAPPSSGPGGGGAMAAYDPSYVPDSVKTFVSHLYRHIRDRNVYETH  61

Query  341  QMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQR  517
            QMYE  F  LS+R F+DTPWP  +AVA + D DHVF LLYRE+WFRH +AR+   T  QR
Sbjct  62   QMYEGGFTRLSDRHFRDTPWPPAEAVAAHCDGDHVFLLLYRELWFRHAHARVQGLTPAQR  121

Query  518  IDSWDNYCNLFQVVLH  565
             +SWDNYC+LF VVL 
Sbjct  122  AESWDNYCSLFSVVLQ  137



>gb|EEC78744.1| hypothetical protein OsI_18958 [Oryza sativa Indica Group]
Length=529

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 3/136 (2%)
 Frame = +2

Query  167  TSTMATSY--DYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIH  340
             S+ A ++  D ED +  +       ++ +YDP+YVPD VK+FV HLYRHIR++NVYE H
Sbjct  2    ASSAAAAFYRDREDAAPPSSGPGGGGAMAAYDPSYVPDSVKTFVSHLYRHIRDRNVYETH  61

Query  341  QMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQR  517
            QMYE  F  LS+R F+DTPWP  +AVA + D DHVF LLYRE+WFRH +AR+   T  QR
Sbjct  62   QMYEGGFTRLSDRHFRDTPWPPAEAVAAHCDGDHVFLLLYRELWFRHAHARVQGLTPAQR  121

Query  518  IDSWDNYCNLFQVVLH  565
             +SWDNYC+LF VVL 
Sbjct  122  AESWDNYCSLFSVVLQ  137



>gb|AAT77307.1| unknown protein [Oryza sativa Japonica Group]
Length=541

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 3/136 (2%)
 Frame = +2

Query  167  TSTMATSY--DYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIH  340
             S+ A ++  D ED +  +       ++ +YDP+YVPD VK+FV HLYRHIR++NVYE H
Sbjct  2    ASSAAAAFYRDREDAAPPSSGPGGGGAMAAYDPSYVPDSVKTFVSHLYRHIRDRNVYETH  61

Query  341  QMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQR  517
            QMYE  F  LS+R F+DTPWP  +AVA + D DHVF LLYRE+WFRH +AR+   T  QR
Sbjct  62   QMYEGGFTRLSDRHFRDTPWPPAEAVAAHCDGDHVFLLLYRELWFRHAHARVQGLTPAQR  121

Query  518  IDSWDNYCNLFQVVLH  565
             +SWDNYC+LF VVL 
Sbjct  122  AESWDNYCSLFSVVLQ  137



>gb|KIZ06502.1| hypothetical protein MNEG_1449 [Monoraphidium neglectum]
Length=531

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +2

Query  251  YDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            +  ++VPD VK FV +LYRHIRE+N+ EI  MYE SF  LSER FK  PWP VD V+  V
Sbjct  6    FAGDFVPDIVKQFVHYLYRHIRERNIPEIQSMYEISFPKLSERYFKSGPWPQVDLVSDLV  65

Query  431  DNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            D DHVFCLLY+E++FRHL+A+  P L+ R +SWDNYC LF V+LH
Sbjct  66   DQDHVFCLLYKELYFRHLFAKTQPGLRARCESWDNYCELFGVILH  110



>ref|XP_003061585.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54215.1| predicted protein [Micromonas pusilla CCMP1545]
Length=616

 Score =   147 bits (371),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VPD VK FV + YRHIREKNVYEI  MYE SF ++SE+ FK +PWP  +AVA + DNDHV
Sbjct  11   VPDMVKQFVVYFYRHIREKNVYEILSMYEKSFPAISEKYFKASPWPHAEAVARFADNDHV  70

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F L+Y+E++FRH+Y +++PTL+QR +SWDNYC LF +VL 
Sbjct  71   FGLMYKELYFRHVYGKVTPTLEQRCESWDNYCALFDIVLQ  110



>gb|EMT29163.1| hypothetical protein F775_30790 [Aegilops tauschii]
Length=677

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            MA++YD EDG  +  Q H     ++YDPNYVPD VK+FV HLYRHIR+KNVYEIHQMYE 
Sbjct  1    MASAYDREDG-LAPPQPHGGGPADAYDPNYVPDSVKTFVVHLYRHIRDKNVYEIHQMYEG  59

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREM  469
             FQ LS+R+F+DTPWPS +AVAPY D DHVF LLYRE+
Sbjct  60   GFQRLSDRLFRDTPWPSAEAVAPYCDGDHVFLLLYREL  97



>ref|XP_002509169.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70427.1| predicted protein [Micromonas sp. RCC299]
Length=519

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  278  VKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLL  457
            V+ FV + YRHIREKNVYEI  MYE SF ++SER FK + WPS +A+A Y DNDHVF LL
Sbjct  2    VRQFVVYFYRHIREKNVYEILSMYEKSFSAISERYFKASSWPSAEAIARYADNDHVFGLL  61

Query  458  YREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            Y+EM+FRH+Y + +PTL QR +SW+NYCNLF V+LH
Sbjct  62   YKEMYFRHVYGKTTPTLDQRKESWENYCNLFGVILH  97



>ref|XP_005645053.1| hypothetical protein COCSUDRAFT_54338 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20509.1| hypothetical protein COCSUDRAFT_54338 [Coccomyxa subellipsoidea 
C-169]
Length=532

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VPD VK FV + YRHIRE+N+ EI  MYE SF  LSER FK T WP V+ +A  VD D V
Sbjct  15   VPDMVKQFVVYFYRHIRERNIPEIFSMYEVSFAKLSERFFKGTTWPPVEYIAELVDKDSV  74

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVL  562
            FCLLY+EM+FRHLYA + PTL+QR +SWDNYC +F ++L
Sbjct  75   FCLLYKEMYFRHLYATVQPTLEQRCESWDNYCAIFNIML  113



>ref|XP_006654164.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Oryza brachyantha]
Length=522

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 78/113 (69%), Gaps = 4/113 (4%)
 Frame = +2

Query  230  SDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSV  409
            S  ++ +YDP+YVPD VK+FV HLYRHIR++NVYE HQMYE  F  LS R          
Sbjct  21   SSGAMAAYDPSYVPDSVKTFVSHLYRHIRDRNVYETHQMYEGGFHRLSARPLXXX---XX  77

Query  410  DAVAPYVDNDHVFCLLYREMWFRHLYARLSP-TLKQRIDSWDNYCNLFQVVLH  565
             A AP+ D DHVF LLYRE+WFRH +ARL   T  QR +SWDNYC+LF V+L 
Sbjct  78   GAGAPHCDGDHVFLLLYRELWFRHAHARLQGLTPAQRAESWDNYCSLFSVILQ  130



>ref|XP_001691635.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04743.1| predicted protein [Chlamydomonas reinhardtii]
Length=528

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VPD VK +  + YRHIRE+N+ EI  MYE SF  LS+R +K +PWP V  +A  VD+DHV
Sbjct  10   VPDIVKQWAHYFYRHIRERNIPEIQSMYEISFLKLSDRYYKASPWPEVQHIAEVVDHDHV  69

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVL  562
            FCLLY+EM+FRHLYAR  PTL+ R +SWDNY +LF ++L
Sbjct  70   FCLLYKEMYFRHLYARCQPTLRDRCESWDNYIDLFGLLL  108



>ref|XP_005849793.1| hypothetical protein CHLNCDRAFT_57223 [Chlorella variabilis]
 gb|EFN57691.1| hypothetical protein CHLNCDRAFT_57223 [Chlorella variabilis]
Length=519

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  PNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDN  436
            P  VP  V  F   LYRHIRE+N+ E++ MY  +F  LSER FK + WP+VD+V P VD 
Sbjct  11   PAPVPKMVADFCQFLYRHIRERNINEVYVMYSHTFPHLSERFFKGSTWPTVDSVLPLVDG  70

Query  437  DHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            DHVF LLY+EM++RHLYA   PTL+QR+DSWDNY  LF V+L+
Sbjct  71   DHVFGLLYKEMYYRHLYASTKPTLEQRMDSWDNYRELFSVILN  113



>gb|KDD75677.1| RNA polymerase I-associated factor PAF67 [Helicosporidium sp. 
ATCC 50920]
Length=525

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  257  PNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDN  436
            P  VP  V+ FV + YRHIR++NV EI+ MY  +F  LSER FK T WP V A++  VD+
Sbjct  11   PAPVPKMVQDFVVYCYRHIRQRNVREIYTMYSLTFPHLSERYFKGTSWPPVSAISHLVDH  70

Query  437  DHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVL  562
            DHVFC+LYREM FRHLYA+  PT+ QR +SW NY  LFQVVL
Sbjct  71   DHVFCMLYREMTFRHLYAKARPTVAQRAESWANYAALFQVVL  112



>ref|XP_005773357.1| hypothetical protein EMIHUDRAFT_463792 [Emiliania huxleyi CCMP1516]
 gb|EOD20928.1| hypothetical protein EMIHUDRAFT_463792 [Emiliania huxleyi CCMP1516]
Length=390

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 90/129 (70%), Gaps = 7/129 (5%)
 Frame = +2

Query  179  ATSYDYE-DGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYET  355
            A+++D +  GS +T + ++ +++E      +P+ V+ FV +  + ++  NVYE+H  YE 
Sbjct  21   ASAFDVDASGSGTTAEVYTSATVE------LPEVVRLFVVYFNKQLKSGNVYEVHSAYEA  74

Query  356  SFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDN  535
            +F  L++R++K +PWP+ + V+P V  D  F LLYRE++FRHLY+RL+PTL+QRIDSW N
Sbjct  75   TFNKLTDRLYKTSPWPTAEVVSPLVGGDATFLLLYRELYFRHLYSRLTPTLQQRIDSWAN  134

Query  536  YCNLFQVVL  562
            Y  LF ++L
Sbjct  135  YEALFSLLL  143



>ref|XP_002949019.1| hypothetical protein VOLCADRAFT_73984 [Volvox carteri f. nagariensis]
 gb|EFJ49954.1| hypothetical protein VOLCADRAFT_73984 [Volvox carteri f. nagariensis]
Length=529

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +P  V  +  + Y HIRE+N+ EI  MYE SF  LS+R +K  PWP V  +   VD DHV
Sbjct  17   IPHLVNQWAYYFYHHIRERNIDEIQSMYEVSFLKLSDRYYKAAPWPEVQHIQEVVDQDHV  76

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVL  562
            FCLLY+EM+FRHLYAR  PTL+ R DSWDNYC+LF ++L
Sbjct  77   FCLLYKEMYFRHLYARCQPTLRDRCDSWDNYCDLFGLLL  115



>ref|XP_005706478.1| hypothetical protein Gasu_27420 [Galdieria sulphuraria]
 gb|EME29958.1| hypothetical protein Gasu_27420 [Galdieria sulphuraria]
Length=539

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VP+ V+ F+ +  +  RE NV E+H +YETSF   SER FK T WP+ +  A YVDND V
Sbjct  40   VPESVQQFLSYFRQKFREGNVSEVHTLYETSFNRYSERYFKTTSWPNPEIAAKYVDNDEV  99

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F L Y+E+++RH+Y+RL PTL QR+++WDNYC+LF  +L+
Sbjct  100  FLLFYKELYYRHIYSRLQPTLAQRVEAWDNYCDLFNFILN  139



>ref|XP_001420552.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98845.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=502

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +2

Query  272  DPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFC  451
            D VK FV + YRHIREKNVYE   MYE SF ++ ER FK T WP+ DA+A Y +ND VF 
Sbjct  8    DAVKQFVTYFYRHIREKNVYETLTMYERSFPAIGERFFKKTAWPTPDAIATYAENDPVFK  67

Query  452  LLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            +LY E+++RHL+   +P+  +R  SW+NYC LF  +LH
Sbjct  68   MLYAELYYRHLHQATTPSANERKGSWENYCELFGALLH  105



>ref|XP_011444762.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Crassostrea gigas]
Length=549

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VPD +KSF+ +  + I E+NVYEI   YE  F  L+ER FK +PWP  + VAP V NDH+
Sbjct  48   VPDIIKSFLTYFQKSITEQNVYEIQNAYENGFNKLTERFFKTSPWPEAEVVAPIVQNDHL  107

Query  446  FCLLYREMWFRHLYARL--SPTLKQRIDSWDNYCNLFQVVLH  565
            F +LY+E+++RH+YAR+   PTL+QR +S+ NYCNLF  +L+
Sbjct  108  FLILYKELFYRHIYARVQNGPTLEQRFESYYNYCNLFNYILN  149



>ref|XP_001630146.1| predicted protein [Nematostella vectensis]
 sp|A7SDW5.1|EIF3L_NEMVE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l [Nematostella vectensis]
 gb|EDO38083.1| predicted protein [Nematostella vectensis]
Length=525

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 85/135 (63%), Gaps = 7/135 (5%)
 Frame = +2

Query  173  TMATSYDYEDGSY----STKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIH  340
            T A  YD  D  Y    S  Q   D S+ SY+   VP+ +K F+   ++H+ E+N+YEI 
Sbjct  3    TQADEYDGGDAGYEDDYSGYQGDGDDSVGSYN---VPEEIKRFIHFFHQHVLEQNLYEIQ  59

Query  341  QMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRI  520
             +YE  F  L++R F  TPWP  + +AP V  D VF +LY+E+++RH+Y +L PT++QR 
Sbjct  60   SIYENGFNKLTDRYFNKTPWPEAEFIAPLVSGDQVFLILYKELYYRHIYNKLKPTVEQRF  119

Query  521  DSWDNYCNLFQVVLH  565
            +S+ NYC+LF  +L+
Sbjct  120  ESYYNYCDLFNYILN  134



>ref|XP_011395819.1| Eukaryotic translation initiation factor 3 subunit L [Auxenochlorella 
protothecoides]
 gb|KFM22953.1| Eukaryotic translation initiation factor 3 subunit L [Auxenochlorella 
protothecoides]
Length=511

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +2

Query  278  VKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLL  457
            V+ FV + YRHIRE+N+ EI  MY  +F  LSER FK   WP V+AV+  VDNDHVFC+L
Sbjct  2    VQDFVVYFYRHIRERNIREIFVMYSHTFPHLSERFFKGVAWPPVEAVSHLVDNDHVFCML  61

Query  458  YREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVL  562
            Y+EM FRHL+A   PTL  RI SW+NY   F V+L
Sbjct  62   YKEMCFRHLHAAAKPTLAHRIASWENYREFFSVIL  96



>dbj|GAN05046.1| eukaryotic translation initiation factor 3 subunit 6 [Mucor ambiguus]
Length=530

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PD V++F+ H YR++ + NVYE+H +Y++SF  L+E+ ++   WP  + VAP V++D V
Sbjct  47   IPDGVRNFILHFYRNVIDNNVYELHNIYDSSFNKLTEKYYQKQAWPEAEVVAPLVNDDQV  106

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+YA L+PTL+QR  S++NYC+LF  +L+
Sbjct  107  FLTLYRELYYRHIYAHLTPTLEQRFHSYENYCDLFNYILN  146



>gb|EIE77654.1| hypothetical protein RO3G_02358 [Rhizopus delemar RA 99-880]
Length=529

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PDPVK+F+   YR + + N+YE+H +Y+TSF  L+E+ ++  PWP  + VAP V++D +
Sbjct  47   IPDPVKNFIHQFYRSVMDNNIYELHIIYDTSFNKLTEKYYRKQPWPEAEVVAPLVNDDQI  106

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+Y+ L+PTL+ R  S++NYC+LF  +L+
Sbjct  107  FLTLYRELYYRHIYSFLTPTLEHRFRSYENYCDLFNYILN  146



>gb|ESA14939.1| hypothetical protein GLOINDRAFT_24425 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX53467.1| hypothetical protein RirG_243530 [Rhizophagus irregularis DAOM 
197198w]
Length=545

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +P+ VK+F+ + +R+I E NVYE+H +YE SF  L+E+ +  TPWP  D +AP V++D V
Sbjct  53   IPEVVKNFIIYFHRNILENNVYELHGIYENSFNRLTEKFYAKTPWPEADYIAPLVNDDQV  112

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+Y++L+PT++ R  S++NYC+LF  +L+
Sbjct  113  FLTLYRELYYRHIYSKLTPTIEHRFHSYENYCDLFNFILN  152



>gb|EPB85480.1| hypothetical protein HMPREF1544_07753 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=530

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PD V++F+ H YR++ + NVYE+H +Y++SF  L+E+ ++   WP  + +AP V++D V
Sbjct  47   IPDGVRNFILHFYRNVIDNNVYELHNIYDSSFNKLTEKYYQKQAWPEAEVIAPLVNDDQV  106

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+YA L+PTL QR  S++NYC+LF  +L+
Sbjct  107  FLTLYRELYYRHIYAHLTPTLDQRFHSYENYCDLFNYILN  146



>emb|CCJ28091.1| unnamed protein product, partial [Pneumocystis jirovecii]
Length=1076

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 85/126 (67%), Gaps = 7/126 (6%)
 Frame = +2

Query  188  YDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQS  367
            YD     YST+    + SLES     +PD V+ F+ + Y  + + NVYE+H  YE+ F  
Sbjct  73   YDENHILYSTR---PEISLEST----IPDAVRGFITYFYNALFQNNVYELHGCYESLFNK  125

Query  368  LSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNL  547
            L+E+ +K+TPWP  + ++P V++D  F + YRE++FRH+YA+L PT++QR  S+DNYC+L
Sbjct  126  LTEKYYKNTPWPDAETISPLVNDDSYFMIFYRELYFRHIYAKLQPTIEQRFQSYDNYCDL  185

Query  548  FQVVLH  565
            F ++L+
Sbjct  186  FNLILN  191



>dbj|BAK07615.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = +2

Query  260  NYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDND  439
            +++PD VK FV  LYR IR  +V+  +Q+Y+  F  LS+R+++D  WPS  AVAPY D+D
Sbjct  28   DHIPDSVKGFVSDLYRSIRGGDVFGANQLYDGDFHRLSDRVYRDARWPSAKAVAPYCDDD  87

Query  440  HVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVL  562
            HVF LLY E+  RH +ARL   T+  R DSWD YC+LF VVL
Sbjct  88   HVFLLLYSELTSRHAHARLPGLTVTHRADSWDTYCSLFAVVL  129



>emb|CEP10774.1| hypothetical protein [Parasitella parasitica]
Length=530

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PD V++FV H YR++ + NVYE+H +Y++SF  L+E+ ++   WP  + +A  V++D V
Sbjct  47   IPDGVRNFVLHFYRNVIDNNVYELHNIYDSSFNKLTEKYYQKQAWPEAEVIASLVNDDQV  106

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+YA L+PTL+QR  S++NYC+LF  +L+
Sbjct  107  FLTLYRELYYRHIYAHLTPTLEQRFHSYENYCDLFNYILN  146



>ref|XP_004344304.2| eukaryotic translation initiation factor 3 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE96343.1| eukaryotic translation initiation factor 3 [Capsaspora owczarzaki 
ATCC 30864]
Length=599

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  260  NYVPDPVKSFVGHLYRHIRE-KNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDN  436
            N +PD V  F+    R + E KNV EI  +Y+  F   +ER +K+ PWPS D +AP VDN
Sbjct  110  NGIPDIVAKFLIFFQRTLAENKNVNEITSVYDGGFAQTTERYYKNAPWPSADLIAPLVDN  169

Query  437  DHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            D  F +LY+E+++RH+YARL+PTL+QR++S++NYC+LF  +L+
Sbjct  170  DTFFLILYKELYYRHIYARLTPTLEQRLESYENYCDLFDFILN  212



>emb|CEG65880.1| Putative Eukaryotic translation initiation factor 3 subunit L 
[Rhizopus microsporus]
Length=530

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PD VK+F+   YR++ + NVYE+H +Y++SF  L+E+ F+   WP  + +A  V++D V
Sbjct  47   IPDSVKNFILQFYRNVMDNNVYELHNVYDSSFNKLTEKYFQKQAWPEAEVIASLVNDDQV  106

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+Y+ L+PTL+QR  S++NYC+LF  +L+
Sbjct  107  FLTLYRELYYRHIYSHLTPTLEQRFQSYENYCDLFNYILN  146



>ref|XP_009014305.1| hypothetical protein HELRODRAFT_185444 [Helobdella robusta]
 gb|ESO07694.1| hypothetical protein HELRODRAFT_185444 [Helobdella robusta]
Length=548

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 82/132 (62%), Gaps = 8/132 (6%)
 Frame = +2

Query  188  YDYEDGSYSTKQQHSDSSLESYDPNY-------VPDPVKSFVGHLYRHIREKNVYEIHQM  346
            Y Y+ G Y          LE YD  Y       +P+ +KSF+ +  + I +++V+EI   
Sbjct  19   YAYQAGDYGMHTGDPHQDLE-YDRQYMQKGSFILPEVIKSFLVYFQKSIHDQDVFEIQNA  77

Query  347  YETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDS  526
            YE  F  L+ER F ++PWP  + VA Y+ ND VF +LY+E+++RH+YA+ +PT  QRI+S
Sbjct  78   YENGFNKLTERFFSNSPWPEAEDVAKYIQNDGVFLILYKELYYRHIYAKFTPTFNQRIES  137

Query  527  WDNYCNLFQVVL  562
            + NYC+LF +++
Sbjct  138  FQNYCHLFNLII  149



>ref|XP_011273777.1| hypothetical protein BN7_3948 [Wickerhamomyces ciferrii]
 emb|CCH44385.1| hypothetical protein BN7_3948 [Wickerhamomyces ciferrii]
Length=533

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +2

Query  245  ESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPS-VDAVA  421
            ES     +P+PV+ F+   Y+   + NVYE+H  YE +F  L+E+ +K++PWP  ++ V 
Sbjct  3    ESTKQTPIPEPVEEFIKTFYKAFLDNNVYELHGCYENNFNKLTEQYYKNSPWPEPIEQVG  62

Query  422  PYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            P V++D +F +LY E+++RH+YARL+PTL+ R  S++NYCNLF ++L+
Sbjct  63   PLVNDDQIFLVLYSEVYYRHIYARLNPTLEHRTGSYNNYCNLFNLLLN  110



>ref|XP_011503899.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Ceratosolen solmsi marchali]
Length=504

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +2

Query  242  LESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVA  421
            L+S +   VP+ VK F+ +L+  I E  ++EI  +YE +F  LSE++F   PWP    ++
Sbjct  22   LDSRNFRQVPEVVKKFLIYLHNCINEGMIFEIQNLYENTFPKLSEQLFDTIPWPEESQIS  81

Query  422  PYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
              VDND+VF  LY+E++FRH+YAR+ P LKQRID++ NYC+LF  +L+
Sbjct  82   ELVDNDYVFITLYKELYFRHIYARMQPNLKQRIDAFFNYCDLFNYILN  129



>ref|XP_002736781.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Saccoglossus kowalevskii]
Length=554

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 91/148 (61%), Gaps = 19/148 (13%)
 Frame = +2

Query  179  ATSYDYEDGSYST-KQQHSDSSLESYDPN----------------YVPDPVKSFVGHLYR  307
            A   +Y+  SYS   QQ  D  + + DP                  +P+ +K+F+   ++
Sbjct  12   AAGTEYDPYSYSGYAQQEGDFEMHTGDPRQDLAYERQYEQTVPSYIIPEVIKNFIHFFHK  71

Query  308  HIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLY  487
             I E N++E++ +YE+SF  L+ER FK++PWP  + VAP VD D +F +LY+E+++RH+Y
Sbjct  72   CINEGNLFEVNNLYESSFNKLTERFFKNSPWPEAEHVAPVVDRDPLFVILYKELYYRHIY  131

Query  488  ARLS--PTLKQRIDSWDNYCNLFQVVLH  565
            A+++  PT +QR +S+ NYCNLF  +L+
Sbjct  132  AKVTGGPTQEQRFESYYNYCNLFNYILN  159



>ref|XP_002591162.1| hypothetical protein BRAFLDRAFT_287258 [Branchiostoma floridae]
 gb|EEN47173.1| hypothetical protein BRAFLDRAFT_287258 [Branchiostoma floridae]
Length=546

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VPD +K F+ + ++ + + NV+EI  +YE SF  L+ER FK +PWP  + + P V ND V
Sbjct  50   VPDVIKRFIEYFHKCVTDGNVFEIGNIYENSFNKLTERFFKTSPWPEAEYIMPLVKNDTV  109

Query  446  FCLLYREMWFRHLYARL--SPTLKQRIDSWDNYCNLFQVVLH  565
            F +LY+E++FRH+YA++   P L+QR +S+ NYCNLF  +L+
Sbjct  110  FLILYKELYFRHIYAKVQGGPNLEQRFESYYNYCNLFNYILN  151



>ref|XP_004932950.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Bombyx mori]
Length=541

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 85/138 (62%), Gaps = 9/138 (7%)
 Frame = +2

Query  176  MATSYDYEDGSYSTKQQHSDSSLESYDPNY-------VPDPVKSFVGHLYRHIREKNVYE  334
            M +S DY +G Y +   +   S E Y+P Y       +PD VK F+ +    I E   YE
Sbjct  1    MYSSDDYNEGGYESYGDYEAQSTEHYEPEYDRSSYYKMPDMVKKFLVYFRNMINEGVTYE  60

Query  335  IHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARL--SPTL  508
            I  +YE +F +L+E+ F++TPWP  D V+P VDND+VF +LY+E+++R +YAR+   P  
Sbjct  61   ILNLYENTFPTLTEKYFENTPWPDEDEVSPIVDNDNVFMILYKELYYRDIYARVPGGPKP  120

Query  509  KQRIDSWDNYCNLFQVVL  562
            +QR  S+ NYC+LF  +L
Sbjct  121  EQRFHSFYNYCDLFNYIL  138



>gb|ELT93773.1| hypothetical protein CAPTEDRAFT_152273 [Capitella teleta]
Length=552

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +P+ +K+F+ +  + I E+N+YEI   YE  F  L++R FK++PWP  D V P V ND +
Sbjct  53   IPEVIKNFLTYFQKVIAEQNIYEIQNSYENGFNQLTDRFFKNSPWPEADVVEPLVKNDFL  112

Query  446  FCLLYREMWFRHLYARL--SPTLKQRIDSWDNYCNLFQVVLH  565
            F +LY+E+++RH+YAR+   PTL+QR +S+ NYC+LF  +L+
Sbjct  113  FLILYKELFYRHVYARVQGGPTLEQRFESYHNYCSLFNYILN  154



>gb|AGM32740.1| RNA polymerase I-associated factor PAF67, partial [Coptotermes 
formosanus]
Length=281

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +2

Query  227  HSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPS  406
            H+DS  E    N +P+ VK F+ +    I E  ++EI  +YETSF  L+E+ F+  PWP 
Sbjct  31   HTDSDYERQSYN-IPEMVKKFLTYFRNCISEGLIFEIQNLYETSFPKLTEQYFEKKPWPD  89

Query  407  VDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVVLH  565
               VA  VDND VF +LY+E++FRH+YAR+S  PTL+QR +S+ NYC+LF  +L+
Sbjct  90   ESDVARLVDNDQVFLILYKELYFRHIYARVSGCPTLEQRFNSFFNYCDLFNYILN  144



>gb|KFH65880.1| hypothetical protein MVEG_07983 [Mortierella verticillata NRRL 
6337]
Length=538

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  230  SDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSV  409
            +D   + Y    +P+ VK+F+   +R+I E NVYE+  +YE SF  L+E+ +    WP  
Sbjct  30   ADQVPQQYQEVQIPEVVKNFILFFHRNILENNVYELQAIYEHSFNKLTEKFYAKESWPEP  89

Query  410  DAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            +A++P V++D VF  LYRE+++RH+Y+RL+PT++ R  S++NYC+LF  +L+
Sbjct  90   EAISPLVNDDQVFLTLYRELYYRHIYSRLTPTIEHRFHSYENYCDLFNYILN  141



>gb|ETE71168.1| Eukaryotic translation initiation factor 3 subunit L [Ophiophagus 
hannah]
Length=563

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 90/162 (56%), Gaps = 37/162 (23%)
 Frame = +2

Query  191  DYEDGSYSTKQQHSDSSLESYDPN---------------YVPDPVKSFVGHLYRHIRE--  319
            DY++GSY       D  L + DP                 +P+ +K+F+ + ++ + +  
Sbjct  7    DYDEGSYDPYAYTGDYDLHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLI  66

Query  320  ------------------KNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
                              + VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND V
Sbjct  67   DQKVYELQASRISSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAV  126

Query  446  FCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVVLH  565
            F +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  127  FLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYILN  168



>ref|XP_003385511.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Amphimedon queenslandica]
Length=537

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 83/135 (61%), Gaps = 10/135 (7%)
 Frame = +2

Query  173  TMATSYDYEDGSYSTKQQHSDSSL----ESYDPNYVPDPVKSFVGHLYRHIREKNVYEIH  340
            T  TSY+      +T  Q S++S+    E +   Y+P+ VK F+ + Y+ I+ K V EI 
Sbjct  21   TQGTSYE------ATASQGSNASVPPTEEDHPDLYIPEEVKQFLPYFYKQIKNKVVPEIL  74

Query  341  QMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRI  520
             +YE  F  LS+R FK+ PWP    +AP+V+ND +F +L+ E+ +RH+YA+  PT++ R 
Sbjct  75   NIYENEFNRLSDRYFKEFPWPEAKRIAPFVNNDEIFLILFEELRYRHIYAKHKPTIEHRF  134

Query  521  DSWDNYCNLFQVVLH  565
            +S+  YC+ F  +L+
Sbjct  135  ESFQRYCDFFDAILN  149



>gb|EHJ64982.1| putative eukaryotic translation initiation factor 3 [Danaus plexippus]
Length=592

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 85/143 (59%), Gaps = 15/143 (10%)
 Frame = +2

Query  170  STMATSYDYEDGSYSTKQQHSDSSLESYDPNY----------VPDPVKSFVGHLYRHIRE  319
            STM +S DY +G Y +   + D    + DP Y          +PD VK F+ +    I E
Sbjct  2    STMYSSDDYNEGGYES---YGDYEPHTGDPQYDLEYDRSYYQMPDMVKKFLVYFRNMITE  58

Query  320  KNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARL-  496
               +EI  +YE +F  L+E+ F++TPWPS   VAP VDNDHVF +LY+E+++R +YAR+ 
Sbjct  59   GVTFEILNLYENTFPKLTEQFFENTPWPSEKEVAPVVDNDHVFMILYKELYYRDIYARVP  118

Query  497  -SPTLKQRIDSWDNYCNLFQVVL  562
              P  +QR  S+ NYC+LF  +L
Sbjct  119  GGPKPEQRFLSFYNYCDLFNYIL  141



>ref|XP_007434464.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Python bivittatus]
Length=563

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 90/162 (56%), Gaps = 37/162 (23%)
 Frame = +2

Query  191  DYEDGSYSTKQQHSDSSLESYDPN---------------YVPDPVKSFVGHLYRHIRE--  319
            DY++GSY       D  L + DP                 +P+ +K+F+ + ++ + +  
Sbjct  7    DYDEGSYDPYAYPGDYDLHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLI  66

Query  320  ------------------KNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
                              + VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND V
Sbjct  67   DQKVYELQASRISSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAV  126

Query  446  FCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVVLH  565
            F +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  127  FLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYILN  168



>gb|EIE89576.1| hypothetical protein RO3G_14287 [Rhizopus delemar RA 99-880]
Length=529

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PD V++F+   YR + + N+YE+H +Y+ SF  L+E+ ++   WP  + +A  V++D V
Sbjct  47   IPDSVRNFILQFYRSVMDNNIYELHGIYDNSFNKLTEKYYQKQAWPEAEVIASLVNDDQV  106

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LYRE+++RH+Y+ L+PTL+ R  S++NYC+LF  +L+
Sbjct  107  FLTLYRELYYRHVYSHLTPTLEHRFRSYENYCDLFNYILN  146



>ref|XP_003727128.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform 1 [Strongylocentrotus purpuratus]
Length=550

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +2

Query  233  DSSLESYDPNY-VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSV  409
            D S    +P Y VP+ +K F+     HIR+KNVY+I+  YET+F  LSE  FK++ WPS 
Sbjct  40   DFSRRGANPTYIVPEDIKRFLLDFQGHIRDKNVYDINHCYETTFNKLSESYFKNSSWPSA  99

Query  410  DAVAPYVDNDHVFCLLYREMWFRHLYARL--SPTLKQRIDSWDNYCNLFQVVLH  565
            + V   V+ND VF +LY+E+++RH+ AR    P  +QR +S+ NYCNLF  +L+
Sbjct  100  EIVGEIVNNDEVFLILYKELYYRHILARTPSGPDQQQRFESYYNYCNLFNYILN  153



>ref|XP_795841.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform 2 [Strongylocentrotus purpuratus]
Length=550

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +2

Query  233  DSSLESYDPNY-VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSV  409
            D S    +P Y VP+ +K F+     HIR+KNVY+I+  YET+F  LSE  FK++ WPS 
Sbjct  40   DFSRRGANPTYIVPEDIKRFLLDFQGHIRDKNVYDINHCYETTFNKLSESYFKNSSWPSA  99

Query  410  DAVAPYVDNDHVFCLLYREMWFRHLYARL--SPTLKQRIDSWDNYCNLFQVVLH  565
            + V   V+ND VF +LY+E+++RH+ AR    P  +QR +S+ NYCNLF  +L+
Sbjct  100  EIVGEIVNNDEVFLILYKELYYRHILARTPSGPDQQQRFESYYNYCNLFNYILN  153



>emb|CEF99744.1| Translation initiation factor 3 complex subunit L [Ostreococcus 
tauri]
Length=500

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
             P+  ++FV   Y H+R KNVYE   MYE SF ++ ER FK   WP+   +A   DND V
Sbjct  4    APEHARAFVRCAYGHVRAKNVYETLAMYERSFAAIGERYFKGKSWPAPRDMADLYDNDGV  63

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F  LY E+++RHL+A  +P+  +R  +WDNYC LF + LH
Sbjct  64   FGALYGELYYRHLHAETTPSANERKGAWDNYCELFGIALH  103



>gb|KFU98436.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Pterocles gutturalis]
Length=334

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>ref|XP_010074072.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Pterocles gutturalis]
Length=335

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  24   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  83

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  84   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  143

Query  560  LH  565
            L+
Sbjct  144  LN  145



>ref|XP_011337689.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Cerapachys biroi]
 gb|EZA55063.1| Eukaryotic translation initiation factor 3 subunit L [Cerapachys 
biroi]
Length=538

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  257  PNY--VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            P+Y  VP+ V++F+  L   I E  ++EI  +YE SF  LSE++F  +PWP    +A  V
Sbjct  29   PSYRQVPEMVRNFLVFLRNCINEGMIFEIQNLYENSFPKLSEQLFDKSPWPDASTIAHIV  88

Query  431  DNDHVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            DND VF  LY+E+++RH+YAR+  PTL+QR++S+ NYC+LF  +LH
Sbjct  89   DNDPVFLTLYKELYYRHIYARMQGPTLEQRLNSFYNYCDLFNYILH  134



>gb|EGI70009.1| Eukaryotic translation initiation factor 3 subunit L [Acromyrmex 
echinatior]
Length=530

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +2

Query  245  ESYD-PNY--VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDA  415
            + YD P+Y  VP+ V++F+  L   I E  ++EI  +YE SF  +SE++F  +PWP    
Sbjct  13   DQYDRPSYRQVPEVVRNFLVFLRNCINEGMIFEIQNLYENSFPKISEQLFDKSPWPDAST  72

Query  416  VAPYVDNDHVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            +A  VDND VF  LY+E+++RH+YAR+  PTL+QR++S+ NYC+LF  +LH
Sbjct  73   IAHIVDNDAVFLTLYKELYYRHIYARMQGPTLEQRLNSFYNYCDLFNYILH  123



>ref|XP_005039809.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Ficedula albicollis]
Length=564

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +KSF+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKSFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>ref|XP_011172791.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Solenopsis invicta]
Length=538

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  257  PNY--VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            P+Y  VP+ V++F+  L   I E  ++EI  +YE SF  +SE++F  +PWP    +A  V
Sbjct  26   PSYRQVPEVVRNFLVFLRNCINEGMIFEIQNLYENSFPKISEQLFDKSPWPDASTIAHIV  85

Query  431  DNDHVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            DND VF  LY+E+++RH+YAR+  PTL+QR++S+ NYC+LF  +LH
Sbjct  86   DNDAVFLTLYKELYYRHIYARMQGPTLEQRLNSFYNYCDLFNYILH  131



>ref|XP_011065299.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Acromyrmex echinatior]
Length=538

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  257  PNY--VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            P+Y  VP+ V++F+  L   I E  ++EI  +YE SF  +SE++F  +PWP    +A  V
Sbjct  26   PSYRQVPEVVRNFLVFLRNCINEGMIFEIQNLYENSFPKISEQLFDKSPWPDASTIAHIV  85

Query  431  DNDHVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            DND VF  LY+E+++RH+YAR+  PTL+QR++S+ NYC+LF  +LH
Sbjct  86   DNDAVFLTLYKELYYRHIYARMQGPTLEQRLNSFYNYCDLFNYILH  131



>emb|CDS09409.1| hypothetical protein LRAMOSA10769 [Absidia idahoensis var. thermophila]
Length=534

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  PNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDN  436
            P  +PD V++F+    R+I E NV ++H  Y+ +F  LS++ +   PWP  + +AP V+N
Sbjct  45   PAQIPDGVRNFILCFNRYILENNVLDLHNAYDNTFNKLSDKHYSKQPWPEAELIAPLVNN  104

Query  437  DHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            D V   LYRE+++RH+Y R+ PTL+ R  S++NYC+LF  +L+
Sbjct  105  DEVILTLYRELYYRHIYRRMVPTLEHRFRSYENYCDLFNYILN  147



>ref|XP_004451669.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like, partial [Dasypus novemcinctus]
Length=250

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  P+L+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>gb|KFP49293.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Cathartes aura]
Length=425

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  57   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  116

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  117  KVSGGPTLEQRFESYYNYCNLFNYILN  143



>ref|XP_011252594.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Camponotus floridanus]
Length=538

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  257  PNY--VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            P+Y  VP+ V++F+  L   I E  ++EI  +YE SF  +SE++F  +PWP    +A  V
Sbjct  26   PSYRQVPEVVRNFLVFLRNCINEGMIFEIQNLYENSFPKISEQLFDKSPWPEASTIAHIV  85

Query  431  DNDHVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            DND VF  LY+E+++RH+YAR+  PTL+QR++S+ NYC+LF  +LH
Sbjct  86   DNDPVFLTLYKELYYRHIYARMQGPTLEQRLNSFYNYCDLFNYILH  131



>gb|EFN70839.1| Eukaryotic translation initiation factor 3 subunit E-interacting 
protein [Camponotus floridanus]
Length=554

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +2

Query  257  PNY--VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYV  430
            P+Y  VP+ V++F+  L   I E  ++EI  +YE SF  +SE++F  +PWP    +A  V
Sbjct  42   PSYRQVPEVVRNFLVFLRNCINEGMIFEIQNLYENSFPKISEQLFDKSPWPEASTIAHIV  101

Query  431  DNDHVFCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            DND VF  LY+E+++RH+YAR+  PTL+QR++S+ NYC+LF  +LH
Sbjct  102  DNDPVFLTLYKELYYRHIYARMQGPTLEQRLNSFYNYCDLFNYILH  147



>emb|CDK25674.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=569

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  PNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDN  436
            P  +P+P+ SF  + Y+   + NVYE++  YE SF  ++E+ FK++ WP    ++  V+N
Sbjct  30   PASIPEPLISFFKYWYKSYLDNNVYELYGCYENSFNKITEKFFKNSSWPLPSDISSLVNN  89

Query  437  DHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            D VF +LY E ++RH+Y++L+PTL+ R  S++NYCNLF ++L+
Sbjct  90   DQVFIILYSECYYRHIYSKLNPTLEIRTGSYNNYCNLFNLILN  132



>ref|XP_009663621.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Struthio camelus australis]
Length=606

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  90   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  149

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  150  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  209

Query  560  LH  565
            L+
Sbjct  210  LN  211



>ref|XP_005101845.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X1 [Aplysia californica]
Length=565

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VP+ +K+F+ H  + I+E+N+ EI   YE  F  L++R FK + WPS   +AP V N+  
Sbjct  63   VPEVIKNFLLHFQQVIKEQNLVEIQNNYENGFNKLTDRFFKTSAWPSAKVIAPIVGNEER  122

Query  446  FCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVVLH  565
            F +LY E++FRH+YAR+S  P+L QR DS+ NYC+LF  +L+
Sbjct  123  FLILYNELFFRHVYARVSSGPSLDQRFDSYYNYCSLFNYILN  164



>ref|XP_005101846.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X2 [Aplysia californica]
Length=558

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VP+ +K+F+ H  + I+E+N+ EI   YE  F  L++R FK + WPS   +AP V N+  
Sbjct  63   VPEVIKNFLLHFQQVIKEQNLVEIQNNYENGFNKLTDRFFKTSAWPSAKVIAPIVGNEER  122

Query  446  FCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVVLH  565
            F +LY E++FRH+YAR+S  P+L QR DS+ NYC+LF  +L+
Sbjct  123  FLILYNELFFRHVYARVSSGPSLDQRFDSYYNYCSLFNYILN  164



>gb|KFP91933.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Apaloderma vittatum]
Length=528

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKLYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>ref|XP_008634828.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Corvus brachyrhynchos]
Length=562

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  46   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  105

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  106  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  165

Query  560  LH  565
            L+
Sbjct  166  LN  167



>ref|XP_005446835.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Falco cherrug]
Length=530

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  74   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  133

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  134  KVSGGPTLEQRFESYYNYCNLFNYILN  160



>gb|KFV19153.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Tauraco erythrolophus]
Length=517

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  56   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  115

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  116  KVSGGPTLEQRFESYYNYCNLFNYILN  142



>gb|KFU83581.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Chaetura pelagica]
Length=550

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  37   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  96

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  97   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  156

Query  560  LH  565
            L+
Sbjct  157  LN  158



>gb|KFQ12757.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Leptosomus discolor]
Length=533

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  72   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  131

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  132  KVSGGPTLEQRFESYYNYCNLFNYILN  158



>gb|EOB03942.1| Eukaryotic translation initiation factor 3 subunit E-interacting 
protein, partial [Anas platyrhynchos]
Length=537

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  21   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  80

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  81   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  140

Query  560  LH  565
            L+
Sbjct  141  LN  142



>gb|KFQ24519.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Merops nubicus]
Length=553

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  37   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  96

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  97   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  156

Query  560  LH  565
            L+
Sbjct  157  LN  158



>gb|KFM02149.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Aptenodytes forsteri]
 gb|KFO05336.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Balearica regulorum gibbericeps]
 gb|KFQ76170.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Phoenicopterus ruber ruber]
 gb|KFQ81279.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Phaethon lepturus]
 gb|KFV39733.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Gavia stellata]
 gb|KFV95043.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Eurypyga helias]
 gb|KFZ51203.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Podiceps cristatus]
Length=538

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>gb|KFO61273.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Corvus brachyrhynchos]
Length=548

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  37   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  96

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  97   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  156

Query  560  LH  565
            L+
Sbjct  157  LN  158



>gb|KGL83796.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Tinamus guttatus]
Length=533

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  56   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  115

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  116  KVSGGPTLEQRFESYYNYCNLFNYILN  142



>ref|XP_008948320.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Merops nubicus]
Length=555

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  39   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  98

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  99   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  158

Query  560  LH  565
            L+
Sbjct  159  LN  160



>ref|XP_002198918.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Taeniopygia guttata]
 ref|XP_005488657.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Zonotrichia albicollis]
 ref|XP_005527658.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Pseudopodoces humilis]
 ref|XP_009084740.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Serinus canaria]
Length=564

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>gb|KFV94330.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Fulmarus glacialis]
Length=538

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>gb|KFW87339.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Manacus vitellinus]
Length=553

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  37   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  96

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  97   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  156

Query  560  LH  565
            L+
Sbjct  157  LN  158



>gb|KFW73179.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Pygoscelis adeliae]
 gb|KGL90715.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Charadrius vociferus]
Length=538

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>ref|XP_008929890.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Manacus vitellinus]
Length=558

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  42   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  101

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  102  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  161

Query  560  LH  565
            L+
Sbjct  162  LN  163



>ref|XP_010134484.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Buceros rhinoceros silvestris]
Length=537

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  21   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  80

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  81   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  140

Query  560  LH  565
            L+
Sbjct  141  LN  142



>gb|KFR13278.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Opisthocomus hoazin]
Length=537

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  57   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  116

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  117  KVSGGPTLEQRFESYYNYCNLFNYILN  143



>gb|KFQ49039.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Pelecanus crispus]
Length=538

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  57   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  116

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  117  KVSGGPTLEQRFESYYNYCNLFNYILN  143



>gb|KFV75696.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Struthio camelus australis]
Length=537

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  21   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  80

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  81   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  140

Query  560  LH  565
            L+
Sbjct  141  LN  142



>ref|XP_005150417.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Melopsittacus undulatus]
Length=564

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>gb|KFP56635.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Cariama cristata]
Length=540

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  24   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  83

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  84   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  143

Query  560  LH  565
            L+
Sbjct  144  LN  145



>ref|XP_010222472.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Tinamus guttatus]
Length=537

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  60   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  119

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  120  KVSGGPTLEQRFESYYNYCNLFNYILN  146



>ref|XP_010154288.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Eurypyga helias]
Length=541

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  60   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  119

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  120  KVSGGPTLEQRFESYYNYCNLFNYILN  146



>gb|KFV68894.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Picoides pubescens]
Length=567

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 77/121 (64%), Gaps = 22/121 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  49   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  108

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  109  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  168

Query  560  L  562
            L
Sbjct  169  L  169



>ref|XP_005514772.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Columba livia]
Length=550

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  69   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  128

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  129  KVSGGPTLEQRFESYYNYCNLFNYILN  155



>gb|KFO89757.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Buceros rhinoceros silvestris]
Length=538

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>ref|NP_001012553.1| eukaryotic translation initiation factor 3 subunit L [Gallus 
gallus]
 ref|XP_010709447.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Meleagris gallopavo]
 sp|Q5F428.1|EIF3L_CHICK RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l [Gallus gallus]
 emb|CAH65106.1| hypothetical protein RCJMB04_3l6 [Gallus gallus]
Length=564

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>ref|XP_005016066.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Anas platyrhynchos]
Length=542

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  61   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  120

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  121  KVSGGPTLEQRFESYYNYCNLFNYILN  147



>gb|KFP38786.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Chlamydotis macqueenii]
Length=527

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  56   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  115

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  116  KVSGGPTLEQRFESYYNYCNLFNYILN  142



>gb|KFQ20375.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Mesitornis unicolor]
Length=552

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  36   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  95

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  96   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  155

Query  560  LH  565
            L+
Sbjct  156  LN  157



>ref|XP_005421984.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Geospiza fortis]
Length=562

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  46   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  105

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  106  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  165

Query  560  LH  565
            L+
Sbjct  166  LN  167



>gb|KFQ45813.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Nestor notabilis]
Length=543

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  72   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  131

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  132  KVSGGPTLEQRFESYYNYCNLFNYILN  158



>ref|XP_010203293.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Colius striatus]
Length=539

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  64   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  123

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  124  KVSGGPTLEQRFESYYNYCNLFNYILN  150



>gb|KFV39542.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Tyto alba]
Length=538

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  22   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  81

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  82   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  141

Query  560  LH  565
            L+
Sbjct  142  LN  143



>ref|XP_009951253.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Leptosomus discolor]
Length=552

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  74   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  133

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  134  KVSGGPTLEQRFESYYNYCNLFNYILN  160



>gb|KFR08886.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Nipponia nippon]
Length=547

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  72   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  131

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  132  KVSGGPTLEQRFESYYNYCNLFNYILN  158



>ref|XP_009986435.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Tauraco erythrolophus]
Length=530

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  65   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  124

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  125  KVSGGPTLEQRFESYYNYCNLFNYILN  151



>ref|XP_009580499.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Fulmarus glacialis]
Length=546

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  65   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  124

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  125  KVSGGPTLEQRFESYYNYCNLFNYILN  151



>ref|XP_009693369.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Cariama cristata]
Length=542

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  61   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  120

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  121  KVSGGPTLEQRFESYYNYCNLFNYILN  147



>ref|XP_010007524.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Nestor notabilis]
Length=558

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  37   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  96

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  97   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  156

Query  560  LH  565
            L+
Sbjct  157  LN  158



>ref|XP_009808556.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Gavia stellata]
Length=554

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  73   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  132

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  133  KVSGGPTLEQRFESYYNYCNLFNYILN  159



>ref|XP_010192463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Mesitornis unicolor]
Length=559

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  43   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  102

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  103  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  162

Query  560  LH  565
            L+
Sbjct  163  LN  164



>gb|KFO81701.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Cuculus canorus]
Length=565

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  49   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  108

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  109  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  168

Query  560  LH  565
            L+
Sbjct  169  LN  170



>ref|XP_009491962.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Pelecanus crispus]
Length=544

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  63   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  122

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  123  KVSGGPTLEQRFESYYNYCNLFNYILN  149



>ref|XP_010409202.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Corvus cornix cornix]
Length=543

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  27   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  86

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  87   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  146

Query  560  LH  565
            L+
Sbjct  147  LN  148



>ref|XP_010171584.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Caprimulgus carolinensis]
Length=550

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  70   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  129

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  130  KVSGGPTLEQRFESYYNYCNLFNYILN  156



>dbj|BAG57085.1| unnamed protein product [Homo sapiens]
Length=222

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLF  550
            ++S  P+L+QR +S+ NYCNLF
Sbjct  143  KVSGGPSLEQRFESYYNYCNLF  164



>ref|XP_010291773.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Phaethon lepturus]
Length=549

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  33   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  92

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  93   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  152

Query  560  LH  565
            L+
Sbjct  153  LN  154



>ref|XP_005232975.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Falco peregrinus]
Length=590

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  112  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  171

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  172  KVSGGPTLEQRFESYYNYCNLFNYILN  198



>ref|XP_010003703.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Chaetura pelagica]
Length=573

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  85   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  144

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  145  KVSGGPTLEQRFESYYNYCNLFNYILN  171



>ref|XP_009566703.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Cuculus canorus]
Length=564

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>ref|XP_009074070.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Acanthisitta chloris]
Length=551

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  37   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  96

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  97   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  156

Query  560  LH  565
            L+
Sbjct  157  LN  158



>ref|XP_009288372.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Aptenodytes forsteri]
Length=553

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  72   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  131

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  132  KVSGGPTLEQRFESYYNYCNLFNYILN  158



>ref|XP_003707707.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Megachile rotundata]
Length=538

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            VP+ V++F+  L   I E  +++I  +YETSF  +SE++F  + WP   A+A  VDND V
Sbjct  32   VPEVVRNFLVFLRNCINEGMIFDIQNLYETSFPKISEQLFDKSSWPDAQAIAHIVDNDPV  91

Query  446  FCLLYREMWFRHLYARL-SPTLKQRIDSWDNYCNLFQVVLH  565
            F  LY+E+++RH+YAR+  PTL+QRI S+ NYC+LF  +LH
Sbjct  92   FLTLYKELYYRHIYARMQGPTLEQRIGSFYNYCDLFNYILH  132



>ref|XP_010303092.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Balearica regulorum gibbericeps]
Length=553

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  72   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  131

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  132  KVSGGPTLEQRFESYYNYCNLFNYILN  158



>ref|XP_009330944.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Pygoscelis adeliae]
Length=562

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  73   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  132

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  133  KVSGGPTLEQRFESYYNYCNLFNYILN  159



>ref|XP_009964570.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Tyto alba]
Length=545

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  64   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  123

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  124  KVSGGPTLEQRFESYYNYCNLFNYILN  150



>ref|XP_001601481.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Nasonia vitripennis]
Length=542

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 79/127 (62%), Gaps = 3/127 (2%)
 Frame = +2

Query  182  TSYDYEDGSYSTKQQHSDSSLESYDPNYVPDPVKSFVGHLYRHIREKNVYEIHQMYETSF  361
            T Y Y+D  Y   ++H +     Y    +P+ VK F+  L ++I+E  ++EI  +YE +F
Sbjct  9    TDYVYDD--YGQPEEHLEG-YGRYSSRQMPEVVKKFLVLLRKYIKEGMIFEIQNLYENTF  65

Query  362  QSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLSPTLKQRIDSWDNYC  541
              LS++ F+  PWPS   +   VD DHVF  LY E+++RH+YA ++PTL+QRI S+ NYC
Sbjct  66   PKLSDQYFEKIPWPSDQQINHIVDGDHVFLTLYMELYYRHIYACMTPTLEQRIQSFYNYC  125

Query  542  NLFQVVL  562
             LF  +L
Sbjct  126  ELFNYIL  132



>ref|XP_009874065.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Apaloderma vittatum]
Length=558

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  73   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  132

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  133  KVSGGPTLEQRFESYYNYCNLFNYILN  159



>gb|KFM78528.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Stegodyphus mimosarum]
Length=511

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +P+ V++F+ +L + I E NVYE+  MYE S+  L+ER +K TPWP    VA  V +D  
Sbjct  13   IPEVVRNFLMYLAKAINEGNVYELQSMYENSYVKLTERFYKTTPWPLAKDVASIVHDDET  72

Query  446  FCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVVL  562
            F +LY+E+++RHLYAR+S  P++ +R++S+ NYC LF ++L
Sbjct  73   FDILYKELYYRHLYARVSGGPSISERLESYFNYCRLFNLIL  113



>ref|XP_009936110.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Opisthocomus hoazin]
Length=560

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  66   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  125

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  126  KVSGGPTLEQRFESYYNYCNLFNYILN  152



>ref|XP_009473560.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Nipponia nippon]
Length=619

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  138  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  197

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  198  KVSGGPTLEQRFESYYNYCNLFNYILN  224



>ref|XP_009880194.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Charadrius vociferus]
Length=575

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  94   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  153

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  154  KVSGGPTLEQRFESYYNYCNLFNYILN  180



>ref|XP_009501133.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Phalacrocorax carbo]
Length=545

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  87   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  146

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  147  KVSGGPTLEQRFESYYNYCNLFNYILN  173



>ref|XP_010127677.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L, partial [Chlamydotis macqueenii]
Length=560

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  75   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  134

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  PTL+QR +S+ NYCNLF  +L+
Sbjct  135  KVSGGPTLEQRFESYYNYCNLFNYILN  161



>dbj|BAE88430.1| unnamed protein product [Macaca fascicularis]
Length=357

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 79/122 (65%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ +L++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYLHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  P+L+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHVYAKVSGGPSLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>ref|XP_004662214.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Jaculus jaculus]
Length=431

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_008177541.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Chrysemys picta bellii]
Length=561

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  45   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  104

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  P+L+QR +S+ NYCNLF  +
Sbjct  105  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYI  164

Query  560  LH  565
            L+
Sbjct  165  LN  166



>ref|XP_006724323.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Homo sapiens]
Length=580

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  126  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  185

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  186  KVSGGPSLEQRFESYYNYCNLFNYILN  212



>ref|XP_001090065.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform 2 [Macaca mulatta]
Length=580

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  126  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  185

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  186  KVSGGPSLEQRFESYYNYCNLFNYILN  212



>emb|CAG30322.1| dJ1014D13.1 [Homo sapiens]
 emb|CAK54466.1| EIF3S6IP [synthetic construct]
 emb|CAK54765.1| EIF3S6IP [synthetic construct]
 dbj|BAG72548.1| eukaryotic translation initiation factor 3, subunit E interacting 
protein [synthetic construct]
Length=607

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  126  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  185

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  186  KVSGGPSLEQRFESYYNYCNLFNYILN  212



>ref|XP_008567995.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Galeopterus variegatus]
Length=525

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_003905570.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Papio anubis]
Length=608

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  127  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  186

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  187  KVSGGPSLEQRFESYYNYCNLFNYILN  213



>dbj|BAG51631.1| unnamed protein product [Homo sapiens]
Length=607

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  126  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  185

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  186  KVSGGPSLEQRFESYYNYCNLFNYILN  212



>ref|XP_006757481.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Myotis davidii]
Length=571

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  90   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  149

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  150  KVSGGPSLEQRFESYYNYCNLFNYILN  176



>gb|EHH20219.1| hypothetical protein EGK_03027 [Macaca mulatta]
Length=607

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  126  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  185

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  186  KVSGGPSLEQRFESYYNYCNLFNYILN  212



>ref|XP_006166301.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Tupaia chinensis]
Length=612

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  131  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  190

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  191  KVSGGPSLEQRFESYYNYCNLFNYILN  217



>gb|EDL04675.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Mus musculus]
Length=565

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  84   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  143

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  144  KVSGGPSLEQRFESYYNYCNLFNYILN  170



>ref|XP_006865333.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Chrysochloris asiatica]
Length=536

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_008142863.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Eptesicus fuscus]
Length=553

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|NP_988980.1| eukaryotic translation initiation factor 3 subunit L [Xenopus 
(Silurana) tropicalis]
 sp|Q6P878.1|EIF3L_XENTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6-interacting protein; AltName: Full=Eukaryotic 
translation initiation factor 3 subunit E-interacting 
protein [Xenopus (Silurana) tropicalis]
 gb|AAH61351.1| eukaryotic translation initiation factor 3, subunit L [Xenopus 
(Silurana) tropicalis]
Length=562

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  46   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  105

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K++PWP  +A+AP V ND VF +LY+E+++RH+YA++S  PTL+QR +S+ NYCNLF  +
Sbjct  106  KNSPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPTLEQRFESYYNYCNLFNYI  165

Query  560  LH  565
            L+
Sbjct  166  LN  167



>pdb|3J8B|L Chain L, Model Of The Human Eif3 Pci-mpn Octamer Docked Into 
The 43s-hcv Ires Em Map
 pdb|3J8C|L Chain L, Model Of The Human Eif3 Pci-mpn Octamer Docked Into 
The 43s Em Map
Length=540

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  48   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  107

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  P+L+QR +S+ NYCNLF  +
Sbjct  108  KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYI  167

Query  560  LH  565
            L+
Sbjct  168  LN  169



>gb|EFB26726.1| hypothetical protein PANDA_002501 [Ailuropoda melanoleuca]
Length=526

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIRE--------------------KNVYEIHQMYETSFQSLSERMF  385
            +P+ +K+F+ + ++ + +                    + VYEI  +YE S+  L+ER F
Sbjct  21   IPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFF  80

Query  386  KDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYARLS--PTLKQRIDSWDNYCNLFQVV  559
            K+TPWP  +A+AP V ND VF +LY+E+++RH+YA++S  P+L+QR +S+ NYCNLF  +
Sbjct  81   KNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYI  140

Query  560  LH  565
            L+
Sbjct  141  LN  142



>emb|CAC84554.1| 67 kDa polymerase-associated factor PAF67 [Mus musculus]
Length=564

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_007069166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Chelonia mydas]
Length=540

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  59   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  118

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  119  KVSGGPSLEQRFESYYNYCNLFNYILN  145



>ref|XP_004065481.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L [Gorilla gorilla gorilla]
Length=613

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  131  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  190

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  191  KVSGGPSLEQRFESYYNYCNLFNYILN  217



>dbj|BAE40238.1| unnamed protein product [Mus musculus]
Length=564

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|NP_660121.2| eukaryotic translation initiation factor 3 subunit L [Mus musculus]
 sp|Q8QZY1.1|EIF3L_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=66 kDa tyrosine-rich heat 
shock protein; AltName: Full=67 kDa polymerase-associated factor; 
AltName: Full=Eukaryotic translation initiation factor 
3 subunit 6-interacting protein; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit E-interacting protein; 
AltName: Full=HSP-66Y; AltName: Full=PAF67 [Mus musculus]
 dbj|BAB85122.1| tyrosine-rich heat shock protein [Mus musculus]
 gb|AAH24463.1| Eukaryotic translation initiation factor 3, subunit L [Mus musculus]
 dbj|BAC28090.1| unnamed protein product [Mus musculus]
 dbj|BAC35837.1| unnamed protein product [Mus musculus]
 dbj|BAE29941.1| unnamed protein product [Mus musculus]
 dbj|BAE30177.1| unnamed protein product [Mus musculus]
 dbj|BAE39996.1| unnamed protein product [Mus musculus]
Length=564

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_008849507.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Nannospalax galili]
 ref|XP_011217121.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Ailuropoda melanoleuca]
Length=540

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  59   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  118

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  119  KVSGGPSLEQRFESYYNYCNLFNYILN  145



>ref|XP_005379287.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Chinchilla lanigera]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_004373903.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 3 [Trichechus manatus latirostris]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_001514662.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Ornithorhynchus anatinus]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|NP_001128679.1| eukaryotic translation initiation factor 3 subunit L [Pan troglodytes]
 sp|A5A6M4.1|EIF3L_PANTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6-interacting protein; AltName: Full=Eukaryotic 
translation initiation factor 3 subunit E-interacting 
protein [Pan troglodytes]
 dbj|BAF62397.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Pan troglodytes verus]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>gb|KIY69436.1| hypothetical protein CYLTODRAFT_420727 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=559

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  266  VPDPVKSFVGHLYRHIREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHV  445
            +PDPVK+F+ H ++ ++E N+ EI   YE+ +   +E+ +  T WP  + +AP V++D++
Sbjct  14   IPDPVKNFIVHFHKAVKENNLAEISAAYESGWNRFTEKFYAKTEWPEAEIIAPLVNDDNI  73

Query  446  FCLLYREMWFRHLYARLSPTLKQRIDSWDNYCNLFQVVLH  565
            F +LYRE+++RH+Y+RL P +  R  S++N C LF  +L+
Sbjct  74   FLILYRELYYRHVYSRLQPNIDDRFHSYENSCELFNYLLN  113



>ref|XP_003821622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Pan paniscus]
Length=607

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  126  VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  185

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  186  KVSGGPSLEQRFESYYNYCNLFNYILN  212



>ref|XP_010611532.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Fukomys damarensis]
 gb|KFO36691.1| Eukaryotic translation initiation factor 3 subunit L [Fukomys 
damarensis]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_003989299.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Felis catus]
 ref|XP_007079456.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Panthera tigris altaica]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_003510323.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Cricetulus griseus]
 ref|XP_005067032.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Mesocricetus auratus]
 ref|XP_005354270.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Microtus ochrogaster]
 ref|XP_006979194.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Peromyscus maniculatus bairdii]
 ref|XP_007622836.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Cricetulus griseus]
 gb|ERE85142.1| eukaryotic translation initiation factor 3 subunit L-like protein 
[Cricetulus griseus]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_002743807.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Callithrix jacchus]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>gb|EDM15826.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Rattus norvegicus]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|NP_001238869.1| eukaryotic translation initiation factor 3, subunit L [Canis 
lupus familiaris]
 ref|XP_001501256.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 1 [Equus caballus]
 ref|XP_004410843.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 3 [Odobenus rosmarus divergens]
 ref|XP_006914808.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Pteropus alecto]
 ref|XP_008542583.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Equus przewalskii]
 ref|XP_008703792.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Ursus maritimus]
 ref|XP_008849506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Nannospalax galili]
 ref|XP_010387520.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Rhinopithecus roxellana]
 ref|XP_010597635.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Loxodonta africana]
 ref|XP_011217120.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Ailuropoda melanoleuca]
 ref|XP_011385928.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Pteropus vampyrus]
 gb|ELK10242.1| Eukaryotic translation initiation factor 3 subunit L [Pteropus 
alecto]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_007519391.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Erinaceus europaeus]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



>ref|XP_005883277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Myotis brandtii]
 gb|EPQ18305.1| Eukaryotic translation initiation factor 3 subunit L [Myotis 
brandtii]
Length=564

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  IREKNVYEIHQMYETSFQSLSERMFKDTPWPSVDAVAPYVDNDHVFCLLYREMWFRHLYA  490
            + ++ VYEI  +YE S+  L+ER FK+TPWP  +A+AP V ND VF +LY+E+++RH+YA
Sbjct  83   VIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYA  142

Query  491  RLS--PTLKQRIDSWDNYCNLFQVVLH  565
            ++S  P+L+QR +S+ NYCNLF  +L+
Sbjct  143  KVSGGPSLEQRFESYYNYCNLFNYILN  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960