BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF017P08

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004917040.1|  PREDICTED: histone H3.2-like isoform X2            240   2e-77   
ref|XP_003621457.1|  Histone H3                                         243   3e-77   
ref|XP_007971598.1|  PREDICTED: histone H3.1-like                       239   9e-77   Chlorocebus sabaeus
ref|XP_008669428.1|  PREDICTED: histone H3.2-like                       241   2e-76   
ref|XP_006401653.1|  hypothetical protein EUTSA_v10014731mg             239   2e-76   
ref|XP_007014942.1|  Histone superfamily protein                        238   2e-76   
ref|XP_007483400.1|  PREDICTED: histone H3.2-like                       239   2e-76   
ref|XP_008663191.1|  PREDICTED: histone H3.2-like                       238   2e-76   
ref|XP_010708157.1|  PREDICTED: histone H3-like                         238   3e-76   
gb|KGN66469.1|  hypothetical protein Csa_1G612925                       237   4e-76   Cucumis sativus [cucumbers]
gb|KJB27089.1|  hypothetical protein B456_004G277300                    238   4e-76   Gossypium raimondii
gb|KCW51227.1|  hypothetical protein EUGRSUZ_J00806                     237   5e-76   Eucalyptus grandis [rose gum]
gb|KDP29737.1|  hypothetical protein JCGZ_18672                         236   6e-76   Jatropha curcas
emb|CBH32561.1|  histone H3, expressed                                  236   6e-76   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001238509.1|  uncharacterized protein LOC100306416               235   7e-76   Glycine max [soybeans]
ref|XP_006652279.1|  PREDICTED: histone H3.2-like                       235   8e-76   
gb|AAA32655.1|  histone H3 (H3-1.1)                                     235   8e-76   Medicago sativa [alfalfa]
ref|XP_006301260.1|  hypothetical protein CARUB_v10021660mg             236   9e-76   
ref|XP_009598129.1|  PREDICTED: histone H3.2-like                       235   9e-76   Nicotiana tomentosiformis
ref|NP_189372.1|  histone H3                                            235   9e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424704.1|  PREDICTED: histone H3-like centromeric prote...    241   9e-76   
ref|XP_005519548.1|  PREDICTED: histone H3.2-like isoform X1            235   1e-75   
gb|KJB67030.1|  hypothetical protein B456_010G171000                    237   1e-75   Gossypium raimondii
ref|XP_007013423.1|  Histone superfamily protein                        238   1e-75   
ref|XP_001862683.1|  histone H3.1t                                      236   1e-75   Culex quinquefasciatus
ref|XP_001177217.2|  PREDICTED: histone H3, embryonic-like              235   1e-75   
emb|CDP18134.1|  unnamed protein product                                235   1e-75   Coffea canephora [robusta coffee]
gb|AFK39648.1|  unknown                                                 235   1e-75   Medicago truncatula
ref|XP_005461835.1|  PREDICTED: histone H3.2-like isoform X2            238   1e-75   
ref|XP_003082036.1|  Histones H3 and H4 (ISS)                           236   1e-75   
gb|KJB71213.1|  hypothetical protein B456_011G110600                    236   2e-75   Gossypium raimondii
emb|CEF62715.1|  Histone H3                                             234   2e-75   Strongyloides ratti
ref|XP_002962371.1|  hypothetical protein SELMODRAFT_78992              234   2e-75   Selaginella moellendorffii
ref|XP_008461433.1|  PREDICTED: histone H3.v1-like                      241   2e-75   Cucumis melo [Oriental melon]
gb|AAV65112.1|  histone 3                                               234   2e-75   Camellia sinensis [black tea]
ref|XP_004252600.1|  PREDICTED: histone H3.2-like                       234   2e-75   Solanum lycopersicum
ref|XP_006368568.1|  hypothetical protein POPTR_0001s05450g             237   2e-75   
ref|XP_001753449.1|  histone H3                                         234   2e-75   
sp|P08903.2|H32_ENCAL  RecName: Full=Histone H3.2                       234   3e-75   Encephalartos altensteinii
ref|XP_004384835.1|  PREDICTED: histone H3.1t-like isoform 1            234   3e-75   
ref|XP_005852293.1|  hypothetical protein CHLNCDRAFT_28967              234   3e-75   Chlorella variabilis
ref|XP_003630193.1|  Histone H3                                         237   3e-75   
ref|XP_001862696.1|  Histone H3c                                        235   3e-75   Culex quinquefasciatus
ref|XP_008669425.1|  PREDICTED: histone H3.2-like                       235   3e-75   Zea mays [maize]
gb|EFZ22370.1|  hypothetical protein SINV_16114                         234   3e-75   
ref|XP_004229367.1|  PREDICTED: histone H3.2-like                       234   3e-75   Solanum lycopersicum
ref|XP_001865500.1|  histone H3.3 type 2                                234   3e-75   Culex quinquefasciatus
gb|AAA33907.1|  histone 3                                               234   3e-75   Oryza sativa [red rice]
ref|XP_001745925.1|  hypothetical protein                               234   3e-75   Monosiga brevicollis MX1
gb|ACN40064.1|  unknown                                                 234   3e-75   Picea sitchensis
sp|Q402E1.3|H32_LILLO  RecName: Full=Histone H3.2                       234   3e-75   Lilium longiflorum [Easter lily]
ref|XP_002502604.1|  histone H3                                         234   3e-75   Micromonas commoda
ref|XP_010260926.1|  PREDICTED: histone H3.2-like                       234   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_001418070.1|  predicted protein                                  234   3e-75   Ostreococcus lucimarinus CCE9901
ref|XP_009782179.1|  PREDICTED: histone H3.2-like                       234   4e-75   Nicotiana sylvestris
gb|ACG25071.1|  histone H3                                              233   4e-75   Zea mays [maize]
ref|NP_001104686.1|  histone cluster 3, H3                              233   4e-75   Danio rerio [leopard danio]
ref|XP_004562239.1|  PREDICTED: histone H3.2-like                       233   4e-75   
ref|XP_003770651.1|  PREDICTED: histone H3.2-like                       233   4e-75   
emb|CCD60248.1|  histone H3, putative                                   233   4e-75   Schistosoma mansoni
ref|XP_005527779.1|  PREDICTED: histone H3.2-like isoform X1            233   4e-75   
gb|EPY79586.1|  histone H3.2-like protein                               234   4e-75   Camelus ferus
ref|XP_003977328.1|  PREDICTED: histone H3.2-like                       234   4e-75   
ref|XP_001620157.1|  hypothetical protein NEMVEDRAFT_v1g148952          233   5e-75   Nematostella vectensis
gb|EMC89182.1|  Histone H3                                              233   5e-75   
ref|XP_003384122.1|  PREDICTED: histone H3-like                         233   5e-75   Amphimedon queenslandica
ref|NP_038576.1|  histone H3.2                                          233   5e-75   Mus musculus [mouse]
gb|ELU16492.1|  hypothetical protein CAPTEDRAFT_90093                   233   5e-75   Capitella teleta
ref|XP_001619077.1|  hypothetical protein NEMVEDRAFT_v1g227757          233   5e-75   Nematostella vectensis
ref|XP_003769946.1|  PREDICTED: histone H3.2-like                       235   5e-75   
ref|XP_004139024.1|  PREDICTED: histone H3.2-like                       233   5e-75   
ref|XP_005756396.1|  putative histone H3                                233   5e-75   Emiliania huxleyi CCMP1516
ref|XP_004562913.1|  PREDICTED: histone H3-like centromeric prote...    238   6e-75   
ref|XP_003788936.1|  PREDICTED: histone H3.1-like                       234   6e-75   
ref|XP_009601229.1|  PREDICTED: histone H3.2-like                       233   6e-75   Nicotiana tomentosiformis
ref|XP_005337122.1|  PREDICTED: histone H3.2-like                       233   6e-75   
ref|XP_003113948.1|  hypothetical protein CRE_27089                     233   6e-75   Caenorhabditis remanei
gb|KDP20192.1|  hypothetical protein JCGZ_07912                         236   6e-75   Jatropha curcas
gb|EGI60526.1|  Histone H3                                              233   6e-75   Acromyrmex echinatior
ref|XP_011088023.1|  PREDICTED: histone H3.2-like                       235   6e-75   
ref|XP_006162733.1|  PREDICTED: histone H3.1-like                       234   6e-75   Tupaia chinensis
ref|XP_001862674.1|  histone H3 type 2                                  233   6e-75   Culex quinquefasciatus
ref|XP_008331672.1|  PREDICTED: histone H3-like                         234   6e-75   
ref|XP_001632617.1|  predicted protein                                  236   6e-75   Nematostella vectensis
ref|XP_002164221.1|  PREDICTED: histone H3-like                         233   6e-75   Hydra vulgaris
ref|XP_001619752.1|  hypothetical protein NEMVEDRAFT_v1g231526          233   7e-75   Nematostella vectensis
ref|XP_001862705.1|  histone H3.2                                       234   7e-75   Culex quinquefasciatus
ref|XP_004933313.1|  PREDICTED: histone H3-like                         233   7e-75   Bombyx mori [silk moth]
ref|XP_003768748.1|  PREDICTED: histone H3.2-like                       233   7e-75   Sarcophilus harrisii
gb|AAI57347.1|  Unknown (protein for MGC:147886)                        233   7e-75   Xenopus tropicalis [western clawed frog]
ref|XP_001618260.1|  hypothetical protein NEMVEDRAFT_v1g196043          233   7e-75   Nematostella vectensis
pdb|3AV1|A  Chain A, The Human Nucleosome Structure Containing Th...    233   7e-75   Homo sapiens [man]
ref|XP_005150559.1|  PREDICTED: histone H3.2-like                       234   8e-75   
ref|XP_007177425.1|  PREDICTED: histone H3.1-like isoform X1            233   8e-75   Balaenoptera acutorostrata scammoni
gb|AEW46685.1|  histone type 2                                          233   8e-75   Ulva linza
ref|XP_001892001.1|  histone H3                                         233   8e-75   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003145584.1|  histone type 2                                     234   8e-75   
gb|AFI61666.1|  histone 3                                               233   8e-75   Ruditapes philippinarum [Japanese littleneck]
emb|CEF65438.1|  Histone H3                                             233   8e-75   Strongyloides ratti
ref|XP_002422632.1|  histone H3, putative                               233   8e-75   Pediculus humanus corporis [human body lice]
gb|KJB81635.1|  hypothetical protein B456_013G154100                    236   8e-75   Gossypium raimondii
ref|XP_004576699.1|  PREDICTED: histone H3.2-like                       233   8e-75   
ref|XP_006288773.1|  hypothetical protein CARUB_v10002094mg             234   8e-75   
ref|XP_002422654.1|  histone H3, putative                               233   9e-75   Pediculus humanus corporis [human body lice]
ref|XP_004977985.1|  PREDICTED: histone H3-like centromeric prote...    238   9e-75   
gb|AAO06264.1|  histone protein Hist2h3c1                               234   9e-75   Mus musculus [mouse]
gb|EFB20850.1|  hypothetical protein PANDA_018542                       233   9e-75   Ailuropoda melanoleuca
emb|CDS28816.1|  histone cluster 2, H3c2                                233   9e-75   Hymenolepis microstoma
gb|KHN31394.1|  Histone H3.3                                            234   1e-74   Glycine soja [wild soybean]
ref|XP_010919158.1|  PREDICTED: histone H3.3-like                       233   1e-74   Elaeis guineensis
ref|XP_004076085.2|  PREDICTED: histone H3-like                         234   1e-74   
ref|XP_004717866.1|  PREDICTED: histone H3.2-like                       233   1e-74   
gb|ACD37543.1|  histone H3                                              233   1e-74   Adineta vaga
gb|ACD37575.1|  histone H3                                              233   1e-74   Philodina roseola
ref|XP_004349092.1|  histone                                            233   1e-74   Capsaspora owczarzaki ATCC 30864
emb|CAA32434.1|  H3 histone                                             233   1e-74   Drosophila melanogaster
gb|EFB20876.1|  hypothetical protein PANDA_018573                       233   1e-74   Ailuropoda melanoleuca
emb|CAB02546.1|  histone H3                                             232   1e-74   Homo sapiens [man]
gb|AFI61670.1|  histone 3                                               232   1e-74   Ruditapes variegatus
ref|XP_011086031.1|  PREDICTED: histone H3.2-like                       232   1e-74   Sesamum indicum [beniseed]
gb|KFV65812.1|  Histone H3                                              232   1e-74   Picoides pubescens
ref|XP_001419259.1|  predicted protein                                  232   1e-74   Ostreococcus lucimarinus CCE9901
emb|CAR63687.1|  Putative protein similar to H3 histone, family 2...    233   1e-74   Angiostrongylus cantonensis
gb|EFB20847.1|  hypothetical protein PANDA_018538                       232   1e-74   Ailuropoda melanoleuca
ref|XP_003088464.1|  hypothetical protein CRE_05346                     232   1e-74   Caenorhabditis remanei
gb|EFB20869.1|  hypothetical protein PANDA_018566                       232   1e-74   Ailuropoda melanoleuca
gb|EFB20866.1|  hypothetical protein PANDA_018563                       232   1e-74   Ailuropoda melanoleuca
ref|XP_006801198.1|  PREDICTED: histone H3.3-like isoform X1            232   1e-74   Neolamprologus brichardi [lyretail cichlid]
ref|XP_001870860.1|  histone H3.2                                       233   1e-74   Culex quinquefasciatus
ref|XP_007179127.1|  PREDICTED: histone H3.1-like isoform X2            232   1e-74   Balaenoptera acutorostrata scammoni
ref|XP_005843780.1|  hypothetical protein CHLNCDRAFT_59160              232   1e-74   Chlorella variabilis
ref|XP_320335.2|  AGAP012197-PA                                         232   1e-74   Anopheles gambiae str. PEST
ref|XP_006024249.1|  PREDICTED: histone H3.2-like                       232   1e-74   
emb|CAA34274.1|  unnamed protein product                                232   1e-74   Mus musculus [mouse]
ref|XP_001061048.2|  PREDICTED: histone H3.1                            234   1e-74   
ref|XP_001640436.1|  predicted protein                                  232   1e-74   Nematostella vectensis
ref|XP_005066350.1|  PREDICTED: histone H3.2-like                       233   1e-74   
ref|XP_008992030.1|  PREDICTED: histone H3.1                            233   1e-74   
ref|XP_010547605.1|  PREDICTED: histone H3.2-like                       232   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_009345124.1|  PREDICTED: histone H3.2-like                       232   1e-74   Pyrus x bretschneideri [bai li]
ref|NP_001183546.1|  uncharacterized LOC100502113                       232   2e-74   Zea mays [maize]
ref|NP_003520.1|  histone H3.1                                          232   2e-74   Homo sapiens [man]
ref|XP_007513760.1|  histone H3                                         232   2e-74   Bathycoccus prasinos
ref|XP_010916783.1|  PREDICTED: histone H3-like centromeric prote...    237   2e-74   Elaeis guineensis
ref|XP_011496732.1|  PREDICTED: histone H3-like                         232   2e-74   Ceratosolen solmsi marchali
gb|AAY90124.1|  histone 3                                               232   2e-74   Rheum australe [Himalayan rhubarb]
gb|EFB21581.1|  hypothetical protein PANDA_016834                       232   2e-74   Ailuropoda melanoleuca
ref|XP_006024237.1|  PREDICTED: histone H3.2-like isoform X1            233   2e-74   
emb|CAN70652.1|  hypothetical protein VITISV_010022                     232   2e-74   Vitis vinifera
ref|XP_003724461.1|  PREDICTED: histone H3, embryonic-like              232   2e-74   Strongylocentrotus purpuratus [purple urchin]
ref|XP_008539398.1|  PREDICTED: histone H3.1-like                       232   2e-74   Equus przewalskii [Przewalski horse]
ref|XP_007163668.1|  hypothetical protein PHAVU_001G253800g             234   2e-74   Phaseolus vulgaris [French bean]
ref|XP_006580873.1|  PREDICTED: histone H3-like centromeric prote...    238   2e-74   Glycine max [soybeans]
pdb|3AFA|A  Chain A, The Human Nucleosome Structure                     232   2e-74   Homo sapiens [man]
ref|XP_002928569.2|  PREDICTED: histone H3.1-like                       233   2e-74   
ref|XP_003259196.1|  PREDICTED: histone H3.2-like isoform 1             232   2e-74   
ref|XP_004576419.1|  PREDICTED: histone H3.2-like                       232   2e-74   
ref|NP_001078516.1|  Histone H3.3                                       233   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KGB39314.1|  Histone H3                                              232   2e-74   Schistosoma haematobium
ref|XP_011347776.1|  PREDICTED: histone H3-like                         233   2e-74   
ref|XP_002045560.1|  GM19670                                            232   2e-74   Drosophila sechellia
dbj|BAA20144.1|  Histone H3                                             232   2e-74   Drosophila simulans
ref|XP_002633139.1|  Hypothetical protein CBG05838                      232   2e-74   Caenorhabditis briggsae
gb|AAP94665.1|  histone H3                                              232   2e-74   Mytilus chilensis
ref|XP_009166091.1|  hypothetical protein T265_13221                    231   2e-74   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_004712543.1|  PREDICTED: histone H3.2-like                       231   2e-74   
ref|XP_003770631.1|  PREDICTED: histone H3.2-like                       233   2e-74   
ref|WP_039311726.1|  hypothetical protein                               231   2e-74   Paenibacillus sp. IHB B 3415
ref|XP_003746445.1|  PREDICTED: uncharacterized protein LOC100902368    236   3e-74   
gb|AAX19362.1|  replacement histone H3.3                                231   3e-74   Ruditapes philippinarum [Japanese littleneck]
ref|XP_001967747.1|  GF18982                                            231   3e-74   Drosophila ananassae
gb|AFI61667.1|  histone 3                                               231   3e-74   Ruditapes philippinarum [Japanese littleneck]
ref|XP_003057560.1|  histone H3                                         231   3e-74   Micromonas pusilla CCMP1545
ref|XP_001505987.1|  PREDICTED: histone H3-like                         231   3e-74   
ref|XP_010830602.1|  PREDICTED: histone H3.1                            235   3e-74   Bison bison bison
ref|XP_003502227.1|  PREDICTED: histone H3.1                            231   3e-74   Cricetulus griseus [Chinese hamsters]
gb|AAI29431.1|  Zgc:113984 protein                                      231   3e-74   Danio rerio [leopard danio]
ref|XP_009623382.1|  PREDICTED: histone H3.2-like                       231   3e-74   Nicotiana tomentosiformis
gb|ACO08255.1|  Histone H3.3                                            231   3e-74   Oncorhynchus mykiss
ref|XP_782990.1|  PREDICTED: histone H3, embryonic-like                 231   3e-74   Strongylocentrotus purpuratus [purple urchin]
emb|CEF62250.1|  Histone H3                                             231   3e-74   Strongyloides ratti
ref|NP_001091119.1|  histone cluster 1, H3g protein                     231   3e-74   Xenopus laevis [clawed frog]
gb|ACO12509.1|  Histone H3                                              231   3e-74   Lepeophtheirus salmonis
ref|XP_002602751.1|  hypothetical protein BRAFLDRAFT_97692              231   3e-74   Branchiostoma floridae
ref|XP_002045486.1|  GM19351                                            231   3e-74   Drosophila sechellia
ref|XP_610495.1|  PREDICTED: histone H3                                 231   3e-74   
dbj|BAA93627.1|  histone H3                                             231   3e-74   Drosophila erecta
sp|Q64400.3|H32_CRILO  RecName: Full=Histone H3.2                       231   3e-74   Cricetulus longicaudatus [lesser long-tailed hamster]
ref|XP_003612851.1|  Histone H3                                         234   3e-74   
ref|XP_006851804.1|  hypothetical protein AMTR_s00041p00020660          231   3e-74   Amborella trichopoda
ref|XP_003109235.1|  hypothetical protein CRE_08233                     231   3e-74   Caenorhabditis remanei
pdb|3LEL|A  Chain A, Structural Insight Into The Sequence-Depende...    231   3e-74   Xenopus laevis [clawed frog]
ref|XP_006222460.1|  PREDICTED: histone H3-like                         233   3e-74   
ref|XP_011384484.1|  PREDICTED: histone H3                              231   3e-74   
ref|XP_002045602.1|  GM25125                                            231   3e-74   Drosophila sechellia
ref|XP_001657153.1|  AAEL003685-PA                                      231   3e-74   
emb|CDW60007.1|  Histone H3                                             231   3e-74   Trichuris trichiura
ref|XP_002586362.1|  hypothetical protein BRAFLDRAFT_108838             231   3e-74   Branchiostoma floridae
ref|XP_002045096.1|  GM19740                                            231   3e-74   Drosophila sechellia
gb|EGT42707.1|  hypothetical protein CAEBREN_09337                      231   3e-74   Caenorhabditis brenneri
ref|XP_008513087.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3         233   3e-74   Equus przewalskii [Przewalski horse]
prf||1202289A  histone H3                                               231   3e-74
ref|XP_001867717.1|  histone H3                                         232   3e-74   Culex quinquefasciatus
ref|XP_003746420.1|  PREDICTED: histone H3-like                         236   3e-74   
emb|CDQ58715.1|  unnamed protein product                                231   3e-74   Oncorhynchus mykiss
tpg|DAA55311.1|  TPA: histone H3.2                                      235   3e-74   
ref|NP_002098.1|  histone H3.3                                          231   3e-74   Homo sapiens [man]
ref|XP_010634570.1|  PREDICTED: histone H3.1-like                       233   3e-74   Fukomys damarensis [Damara mole rat]
ref|XP_005702922.1|  histone H3                                         231   3e-74   Galdieria sulphuraria
gb|AFK11045.1|  histone H3.3                                            231   3e-74   Callorhinchus milii [Australian ghost shark]
ref|XP_527253.2|  PREDICTED: histone H3.1-like                          232   3e-74   Pan troglodytes
dbj|BAD02413.1|  histone 3                                              231   3e-74   Drosophila pseudoobscura
ref|XP_002635330.1|  Hypothetical protein CBG01499                      231   3e-74   Caenorhabditis briggsae
dbj|BAD90754.1|  histone 3                                              231   3e-74   Conocephalum conicum
gb|AAB27669.2|  H3 histone                                              231   4e-74   Styela plicata
emb|CBI23573.3|  unnamed protein product                                231   4e-74   Vitis vinifera
ref|XP_008615723.1|  histone H3                                         231   4e-74   Saprolegnia diclina VS20
ref|XP_001623766.1|  predicted protein                                  231   4e-74   Nematostella vectensis
ref|XP_002743348.1|  PREDICTED: histone H3.3-like                       231   4e-74   Callithrix jacchus [common marmoset]
gb|AFY26276.1|  histone H3                                              231   4e-74   Plectorhinchus mediterraneus
gb|EYU30980.1|  hypothetical protein MIMGU_mgv1a014700mg                233   4e-74   Erythranthe guttata [common monkey flower]
ref|XP_002999294.1|  histone, putative                                  231   4e-74   Phytophthora infestans T30-4
ref|XP_005643646.1|  histone H3                                         231   4e-74   Coccomyxa subellipsoidea C-169
ref|XP_003979768.1|  PREDICTED: histone H3.2-like                       234   4e-74   
pdb|3AV2|A  Chain A, The Human Nucleosome Structure Containing Th...    231   4e-74   Homo sapiens [man]
ref|XP_002045405.1|  GM13629                                            231   4e-74   Drosophila sechellia
ref|XP_002985522.1|  hypothetical protein SELMODRAFT_269004             231   4e-74   Selaginella moellendorffii
ref|XP_007971657.1|  PREDICTED: histone H3.1-like                       231   4e-74   Chlorocebus sabaeus
ref|XP_004019074.1|  PREDICTED: histone H3.1-like                       231   4e-74   
ref|XP_002645157.1|  C. briggsae CBR-HIS-71 protein                     231   4e-74   Caenorhabditis briggsae
dbj|BAE31789.1|  unnamed protein product                                231   4e-74   Mus musculus [mouse]
gb|ACO07612.1|  Histone H3.3                                            231   4e-74   Oncorhynchus mykiss
gb|AAA48795.1|  histone H3                                              231   5e-74   Gallus gallus [bantam]
emb|CAP53901.1|  histone H3                                             231   5e-74   Xenoturbella bocki
gb|AFY26266.1|  histone H3                                              231   5e-74   Plectorhinchus mediterraneus
ref|XP_010186633.1|  PREDICTED: histone H3-like isoform X1              234   5e-74   Mesitornis unicolor
ref|XP_003999137.2|  PREDICTED: LOW QUALITY PROTEIN: histone H3.3       232   5e-74   
gb|EHH18025.1|  Histone H3/a                                            231   5e-74   Macaca mulatta [rhesus macaque]
gb|KJB17320.1|  hypothetical protein B456_003G041300                    231   5e-74   Gossypium raimondii
ref|XP_007471286.1|  PREDICTED: histone H3.1-like                       231   5e-74   Lipotes vexillifer [baiji]
emb|CAD38827.1|  histone h3.1                                           231   5e-74   Oikopleura dioica
ref|XP_002045660.1|  GM18832                                            231   5e-74   Drosophila sechellia
ref|XP_307081.3|  Anopheles gambiae str. PEST AGAP012709-PA             231   5e-74   Anopheles gambiae str. PEST
ref|XP_010916709.1|  PREDICTED: histone H3.3-like                       231   5e-74   Elaeis guineensis
ref|XP_005350046.1|  PREDICTED: histone H3.1-like                       231   5e-74   Microtus ochrogaster [prairie voles]
ref|NP_509344.1|  Protein HIS-71                                        231   5e-74   Caenorhabditis elegans [roundworm]
ref|XP_002045506.1|  GM11653                                            231   5e-74   Drosophila sechellia
pdb|3AZH|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    231   6e-74   Homo sapiens [man]
pdb|3AZG|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    231   6e-74   Homo sapiens [man]
pdb|3AZF|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    231   6e-74   Homo sapiens [man]
pdb|3AZE|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    231   6e-74   Homo sapiens [man]
pdb|3AYW|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    231   6e-74   Homo sapiens [man]
gb|KFK25377.1|  hypothetical protein AALP_AA8G105500                    231   6e-74   Arabis alpina [alpine rockcress]
ref|XP_009301168.1|  PREDICTED: histone H3                              231   6e-74   
ref|XP_010223166.1|  PREDICTED: histone H3-like                         231   6e-74   Tinamus guttatus
ref|XP_002729690.2|  PREDICTED: histone H3.3-like                       231   6e-74   Rattus norvegicus [brown rat]
ref|XP_010456468.1|  PREDICTED: histone H3-like centromeric prote...    236   6e-74   
gb|EMT02210.1|  Histone H3.3                                            231   6e-74   
ref|XP_001082339.1|  PREDICTED: histone H3.1t-like isoform 1            231   6e-74   
ref|XP_008830105.1|  PREDICTED: histone H3-like                         231   6e-74   Nannospalax galili
gb|KJE90506.1|  histone                                                 231   6e-74   Capsaspora owczarzaki ATCC 30864
gb|AFW71933.1|  histone H3                                              232   6e-74   
sp|P22843.2|H3_ACRFO  RecName: Full=Histone H3                          231   6e-74   Acropora formosa
ref|XP_009032312.1|  histone 3                                          231   6e-74   Aureococcus anophagefferens
ref|XP_010106281.1|  Histone                                            231   6e-74   
ref|XP_002930251.1|  PREDICTED: histone H3.1                            230   7e-74   Ailuropoda melanoleuca
ref|XP_003505638.2|  PREDICTED: uncharacterized protein LOC100759437    237   7e-74   Cricetulus griseus [Chinese hamsters]
ref|XP_009059617.1|  hypothetical protein LOTGIDRAFT_176845             230   7e-74   Lottia gigantea
ref|XP_006642985.1|  PREDICTED: histone H3.3-like                       230   7e-74   Lepisosteus oculatus
gb|EPY83085.1|  histone 1, H2ai isoform 3-like protein                  230   7e-74   Camelus ferus
ref|XP_001743988.1|  hypothetical protein                               230   7e-74   Monosiga brevicollis MX1
ref|XP_001624255.1|  predicted protein                                  230   7e-74   Nematostella vectensis
ref|XP_006147050.1|  PREDICTED: histone H3.1-like                       230   7e-74   
ref|XP_008841936.1|  PREDICTED: histone H3-like                         234   7e-74   
emb|CDR95028.1|  Histone H3, putative                                   230   7e-74   Babesia bigemina
gb|ACI68311.1|  Histone H3.3                                            230   7e-74   Salmo salar
gb|AAZ72657.1|  histone H3.3                                            230   7e-74   Craterostigma plantagineum
gb|KFP37625.1|  Histone H3                                              230   8e-74   Chlamydotis macqueenii
ref|XP_004780676.1|  PREDICTED: histone H3.1-like                       230   8e-74   Mustela putorius furo [black ferret]
dbj|BAD02414.1|  histone 3                                              230   8e-74   
ref|XP_005580074.1|  PREDICTED: histone H3.3-like                       230   8e-74   
gb|ACG48841.1|  histone H3                                              230   8e-74   
ref|NP_001269296.1|  uncharacterized protein LOC102012783               230   8e-74   
ref|XP_001655332.1|  AAEL011424-PA                                      230   8e-74   
gb|KFQ96138.1|  Histone H3                                              230   8e-74   
ref|XP_004389664.1|  PREDICTED: histone H3.2-like                       230   8e-74   
ref|XP_005906213.1|  PREDICTED: histone H3.1-like                       230   8e-74   
ref|NP_001281232.1|  60S ribosomal protein L32                          230   8e-74   
ref|XP_005711872.1|  Histone H3                                         230   8e-74   
ref|XP_006162722.1|  PREDICTED: histone H3.1-like                       230   8e-74   
ref|XP_004043454.1|  PREDICTED: histone H3.1-like                       230   8e-74   
gb|ACG25088.1|  histone H3                                              231   8e-74   
gb|AFY26271.1|  histone H3                                              230   8e-74   
ref|XP_008172421.1|  PREDICTED: histone H3-like centromeric prote...    235   8e-74   
gb|AIY27744.1|  histone H3 protein                                      230   9e-74   
ref|XP_006425525.1|  hypothetical protein CICLE_v10026741mg             230   9e-74   
ref|NP_001020342.1|  uncharacterized protein LOC573992                  230   9e-74   
gb|KHJ92628.1|  core histone H2A/H2B/H3/H4                              230   9e-74   
ref|XP_005337153.1|  PREDICTED: histone H3.1-like                       232   9e-74   
pdb|3WTP|E  Chain E, Crystal Structure Of The Heterotypic Nucleos...    230   9e-74   
ref|XP_010832083.1|  PREDICTED: histone H3.3-like                       230   9e-74   
ref|XP_002075944.1|  GK12402                                            230   9e-74   
tpg|DAA45649.1|  TPA: histone H3                                        231   9e-74   
ref|XP_002943219.2|  PREDICTED: histone H3.2-like                       230   9e-74   
gb|AAI53404.1|  Zgc:113984 protein                                      230   9e-74   
ref|XP_005342614.1|  PREDICTED: histone H3.1-like                       230   9e-74   
ref|XP_010749016.1|  PREDICTED: histone H3-like                         234   9e-74   
ref|XP_009122895.1|  PREDICTED: histone H3-like centromeric prote...    235   9e-74   
gb|EGT34501.1|  hypothetical protein CAEBREN_26308                      230   1e-73   
ref|XP_006045710.1|  PREDICTED: histone H3-like centromeric prote...    235   1e-73   
gb|ADF58427.1|  histone H3                                              230   1e-73   
emb|CAA56575.1|  histone H3.2 protein                                   230   1e-73   
ref|XP_001928622.1|  PREDICTED: histone H3.1-like                       230   1e-73   
gb|KHN25265.1|  Histone H3.2                                            230   1e-73   
ref|XP_006923340.1|  PREDICTED: histone H3.1-like                       230   1e-73   
gb|AIS25392.1|  histone H3.3                                            230   1e-73   
gb|AIS25385.1|  histone H3.3                                            230   1e-73   
gb|ACM09185.1|  Histone H3.3                                            230   1e-73   
gb|ABO26658.1|  histone H3                                              230   1e-73   
ref|XP_006091951.1|  PREDICTED: histone H3.3-like                       230   1e-73   
ref|XP_003552025.2|  PREDICTED: histone H3.3-like                       232   1e-73   
gb|EDL18362.1|  mCG6162                                                 230   1e-73   
emb|CBJ32075.1|  conserved unknown protein                              230   1e-73   
ref|XP_008260696.1|  PREDICTED: histone H3.1-like                       230   1e-73   
emb|CEF59912.1|  Histone H3                                             230   1e-73   
ref|XP_003430322.2|  PREDICTED: uncharacterized protein LOC100093342    239   1e-73   
gb|AFW86017.1|  histone H3                                              233   1e-73   
gb|KHJ85982.1|  core histone H2A/H2B/H3/H4                              230   1e-73   
gb|EGV94774.1|  Histone H3                                              234   1e-73   
emb|CCA15304.1|  histone putative                                       230   1e-73   
ref|XP_002045797.1|  GM16878                                            230   1e-73   
ref|XP_010749697.1|  PREDICTED: histone H3-like                         234   1e-73   
dbj|BAG35628.1|  unnamed protein product                                230   1e-73   
ref|XP_007445090.1|  PREDICTED: histone H3.2-like                       234   1e-73   
ref|XP_002612136.1|  hypothetical protein BRAFLDRAFT_125364             229   1e-73   
ref|XP_010854483.1|  PREDICTED: histone H3.3                            229   1e-73   
ref|XP_010368156.1|  PREDICTED: histone H3.3-like                       229   1e-73   
gb|AFI61665.1|  histone 3                                               229   1e-73   
gb|AAL78367.1|AF467728_1  disease-resistent-related protein             229   1e-73   
gb|EFZ14264.1|  hypothetical protein SINV_11024                         232   1e-73   
ref|XP_001853968.1|  histone H3.2                                       229   1e-73   
ref|XP_002595193.1|  hypothetical protein BRAFLDRAFT_129781             234   1e-73   
ref|XP_791401.1|  PREDICTED: histone H3.3-like                          229   1e-73   
gb|AAI07286.1|  Hist1h3h protein                                        229   1e-73   
ref|NP_001255163.1|  Protein HIS-72, isoform a                          229   2e-73   
ref|XP_006001747.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_003754356.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_005539891.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|NP_001127304.1|  histone H3.3                                       229   2e-73   
ref|XP_011265433.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_002809382.1|  PREDICTED: histone H3.1                            230   2e-73   
gb|AFI61675.1|  histone 3                                               229   2e-73   
ref|XP_010611509.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.3       231   2e-73   
gb|AAX19361.1|  replacement histone H3.3                                229   2e-73   
ref|XP_010944075.1|  PREDICTED: histone H3.1-like                       234   2e-73   
gb|ACO08041.1|  Histone H3.3                                            229   2e-73   
gb|ACH44317.1|  putative H3 histone family 3A                           229   2e-73   
ref|XP_008218130.1|  PREDICTED: histone H3.1-like                       229   2e-73   
gb|ACG38891.1|  histone H3                                              229   2e-73   
dbj|BAD90809.1|  histone 3                                              229   2e-73   
ref|XP_008330713.1|  PREDICTED: histone H3.3-like                       229   2e-73   
gb|ACH46262.1|  putative H3 histone family 3B variant 1                 229   2e-73   
ref|XP_005855528.1|  histone H3                                         229   2e-73   
ref|XP_004696931.1|  PREDICTED: histone H3.1-like                       229   2e-73   
ref|XP_004136113.1|  PREDICTED: uncharacterized protein LOC101209420    234   2e-73   
ref|XP_001366052.3|  PREDICTED: histone H3-like centromeric prote...    236   2e-73   
ref|XP_007882585.1|  PREDICTED: histone H3-like                         229   2e-73   
ref|XP_006125985.1|  PREDICTED: uncharacterized protein LOC102454723    237   2e-73   
ref|XP_008560081.1|  PREDICTED: histone H3-like                         233   2e-73   
gb|AAX92698.1|  histone 3                                               229   2e-73   
gb|ACO08061.1|  Histone H3.3                                            229   2e-73   
gb|AAH21768.1|  H3 histone, family 3B                                   229   2e-73   
ref|XP_006988974.1|  PREDICTED: histone H3-like centromeric prote...    235   2e-73   
ref|XP_004090247.1|  PREDICTED: histone H3.3-like isoform 1             229   2e-73   
ref|XP_008634735.1|  PREDICTED: histone H3-like                         229   2e-73   
dbj|BAF83791.1|  unnamed protein product                                229   2e-73   
gb|AAP80717.1|  putative histone H3 protein                             229   2e-73   
ref|XP_010358086.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_011364782.1|  PREDICTED: histone H3.1-like                       233   2e-73   
gb|AIS25387.1|  histone H3.3                                            229   2e-73   
ref|XP_008399117.1|  PREDICTED: histone H3-like                         234   2e-73   
ref|XP_001096522.2|  PREDICTED: hypothetical protein LOC704845          234   2e-73   
ref|XP_002045012.1|  GM24194                                            229   2e-73   
gb|AAA52651.1|  histone H3                                              229   2e-73   
ref|XP_010356091.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_010366082.1|  PREDICTED: histone H3.3-like                       229   2e-73   
gb|AAA30003.1|  histone H3                                              229   2e-73   
ref|XP_002744826.3|  PREDICTED: histone H3.3-like                       229   2e-73   
gb|AFY26267.1|  histone H3                                              229   2e-73   
ref|XP_010816813.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.1...    229   2e-73   
ref|XP_002712259.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_008313557.1|  PREDICTED: histone H3-like                         229   2e-73   
ref|XP_010471674.1|  PREDICTED: histone H3.3-like                       229   2e-73   
ref|XP_005554276.1|  PREDICTED: histone H3-like centromeric prote...    235   2e-73   
gb|AAH67493.1|  Histone cluster 1, H3i                                  229   3e-73   
ref|XP_008159186.1|  PREDICTED: histone H3.1-like                       233   3e-73   
ref|XP_004788235.1|  PREDICTED: histone H3.1-like                       234   3e-73   
ref|XP_008803321.1|  PREDICTED: histone H3.3-like                       229   3e-73   
ref|XP_004810929.1|  PREDICTED: histone H3.3                            229   3e-73   
ref|XP_006125961.1|  PREDICTED: histone H3.2-like isoform X4            229   3e-73   
ref|XP_004695483.1|  PREDICTED: histone H3.1-like                       229   3e-73   
ref|XP_008017399.1|  PREDICTED: histone H3-like                         229   3e-73   
ref|XP_003746454.1|  PREDICTED: uncharacterized protein LOC100903667    238   3e-73   
ref|XP_002131734.2|  PREDICTED: histone H3.3                            230   3e-73   
pdb|1KX3|A  Chain A, X-Ray Structure Of The Nucleosome Core Parti...    229   3e-73   
gb|AIS25388.1|  histone H3.3                                            229   3e-73   
ref|XP_009892706.1|  PREDICTED: uncharacterized protein LOC104294757    237   3e-73   
ref|NP_496899.1|  Protein HIS-42                                        229   3e-73   
ref|XP_005830219.1|  histone H3                                         229   3e-73   
gb|AAK21963.1|  histone H3                                              229   3e-73   
gb|AGS78027.1|  histone H3                                              229   3e-73   
gb|AAH66884.1|  Histone cluster 1, H3i                                  229   3e-73   
ref|XP_008972370.1|  PREDICTED: histone H3.3-like                       229   3e-73   
ref|XP_005369997.1|  PREDICTED: uncharacterized protein LOC101990594    235   3e-73   
ref|NP_001103112.1|  histone cluster 3, H3                              229   3e-73   
gb|AAX92952.1|  histone H3 - maize                                      230   3e-73   
emb|CAJ81662.1|  H3 histone                                             229   3e-73   
ref|XP_010089325.1|  Histone                                            229   3e-73   
gb|AGM32107.1|  histone H3.3                                            229   3e-73   
ref|XP_001105140.1|  PREDICTED: histone H3.3-like isoform 1             229   3e-73   
ref|XP_008694001.1|  PREDICTED: histone H3-like centromeric prote...    233   3e-73   
emb|CBN79887.1|  conserved unknown protein                              229   3e-73   
ref|XP_003897000.1|  PREDICTED: histone H3.3-like                       229   3e-73   
ref|XP_007620855.1|  PREDICTED: uncharacterized protein LOC100759437    235   3e-73   
ref|XP_004988972.1|  histone H3                                         229   4e-73   
ref|XP_008059796.1|  PREDICTED: histone H3.1                            229   4e-73   
ref|XP_006761314.1|  PREDICTED: histone H3.3-like                       229   4e-73   
ref|XP_001609713.1|  Histone H3                                         228   4e-73   
gb|AAP94664.1|  histone H3                                              228   4e-73   
ref|XP_007948038.1|  PREDICTED: histone H3.1-like                       233   4e-73   
gb|ELK33066.1|  Histone H3.1                                            232   4e-73   
ref|XP_011397775.1|  Histone H3.1                                       228   4e-73   
ref|XP_002872367.1|  histone H3.2                                       228   4e-73   
ref|XP_001514930.2|  PREDICTED: uncharacterized protein LOC100093260    235   4e-73   
ref|XP_002177514.1|  histone H3 isoform 1c                              228   4e-73   
emb|CDS15495.1|  histone                                                234   4e-73   
ref|XP_009322838.1|  PREDICTED: histone H3.3                            228   4e-73   
ref|XP_005982710.1|  PREDICTED: histone H3.3-like                       228   4e-73   
ref|XP_003909268.1|  PREDICTED: histone H3.3-like                       228   4e-73   
gb|EHH52805.1|  Histone H3/a                                            228   4e-73   
ref|NP_998161.1|  H3 histone, family 3A                                 228   4e-73   
ref|XP_002045584.1|  GM20952                                            228   4e-73   
ref|XP_007064143.1|  PREDICTED: uncharacterized protein LOC102945886    234   4e-73   
ref|XP_003421240.1|  PREDICTED: histone H3.1                            228   4e-73   
ref|XP_004432230.1|  PREDICTED: uncharacterized protein LOC101398437    237   4e-73   
gb|EPQ17117.1|  Histone H3.3                                            228   5e-73   
pdb|1F66|A  Chain A, 2.6 A Crystal Structure Of A Nucleosome Core...    228   5e-73   
ref|XP_004387168.1|  PREDICTED: histone H3-like centromeric prote...    233   5e-73   
ref|XP_003275194.1|  PREDICTED: histone H3.1t-like                      228   5e-73   
ref|XP_008145522.1|  PREDICTED: histone H3-like centromeric prote...    233   5e-73   
ref|XP_006974381.1|  PREDICTED: histone H3.3-like isoform X1            228   5e-73   
gb|EHH61202.1|  hypothetical protein EGM_19156                          228   5e-73   
gb|AAH81561.1|  H3 histone, family 3A                                   228   5e-73   
ref|XP_008561649.1|  PREDICTED: histone H3.1-like                       233   5e-73   
ref|XP_006825798.1|  PREDICTED: histone H3-like centromeric prote...    234   5e-73   
ref|XP_006024284.1|  PREDICTED: histone H3-like centromeric prote...    233   5e-73   
gb|AGN29609.1|  histone H3                                              228   5e-73   
ref|XP_005892260.1|  PREDICTED: histone H3.1-like                       228   5e-73   
ref|NP_999712.1|  histone H3, embryonic                                 228   5e-73   
ref|XP_005892043.1|  PREDICTED: histone H3.3-like                       228   5e-73   
gb|KHN41576.1|  Histone H3.2                                            228   6e-73   
ref|XP_010385229.1|  PREDICTED: histone H3.3-like                       228   6e-73   
ref|XP_009083303.1|  PREDICTED: histone H3.3                            228   6e-73   
gb|ACM08344.1|  Histone H3.3                                            228   6e-73   
ref|XP_007091329.1|  PREDICTED: histone H3.3-like                       228   6e-73   
ref|XP_005594080.1|  PREDICTED: histone H3.3-like                       228   6e-73   
gb|AAI07288.1|  Hist1h3i protein                                        228   6e-73   
ref|XP_007483415.1|  PREDICTED: histone H3-like centromeric prote...    233   6e-73   
ref|XP_009321196.1|  PREDICTED: histone H3                              228   6e-73   
ref|XP_002611004.1|  hypothetical protein BRAFLDRAFT_128327             232   6e-73   
ref|XP_004897510.1|  PREDICTED: histone H3.3-like                       228   6e-73   
ref|XP_008759531.1|  PREDICTED: histone cluster 2, H3c2 isoform X1      234   6e-73   
ref|XP_005355175.1|  PREDICTED: histone H3-like centromeric prote...    233   6e-73   
ref|XP_004830908.1|  histone H3, putative                               228   6e-73   
ref|XP_010167429.1|  PREDICTED: histone H3                              228   6e-73   
ref|XP_003746460.1|  PREDICTED: uncharacterized protein LOC100904527    233   6e-73   
gb|EFN83153.1|  Histone H3.3                                            230   6e-73   
ref|XP_008929842.1|  PREDICTED: histone H3-like                         228   6e-73   
ref|XP_004895398.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.2...    232   7e-73   
gb|EMT07308.1|  Histone H3.2                                            228   7e-73   
ref|XP_010466628.1|  PREDICTED: histone H3.3-like                       228   7e-73   
gb|AGS78028.1|  histone H3                                              228   7e-73   
ref|XP_005313474.2|  PREDICTED: histone H3-like                         232   7e-73   
ref|XP_008492725.1|  PREDICTED: histone H3.3                            228   7e-73   
ref|NP_003484.1|  histone H3.1t                                         228   7e-73   
gb|AAX37123.1|  histone 3 H3                                            228   7e-73   
ref|XP_005537302.1|  histone H3                                         228   7e-73   
ref|XP_010480248.1|  PREDICTED: histone H3.3-like                       228   8e-73   
emb|CCF73041.1|  unnamed protein product                                228   8e-73   
pdb|3A6N|A  Chain A, The Nucleosome Containing A Testis-Specific ...    228   8e-73   
sp|Q7XYZ0.3|H3_GRIJA  RecName: Full=Histone H3                          228   8e-73   
gb|ACI68993.1|  Histone H3.3                                            228   8e-73   
ref|XP_006923686.1|  PREDICTED: histone H3-like centromeric prote...    233   8e-73   
ref|XP_008995480.1|  PREDICTED: histone H3.3-like                       228   8e-73   
ref|XP_005949462.1|  PREDICTED: histone H3.2-like isoform X2            228   8e-73   
gb|AAA48793.1|  histone 3.3A                                            228   8e-73   
sp|P08898.4|H3_CAEEL  RecName: Full=Histone H3                          228   8e-73   
ref|NP_001074488.1|  predicted gene 12657                               228   9e-73   
ref|XP_008820599.1|  PREDICTED: histone H3.3                            228   9e-73   
gb|AAI27043.1|  Hist1h3e protein                                        228   9e-73   



>ref|XP_004917040.1| PREDICTED: histone H3.2-like isoform X2 [Xenopus (Silurana) tropicalis]
Length=148

 Score =   240 bits (612),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  32   IQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALRE  211
            IQ   ++V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALRE
Sbjct  4    IQLHSAVVAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE  63

Query  212  IRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLC  391
            IR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLC
Sbjct  64   IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC  123

Query  392  AIHAKRVTIMPKDIQLARRIRGERA  466
            AIHAKRVTIMPKDIQLARRIRGERA
Sbjct  124  AIHAKRVTIMPKDIQLARRIRGERA  148



>ref|XP_003621457.1| Histone H3 [Medicago truncatula]
 gb|AES77675.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=235

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  26   LYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  205
            ++     S+ PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  89   IFFLSNFSLFPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  148

Query  206  REIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTN  385
            REIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTN
Sbjct  149  REIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTN  208

Query  386  LCAIHAKRVTIMPKDIQLARRIRGERA  466
            LCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  209  LCAIHAKRVTIMPKDIQLARRIRGERA  235



>ref|XP_007971598.1| PREDICTED: histone H3.1-like [Chlorocebus sabaeus]
Length=181

 Score =   239 bits (610),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 141/153 (92%), Gaps = 2/153 (1%)
 Frame = +2

Query  8    HSNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  187
            H +F  L+     SI  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+R
Sbjct  31   HCSFSALFQSIAFSI--MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR  88

Query  188  PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvG  367
            PGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVG
Sbjct  89   PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVG  148

Query  368  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  149  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  181



>ref|XP_008669428.1| PREDICTED: histone H3.2-like [Zea mays]
Length=235

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +2

Query  5    IHSNFCNLYIQFELSIV-PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR  181
            IHS+    Y   E S+  PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR
Sbjct  83   IHSS--QPYSCLESSLAAPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR  140

Query  182  FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeayl  361
            FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYL
Sbjct  141  FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYL  200

Query  362  vGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  201  VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  235



>ref|XP_006401653.1| hypothetical protein EUTSA_v10014731mg [Eutrema salsugineum]
 gb|ESQ43106.1| hypothetical protein EUTSA_v10014731mg [Eutrema salsugineum]
Length=195

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 145/156 (93%), Gaps = 1/156 (1%)
 Frame = +2

Query  2    SIHSNFCNLYIQFEL-SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH  178
            S+H +    +  F + S+  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH
Sbjct  40   SLHKSSLQKFKNFSIPSLNQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH  99

Query  179  RFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeay  358
            RFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAY
Sbjct  100  RFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAY  159

Query  359  lvGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  160  LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  195



>ref|XP_007014942.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY32561.1| Histone superfamily protein [Theobroma cacao]
Length=176

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 144/152 (95%), Gaps = 4/152 (3%)
 Frame = +2

Query  14   NFCNLYIQFELSI-VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  190
            +F NL   F LS  + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP
Sbjct  28   SFDNL---FHLSSQITMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  84

Query  191  GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGL  370
            GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL
Sbjct  85   GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL  144

Query  371  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  145  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  176



>ref|XP_007483400.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
 ref|XP_007483403.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
Length=196

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +2

Query  5    IHSNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRF  184
            +HS F  L  +F    V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+
Sbjct  44   LHSRF-GLLGKFASPYVAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRY  102

Query  185  RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylv  364
            RPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLV
Sbjct  103  RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLV  162

Query  365  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  163  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  196



>ref|XP_008663191.1| PREDICTED: histone H3.2-like [Zea mays]
 gb|AFW58221.1| histone H3.2 [Zea mays]
Length=171

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            + PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK
Sbjct  33   LSPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  92

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKR
Sbjct  93   STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKR  152

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  153  VTIMPKDIQLARRIRGERA  171



>ref|XP_010708157.1| PREDICTED: histone H3-like [Meleagris gallopavo]
Length=165

 Score =   238 bits (606),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 142/150 (95%), Gaps = 1/150 (1%)
 Frame = +2

Query  17   FCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  196
            F  L++ +  S V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGT
Sbjct  17   FVVLFLTWCCSFV-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT  75

Query  197  VALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFE  376
            VALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFE
Sbjct  76   VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE  135

Query  377  DTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            DTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  136  DTNLCAIHAKRVTIMPKDIQLARRIRGERA  165



>gb|KGN66469.1| hypothetical protein Csa_1G612925 [Cucumis sativus]
Length=171

 Score =   237 bits (605),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            S+  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ
Sbjct  32   SLSQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  91

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  92   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK  151

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKDIQLARRIRGERA
Sbjct  152  RVTIMPKDIQLARRIRGERA  171



>gb|KJB27089.1| hypothetical protein B456_004G277300 [Gossypium raimondii]
Length=193

 Score =   238 bits (607),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +2

Query  29   YIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR  208
            +  +  +I  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR
Sbjct  48   FTSYLRTISSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR  107

Query  209  EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNL  388
            EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNL
Sbjct  108  EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNL  167

Query  389  CAIHAKRVTIMPKDIQLARRIRGERA  466
            CAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  168  CAIHAKRVTIMPKDIQLARRIRGERA  193



>gb|KCW51227.1| hypothetical protein EUGRSUZ_J00806, partial [Eucalyptus grandis]
Length=161

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  41   ELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK  220
            E S + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK
Sbjct  20   ESSPIGMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK  79

Query  221  YQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIH  400
            YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIH
Sbjct  80   YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIH  139

Query  401  AKRVTIMPKDIQLARRIRGERA  466
            AKRVTIMPKDIQLARRIRGERA
Sbjct  140  AKRVTIMPKDIQLARRIRGERA  161



>gb|KDP29737.1| hypothetical protein JCGZ_18672 [Jatropha curcas]
Length=136

 Score =   236 bits (601),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAA+QEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAAMQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CBH32561.1| histone H3, expressed [Triticum aestivum]
 dbj|BAJ89751.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06522.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88326.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07409.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04782.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05326.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CDM85134.1| unnamed protein product [Triticum aestivum]
Length=136

 Score =   236 bits (601),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAE+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|NP_001238509.1| uncharacterized protein LOC100306416 [Glycine max]
 ref|XP_003529355.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003531787.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003531853.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003537953.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003539404.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003542714.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003546675.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003557185.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003564281.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003568367.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003575094.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003592468.1| Histone H3 [Medicago truncatula]
 ref|XP_003612856.1| Histone H3 [Medicago truncatula]
 ref|XP_003622981.1| Histone H3 [Medicago truncatula]
 ref|XP_003628691.1| Histone H3 [Medicago truncatula]
 ref|XP_003630185.1| Histone H3 [Medicago truncatula]
 ref|XP_004140867.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004160811.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004488709.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489510.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489511.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489512.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489513.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004503973.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004505111.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004512510.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_006383727.1| hypothetical protein POPTR_0005s25530g [Populus trichocarpa]
 ref|XP_006595049.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_006597243.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_006846511.1| hypothetical protein AMTR_s00018p00168040 [Amborella trichopoda]
 ref|XP_007131986.1| hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris]
 ref|XP_007133533.1| hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris]
 ref|XP_007139488.1| hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris]
 ref|XP_007153894.1| hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris]
 ref|XP_007159809.1| hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris]
 ref|XP_007159810.1| hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris]
 ref|XP_008352444.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384522.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384524.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008445689.1| PREDICTED: histone H3.2 [Cucumis melo]
 ref|XP_008657023.1| PREDICTED: histone H3.2 [Zea mays]
 ref|XP_008784458.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_008785823.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_009374750.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009379418.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009379421.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009414586.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_010025543.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010025545.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010246200.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010231094.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_010231492.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_010237279.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_010523315.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010928463.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011045162.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011014732.1| PREDICTED: histone H3.2 [Populus euphratica]
 sp|P68427.2|H32_PEA RecName: Full=Histone H3.2 [Pisum sativum]
 sp|P68428.2|H32_WHEAT RecName: Full=Histone H3.2 [Triticum aestivum]
 sp|P68429.2|H32_MEDSA RecName: Full=Histone H3.2; AltName: Full=Histone H3.1; AltName: 
Full=Major histone H3 [Medicago sativa]
 sp|P68430.2|H32_ONOVI RecName: Full=Histone H3.2 [Onobrychis viciifolia]
 emb|CAA31964.1| unnamed protein product [Medicago sativa]
 emb|CAA31965.1| unnamed protein product [Medicago sativa]
 emb|CAA25451.1| unnamed protein product [Triticum aestivum]
 gb|AAB49545.1| histone H3.1 [Medicago sativa]
 gb|AAB81995.1| histone H3 [Onobrychis viciifolia]
 gb|ACG24791.1| histone H3 [Zea mays]
 gb|ACG27393.1| histone H3 [Zea mays]
 gb|ACG33231.1| histone H3 [Zea mays]
 gb|ACJ86155.1| unknown [Medicago truncatula]
 gb|ACU14577.1| unknown [Glycine max]
 gb|ACZ74621.1| histone H3-like protein [Wolffia arrhiza]
 gb|ADE76568.1| unknown [Picea sitchensis]
 gb|ADE76659.1| unknown [Picea sitchensis]
 dbj|BAK05448.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85119.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85969.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88067.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01074.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AES79199.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES95814.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AET03167.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AET04661.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK40853.1| unknown [Medicago truncatula]
 gb|AFK41087.1| unknown [Medicago truncatula]
 gb|AFK42486.1| unknown [Medicago truncatula]
 gb|AFK42592.1| unknown [Lotus japonicus]
 gb|AFK43073.1| unknown [Medicago truncatula]
 gb|AFK47036.1| unknown [Medicago truncatula]
 gb|AFW71715.1| histone H3 [Zea mays]
 gb|AFW84464.1| putative vesicle-associated membrane protein family protein [Zea 
mays]
 gb|ERN08186.1| hypothetical protein AMTR_s00018p00168040 [Amborella trichopoda]
 gb|ERP61524.1| hypothetical protein POPTR_0005s25530g [Populus trichocarpa]
 gb|ESW03980.1| hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris]
 gb|ESW05527.1| hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris]
 gb|ESW11482.1| hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris]
 gb|ESW25888.1| hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris]
 gb|ESW31803.1| hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris]
 gb|ESW31804.1| hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris]
 gb|AET04671.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH21352.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES95809.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH30259.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH30956.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES65091.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 emb|CDM83919.1| unnamed protein product [Triticum aestivum]
 gb|KHN21882.1| Histone H3.2 [Glycine soja]
 gb|KHN30118.1| Histone H3.2 [Glycine soja]
 gb|KHN34049.1| Histone H3.2 [Glycine soja]
Length=136

 Score =   235 bits (600),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_006652279.1| PREDICTED: histone H3.2-like [Oryza brachyantha]
Length=136

 Score =   235 bits (600),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEA L GLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEASLGGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAA32655.1| histone H3 (H3-1.1) [Medicago sativa]
Length=136

 Score =   235 bits (600),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSS V+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSVVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_006301260.1| hypothetical protein CARUB_v10021660mg, partial [Capsella rubella]
 gb|EOA34158.1| hypothetical protein CARUB_v10021660mg, partial [Capsella rubella]
Length=169

 Score =   236 bits (603),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  29   YIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR  208
            +  F +    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR
Sbjct  24   FSSFRIYSKEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR  83

Query  209  EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNL  388
            EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNL
Sbjct  84   EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNL  143

Query  389  CAIHAKRVTIMPKDIQLARRIRGERA  466
            CAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  144  CAIHAKRVTIMPKDIQLARRIRGERA  169



>ref|XP_009598129.1| PREDICTED: histone H3.2-like [Nicotiana tomentosiformis]
Length=136

 Score =   235 bits (600),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEATEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|NP_189372.1| histone H3  [Arabidopsis thaliana]
 ref|NP_201339.1| histone H3.1 [Arabidopsis thaliana]
 ref|NP_563838.1| histone H3  [Arabidopsis thaliana]
 ref|NP_568227.1| histone H3 [Arabidopsis thaliana]
 ref|NP_568228.1| histone H3 [Arabidopsis thaliana]
 ref|NP_001044904.1| Os01g0866200 [Oryza sativa Japonica Group]
 ref|NP_001052776.1| Os04g0419600 [Oryza sativa Japonica Group]
 ref|NP_001055660.1| Os05g0438700 [Oryza sativa Japonica Group]
 ref|NP_001056877.1| Os06g0160100 [Oryza sativa Japonica Group]
 ref|NP_001065791.1| Os11g0155900 [Oryza sativa Japonica Group]
 ref|NP_001131276.1| histone H3.2 [Zea mays]
 ref|NP_001174611.1| Os06g0159501 [Oryza sativa Japonica Group]
 ref|NP_001174613.1| Os06g0160001 [Oryza sativa Japonica Group]
 ref|XP_002299242.1| histone H3 family protein [Populus trichocarpa]
 ref|XP_002304754.1| hypothetical protein POPTR_0003s22120g [Populus trichocarpa]
 ref|XP_002282606.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002285556.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002285562.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002264961.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002457320.1| hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor]
 ref|XP_002452234.1| hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor]
 ref|XP_002446458.1| hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor]
 ref|XP_002447846.1| hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor]
 ref|XP_002441172.1| hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor]
 ref|XP_002436522.1| hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor]
 ref|XP_002437869.1| hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor]
 ref|XP_002522502.1| histone h3, putative [Ricinus communis]
 ref|XP_002524630.1| histone h3, putative [Ricinus communis]
 ref|XP_002533558.1| histone h3, putative [Ricinus communis]
 ref|XP_002533561.1| histone h3, putative [Ricinus communis]
 ref|XP_002533563.1| histone h3, putative [Ricinus communis]
 ref|XP_002533564.1| histone h3, putative [Ricinus communis]
 ref|XP_002873454.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873455.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002877045.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002892490.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002894648.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004142133.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004154620.1| PREDICTED: histone H3.2-like isoform 1 [Cucumis sativus]
 ref|XP_004154621.1| PREDICTED: histone H3.2-like isoform 2 [Cucumis sativus]
 ref|XP_004158207.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004167423.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004173594.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004229355.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004229356.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004229488.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004248123.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004293906.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004294584.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004294793.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004295221.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004300433.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004952690.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_004964781.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_004970697.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_004975679.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_006359169.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006359170.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006361042.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006364319.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006365266.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006366504.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006366505.1| PREDICTED: histone H3.2-like isoform X1 [Solanum tuberosum]
 ref|XP_006289123.1| hypothetical protein CARUB_v10002544mg [Capsella rubella]
 ref|XP_006289801.1| hypothetical protein CARUB_v10003405mg [Capsella rubella]
 ref|XP_006292533.1| hypothetical protein CARUB_v10018763mg [Capsella rubella]
 ref|XP_006304637.1| hypothetical protein CARUB_v10011755mg [Capsella rubella]
 ref|XP_006386195.1| hypothetical protein POPTR_0002s03030g [Populus trichocarpa]
 ref|XP_006386111.1| hypothetical protein POPTR_0003s22240g [Populus trichocarpa]
 ref|XP_002320408.2| hypothetical protein POPTR_0014s09260g [Populus trichocarpa]
 ref|XP_006394044.1| hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum]
 ref|XP_006394194.1| hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum]
 ref|XP_006396911.1| hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum]
 ref|XP_006399532.1| hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum]
 ref|XP_006399534.1| hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum]
 ref|XP_006426310.1| hypothetical protein CICLE_v10026742mg [Citrus clementina]
 ref|XP_006446007.1| hypothetical protein CICLE_v10017132mg [Citrus clementina]
 ref|XP_006446012.1| hypothetical protein CICLE_v10017131mg [Citrus clementina]
 ref|XP_006446027.1| hypothetical protein CICLE_v10017133mg [Citrus clementina]
 ref|XP_006466277.1| PREDICTED: histone H3.2-like [Citrus sinensis]
 ref|XP_006493650.1| PREDICTED: histone H3.2-like [Citrus sinensis]
 ref|XP_006493653.1| PREDICTED: histone H3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006493654.1| PREDICTED: histone H3.2-like isoform X2 [Citrus sinensis]
 ref|XP_006493658.1| PREDICTED: histone H3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006493659.1| PREDICTED: histone H3.2-like isoform X2 [Citrus sinensis]
 ref|XP_006656199.1| PREDICTED: histone H3.2-like [Oryza brachyantha]
 ref|XP_006662745.1| PREDICTED: histone H3.2-like [Oryza brachyantha]
 ref|XP_006827607.1| hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda]
 ref|XP_006854535.1| hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda]
 ref|XP_007014937.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007047838.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007206130.1| hypothetical protein PRUPE_ppa013165mg [Prunus persica]
 ref|XP_007206131.1| hypothetical protein PRUPE_ppa013174mg [Prunus persica]
 ref|XP_007213974.1| hypothetical protein PRUPE_ppa013173mg [Prunus persica]
 ref|XP_008219239.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008219284.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008243610.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008245364.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008383674.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384460.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384469.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008349461.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008358867.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008366176.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008449740.1| PREDICTED: histone H3.2 [Cucumis melo]
 ref|XP_008466947.1| PREDICTED: histone H3.2 [Cucumis melo]
 ref|XP_008678686.1| PREDICTED: histone H3.2 [Zea mays]
 ref|XP_008659267.1| PREDICTED: histone H3.2 [Zea mays]
 ref|XP_008777421.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_008781402.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_008793940.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_009125303.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009131154.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009110843.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009112178.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009114048.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009374897.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009352838.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009364707.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009364738.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009379413.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009418349.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009393405.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399186.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009404906.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009405329.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009411937.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009420590.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009612389.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009588612.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009588620.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009589159.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009594168.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009597397.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009795193.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009790377.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009792014.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009794411.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009794577.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009800087.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009768852.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009776512.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_010044997.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010031842.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010033130.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010087371.1| Histone [Morus notabilis]
 ref|XP_010087372.1| Histone [Morus notabilis]
 ref|XP_010091983.1| Histone [Morus notabilis]
 ref|XP_010091985.1| Histone [Morus notabilis]
 ref|XP_010111157.1| Histone [Morus notabilis]
 ref|XP_010257371.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010257381.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010258545.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010260368.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010260930.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010263130.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010265797.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010241721.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010324306.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_010316780.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_010463183.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010489841.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010502711.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010514443.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010425488.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010444536.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010458200.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010475747.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010484375.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010519319.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010536065.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010544196.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010673587.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673590.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010675450.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010675457.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010675458.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679903.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010911970.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_010912408.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011037963.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_010930992.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011028938.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_010904890.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011037873.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011037877.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011042066.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011042070.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011087280.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011080254.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011090392.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011092467.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011093538.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011463287.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 sp|P59226.2|H32_ARATH RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 [Arabidopsis 
thaliana]
 sp|P69246.2|H32_MAIZE RecName: Full=Histone H3.2 [Zea mays]
 sp|P69248.2|H32_PETCR RecName: Full=Histone H3.2 [Petroselinum crispum]
 sp|Q71T45.3|H32_EUPES RecName: Full=Histone H3.2 [Euphorbia esula]
 sp|Q6LBE3.3|H32_ASPOF RecName: Full=Histone H3.2 [Asparagus officinalis]
 sp|Q6LCK1.3|H32_BRANA RecName: Full=Histone H3.2 [Brassica napus]
 sp|Q76MV0.1|H32_TOBAC RecName: Full=Histone H3.2 [Nicotiana tabacum]
 sp|Q2RAD9.1|H32_ORYSJ RecName: Full=Histone H3.2 [Oryza sativa Japonica Group]
 sp|A2Y533.1|H32_ORYSI RecName: Full=Histone H3.2 [Oryza sativa Indica Group]
 gb|AAF64452.1|AF239930_1 histone H3 [Euphorbia esula]
 gb|AAK49583.1|AF370577_1 histone H3 [Arabidopsis thaliana]
 emb|CAA31969.1| unnamed protein product [Oryza sativa]
 emb|CAA31970.1| unnamed protein product [Oryza sativa]
 gb|AAA33471.1| histone H3 (H3C3) [Zea mays]
 gb|AAA33472.1| histone H3 [Zea mays]
 gb|AAA33473.1| histone H3 [Zea mays]
 gb|AAA66265.1| histone H3 [Zea mays]
 gb|AAA33852.1| histone H3 [Petroselinum crispum]
 gb|AAA33853.1| histone H3 [Petroselinum crispum]
 gb|AAA33854.1| histone H3 [Petroselinum crispum]
 gb|AAA32808.1| histone H3 [Arabidopsis thaliana]
 gb|AAA32809.1| histone H3 [Arabidopsis thaliana]
 emb|CAA59111.1| histone 3 [Zea mays]
 gb|AAA79889.1| histone H3 [Arabidopsis thaliana]
 gb|AAB67837.1| histone H3 homolog [Brassica napus]
 emb|CAA57811.1| Histone H3 [Asparagus officinalis]
 gb|AAB18816.1| histone 3 [Oryza sativa Indica Group]
 gb|AAC24084.1| Match to histone H3 gene gb|M17131 and gb|M35387 from A. thaliana. 
ESTs gb|H76511 gb|H76255, gb|AA712452, gb|N65260 and gb|T42306 
come from this gene [Arabidopsis thaliana]
 dbj|BAA81840.1| histone H3 [Oryza sativa Japonica Group]
 dbj|BAA81841.1| histone H3 [Oryza sativa Japonica Group]
 emb|CAB89403.1| histone H3-like protein [Arabidopsis thaliana]
 emb|CAB89404.1| histone H3-like protein [Arabidopsis thaliana]
 dbj|BAA95712.1| histone H3-like protein [Arabidopsis thaliana]
 dbj|BAB11558.1| histone H3 [Arabidopsis thaliana]
 gb|AAK59851.1| AT3g27360/K1G2_6 [Arabidopsis thaliana]
 gb|AAK64008.1| AT5g65360/MNA5_9 [Arabidopsis thaliana]
 gb|AAL76132.1| AT3g27360/K1G2_6 [Arabidopsis thaliana]
 gb|AAL87394.1| AT5g65360/MNA5_9 [Arabidopsis thaliana]
 gb|AAM60903.1| histone H3-like protein [Arabidopsis thaliana]
 dbj|BAC01212.1| histone H3 [Oryza sativa Japonica Group]
 gb|AAM95675.1| histone H3 [Orobanche cernua var. cumana]
 dbj|BAC41835.1| putative histone H3 [Arabidopsis thaliana]
 dbj|BAC53942.1| H3 histone [Nicotiana tabacum]
 gb|AAO23616.1| At5g10400 [Arabidopsis thaliana]
 gb|AAO24594.1| At1g09200 [Arabidopsis thaliana]
 gb|AAO64207.1| putative histone H3 [Arabidopsis thaliana]
 gb|AAP04053.1| putative histone H3 [Arabidopsis thaliana]
 emb|CAE02924.1| OSJNBb0108J11.17 [Oryza sativa Japonica Group]
 gb|AAT07615.1| putative histone H3 [Oryza sativa Japonica Group]
 dbj|BAD46448.1| histone H3 [Oryza sativa Japonica Group]
 dbj|BAD46453.1| histone H3 [Oryza sativa Japonica Group]
 dbj|BAD46454.1| histone H3 [Oryza sativa Japonica Group]
 gb|AAX92719.1| histone H3 - maize [Oryza sativa Japonica Group]
 gb|AAZ66939.1| 117M18_20 [Brassica rapa]
 gb|ABA91537.2| Histone H3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF00340.1| histone H3 like protein [Arabidopsis thaliana]
 dbj|BAE99603.1| histone H3 like protein [Arabidopsis thaliana]
 dbj|BAE99643.1| histone H3 like protein [Arabidopsis thaliana]
 dbj|BAF06818.1| Os01g0866200 [Oryza sativa Japonica Group]
 dbj|BAF14690.1| Os04g0419600 [Oryza sativa Japonica Group]
 dbj|BAF17574.1| Os05g0438700 [Oryza sativa Japonica Group]
 dbj|BAF18791.1| Os06g0160100 [Oryza sativa Japonica Group]
 dbj|BAF27636.1| Os11g0155900 [Oryza sativa Japonica Group]
 gb|ABK21761.1| unknown [Picea sitchensis]
 gb|ABK25492.1| unknown [Picea sitchensis]
 gb|ABK92858.1| unknown [Populus trichocarpa]
 gb|ABK93905.1| unknown [Populus trichocarpa]
 gb|ABK93950.1| unknown [Populus trichocarpa]
 gb|ABK95888.1| unknown [Populus trichocarpa]
 gb|EAY80005.1| hypothetical protein OsI_35174 [Oryza sativa Indica Group]
 gb|EAY98193.1| hypothetical protein OsI_20106 [Oryza sativa Indica Group]
 gb|EAY99776.1| hypothetical protein OsI_21763 [Oryza sativa Indica Group]
 gb|EAY99779.1| hypothetical protein OsI_21766 [Oryza sativa Indica Group]
 gb|EAZ14271.1| hypothetical protein OsJ_04197 [Oryza sativa Japonica Group]
 gb|EAZ30723.1| hypothetical protein OsJ_14783 [Oryza sativa Japonica Group]
 gb|EAZ35903.1| hypothetical protein OsJ_20204 [Oryza sativa Japonica Group]
 emb|CAN73758.1| hypothetical protein VITISV_031197 [Vitis vinifera]
 emb|CAN80002.1| hypothetical protein VITISV_043973 [Vitis vinifera]
 emb|CAN83843.1| hypothetical protein VITISV_044079 [Vitis vinifera]
 emb|CAN80880.1| hypothetical protein VITISV_018649 [Vitis vinifera]
 emb|CAN83194.1| hypothetical protein VITISV_010341 [Vitis vinifera]
 gb|ABS11143.1| histone H3 [Nicotiana benthamiana]
 dbj|BAF76800.1| histone H3.1 [Nicotiana tabacum]
 gb|ACF79612.1| unknown [Zea mays]
 gb|ACF82232.1| unknown [Zea mays]
 gb|ACF86247.1| unknown [Zea mays]
 gb|ACF88431.1| unknown [Zea mays]
 gb|ACG25137.1| histone H3 [Zea mays]
 gb|ACG27345.1| histone H3 [Zea mays]
 gb|ACG30057.1| histone H3 [Zea mays]
 gb|ACG30474.1| histone H3 [Zea mays]
 gb|ACG30701.1| histone H3 [Zea mays]
 gb|ACG30707.1| histone H3 [Zea mays]
 gb|ACG30791.1| histone H3 [Zea mays]
 gb|ACG30950.1| histone H3 [Zea mays]
 gb|ACG31934.1| histone H3 [Zea mays]
 gb|ACG36961.1| histone H3 [Zea mays]
 gb|ACG39635.1| histone H3 [Zea mays]
 gb|ACG40073.1| histone H3 [Zea mays]
 gb|ACG40983.1| histone H3 [Zea mays]
 gb|ACG47284.1| histone H3 [Zea mays]
 gb|ACG70966.1| histone H3 [Ziziphus jujuba]
 dbj|BAH00243.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80059.1| hypothetical protein OsI_21765 [Oryza sativa Indica Group]
 gb|EEE51672.1| hypothetical protein OsJ_33018 [Oryza sativa Japonica Group]
 gb|EEE79733.1| hypothetical protein POPTR_0003s22120g [Populus trichocarpa]
 gb|EEE84047.1| histone H3 family protein [Populus trichocarpa]
 gb|EEF28815.1| histone h3, putative [Ricinus communis]
 gb|EEF28818.1| histone h3, putative [Ricinus communis]
 gb|EEF28820.1| histone h3, putative [Ricinus communis]
 gb|EEF28821.1| histone h3, putative [Ricinus communis]
 gb|EEF37755.1| histone h3, putative [Ricinus communis]
 gb|EEF39802.1| histone h3, putative [Ricinus communis]
 gb|ACN33923.1| unknown [Zea mays]
 gb|ACR37182.1| unknown [Zea mays]
 gb|ACR37485.1| unknown [Zea mays]
 gb|ACR37603.1| unknown [Zea mays]
 gb|ACR37986.1| unknown [Zea mays]
 gb|ACR38054.1| unknown [Zea mays]
 gb|EER87889.1| hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor]
 gb|EER89236.1| hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor]
 gb|EES02440.1| hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor]
 gb|EES05210.1| hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor]
 gb|EES10786.1| hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor]
 gb|EES12174.1| hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor]
 gb|EES19602.1| hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor]
 dbj|BAH93339.1| Os06g0159501 [Oryza sativa Japonica Group]
 dbj|BAH93341.1| Os06g0160001 [Oryza sativa Japonica Group]
 gb|ADC54261.1| histone H3 [Oryza sativa Japonica Group]
 gb|ADE76159.1| unknown [Picea sitchensis]
 gb|ADE76345.1| unknown [Picea sitchensis]
 gb|ADE76464.1| unknown [Picea sitchensis]
 gb|ADE77414.1| unknown [Picea sitchensis]
 gb|EFH49713.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49714.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53304.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68749.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70907.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|ADR30794.1| histone H3.1 [Hevea brasiliensis]
 dbj|BAJ53177.1| JHL18I08.11 [Jatropha curcas]
 gb|AED91535.1| histone H3 [Arabidopsis thaliana]
 gb|AED91536.1| histone H3 [Arabidopsis thaliana]
 gb|AED98043.1| histone H3 [Arabidopsis thaliana]
 gb|AEE28413.1| histone H3 [Arabidopsis thaliana]
 gb|AEE77308.1| histone H3 [Arabidopsis thaliana]
 emb|CCD74495.1| histone H3 [Arabidopsis halleri subsp. halleri]
 gb|AFW58222.1| histone H3.2 isoform 1 [Zea mays]
 gb|AFW58223.1| histone H3.2 isoform 2 [Zea mays]
 gb|AFW58244.1| histone H3.2 [Zea mays]
 gb|AFW62565.1| histone H3.2 [Zea mays]
 gb|AFW75594.1| histone H3.2 [Zea mays]
 gb|AFW85733.1| histone H3.2 isoform 1 [Zea mays]
 gb|AFW85734.1| histone H3.2 isoform 2 [Zea mays]
 tpg|DAA37864.1| TPA: histone H3.2 [Zea mays]
 tpg|DAA53403.1| TPA: histone H3.2 [Zea mays]
 gb|EMJ07329.1| hypothetical protein PRUPE_ppa013165mg [Prunus persica]
 gb|EMJ07330.1| hypothetical protein PRUPE_ppa013174mg [Prunus persica]
 gb|EMJ15173.1| hypothetical protein PRUPE_ppa013173mg [Prunus persica]
 gb|EOA22021.1| hypothetical protein CARUB_v10002544mg [Capsella rubella]
 gb|EOA22699.1| hypothetical protein CARUB_v10003405mg [Capsella rubella]
 gb|EOA25431.1| hypothetical protein CARUB_v10018763mg [Capsella rubella]
 gb|EOA37535.1| hypothetical protein CARUB_v10011755mg [Capsella rubella]
 gb|EOX91995.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY32556.1| Histone superfamily protein [Theobroma cacao]
 gb|EPS69903.1| hypothetical protein M569_04854 [Genlisea aurea]
 gb|ERM95023.1| hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda]
 gb|ERN16002.1| hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda]
 gb|EEE98723.2| hypothetical protein POPTR_0014s09260g [Populus trichocarpa]
 gb|ERP63908.1| hypothetical protein POPTR_0003s22240g [Populus trichocarpa]
 gb|ERP63992.1| hypothetical protein POPTR_0002s03030g [Populus trichocarpa]
 gb|ESQ31330.1| hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum]
 gb|ESQ31480.1| hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum]
 gb|ESQ38364.1| hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum]
 gb|ESQ40985.1| hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum]
 gb|ESQ40987.1| hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum]
 gb|ESR39550.1| hypothetical protein CICLE_v10026742mg [Citrus clementina]
 gb|ESR59247.1| hypothetical protein CICLE_v10017132mg [Citrus clementina]
 gb|ESR59252.1| hypothetical protein CICLE_v10017131mg [Citrus clementina]
 gb|ESR59267.1| hypothetical protein CICLE_v10017133mg [Citrus clementina]
 gb|EXB28981.1| Histone [Morus notabilis]
 gb|EXB28982.1| Histone [Morus notabilis]
 gb|EXB48389.1| Histone [Morus notabilis]
 gb|EXB48391.1| Histone [Morus notabilis]
 gb|EXC30548.1| Histone [Morus notabilis]
 gb|EYU18019.1| hypothetical protein MIMGU_mgv1a016053mg [Erythranthe guttata]
 gb|EYU18357.1| hypothetical protein MIMGU_mgv1a016039mg [Erythranthe guttata]
 gb|EYU26936.1| hypothetical protein MIMGU_mgv1a016046mg [Erythranthe guttata]
 gb|EYU39090.1| hypothetical protein MIMGU_mgv1a016037mg [Erythranthe guttata]
 gb|EYU43364.1| hypothetical protein MIMGU_mgv1a024982mg [Erythranthe guttata]
 gb|EYU46298.1| hypothetical protein MIMGU_mgv1a016044mg [Erythranthe guttata]
 gb|KCW52687.1| hypothetical protein EUGRSUZ_J02055 [Eucalyptus grandis]
 gb|KCW87138.1| hypothetical protein EUGRSUZ_B03665 [Eucalyptus grandis]
 gb|KDO60645.1| hypothetical protein CISIN_1g032664mg [Citrus sinensis]
 gb|KDO64858.1| hypothetical protein CISIN_1g032661mg [Citrus sinensis]
 gb|KDO64866.1| hypothetical protein CISIN_1g032673mg [Citrus sinensis]
 gb|KDO64873.1| hypothetical protein CISIN_1g032676mg [Citrus sinensis]
 gb|KDP20190.1| hypothetical protein JCGZ_07910 [Jatropha curcas]
 gb|KDP21024.1| hypothetical protein JCGZ_21495 [Jatropha curcas]
 emb|CDP11387.1| unnamed protein product [Coffea canephora]
 emb|CDP07721.1| unnamed protein product [Coffea canephora]
 emb|CDP07722.1| unnamed protein product [Coffea canephora]
 gb|KFK25331.1| hypothetical protein AALP_AA8G099000 [Arabis alpina]
 gb|KFK25332.1| hypothetical protein AALP_AA8G099100 [Arabis alpina]
 gb|KFK28215.1| hypothetical protein AALP_AA8G487700 [Arabis alpina]
 gb|KFK28217.1| hypothetical protein AALP_AA8G487900 [Arabis alpina]
 gb|KFK43216.1| hypothetical protein AALP_AA1G095700 [Arabis alpina]
 emb|CDX96998.1| BnaC09g46270D [Brassica napus]
 emb|CDX69839.1| BnaA10g21880D [Brassica napus]
 gb|KGN54155.1| histone H3 [Cucumis sativus]
 gb|AIZ04726.1| histone 3 [Elettaria cardamomum]
 gb|KJB21399.1| hypothetical protein B456_004G040400 [Gossypium raimondii]
 gb|KJB21400.1| hypothetical protein B456_004G040400 [Gossypium raimondii]
 gb|KJB27088.1| hypothetical protein B456_004G277200 [Gossypium raimondii]
 gb|KJB54045.1| hypothetical protein B456_009G018200 [Gossypium raimondii]
 gb|KJB70057.1| hypothetical protein B456_011G056400 [Gossypium raimondii]
 gb|KJB70058.1| hypothetical protein B456_011G056400 [Gossypium raimondii]
 gb|KJB70059.1| hypothetical protein B456_011G056500 [Gossypium raimondii]
 gb|KJB83503.1| hypothetical protein B456_013G250500 [Gossypium raimondii]
 prf||1303352A histone H3
 prf||1314298B histone H3
Length=136

 Score =   235 bits (600),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_010424704.1| PREDICTED: histone H3-like centromeric protein CNA1 [Camelina 
sativa]
Length=302

 Score =   241 bits (615),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 142/152 (93%), Gaps = 5/152 (3%)
 Frame = +2

Query  11   SNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  190
            +N C   I FE     MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP
Sbjct  156  TNICFKLIHFE-----MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  210

Query  191  GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGL  370
            GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL
Sbjct  211  GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL  270

Query  371  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  271  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  302


 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_005519548.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
Length=140

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQK
Sbjct  2    VLAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQK  61

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct  62   STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR  121

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  122  VTIMPKDIQLARRIRGERA  140



>gb|KJB67030.1| hypothetical protein B456_010G171000 [Gossypium raimondii]
Length=193

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK
Sbjct  55   VLQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  114

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKR
Sbjct  115  STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKR  174

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  175  VTIMPKDIQLARRIRGERA  193



>ref|XP_007013423.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY31042.1| Histone superfamily protein [Theobroma cacao]
Length=220

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            + +PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ
Sbjct  81   TFLPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  140

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  141  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK  200

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKDIQLARRIRGERA
Sbjct  201  RVTIMPKDIQLARRIRGERA  220



>ref|XP_001862683.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37375.1| histone H3.1t [Culex quinquefasciatus]
Length=151

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +2

Query  35   QFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREI  214
            +++ + + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREI
Sbjct  8    EYKSTSIAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREI  67

Query  215  RKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCA  394
            R+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCA
Sbjct  68   RRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCA  127

Query  395  IHAKRVTIMPKDIQLARRIRGERA  466
            IHAKRVTIMPKDIQLARRIRGERA
Sbjct  128  IHAKRVTIMPKDIQLARRIRGERA  151



>ref|XP_001177217.2| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
 ref|XP_794816.3| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
Length=145

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            SI  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQ
Sbjct  6    SIFSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ  65

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  66   KSTELLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  125

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKDIQLARRIRGERA
Sbjct  126  RVTIMPKDIQLARRIRGERA  145



>emb|CDP18134.1| unnamed protein product [Coffea canephora]
Length=136

 Score =   235 bits (599),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT+
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTV  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AFK39648.1| unknown [Medicago truncatula]
Length=136

 Score =   235 bits (599),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_005461835.1| PREDICTED: histone H3.2-like isoform X2 [Oreochromis niloticus]
Length=221

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            + PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQK
Sbjct  83   LSPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQK  142

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct  143  STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR  202

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  203  VTIMPKDIQLARRIRGERA  221



>ref|XP_003082036.1| Histones H3 and H4 (ISS) [Ostreococcus tauri]
Length=167

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            S V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQ
Sbjct  28   STVNMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQ  87

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  88   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAK  147

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKD+QLARRIRGERA
Sbjct  148  RVTIMPKDVQLARRIRGERA  167



>gb|KJB71213.1| hypothetical protein B456_011G110600 [Gossypium raimondii]
Length=181

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  46   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  105

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  106  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  165

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  166  MPKDIQLARRIRGERA  181



>emb|CEF62715.1| Histone H3 [Strongyloides ratti]
 emb|CEF62882.1| Histone H3 [Strongyloides ratti]
Length=136

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE+AEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002962371.1| hypothetical protein SELMODRAFT_78992 [Selaginella moellendorffii]
 ref|XP_002962905.1| hypothetical protein SELMODRAFT_438193 [Selaginella moellendorffii]
 ref|XP_002973738.1| hypothetical protein SELMODRAFT_99535 [Selaginella moellendorffii]
 ref|XP_002975787.1| hypothetical protein SELMODRAFT_103546 [Selaginella moellendorffii]
 gb|EFJ23416.1| hypothetical protein SELMODRAFT_103546 [Selaginella moellendorffii]
 gb|EFJ25398.1| hypothetical protein SELMODRAFT_99535 [Selaginella moellendorffii]
 gb|EFJ35834.1| hypothetical protein SELMODRAFT_78992 [Selaginella moellendorffii]
 gb|EFJ36368.1| hypothetical protein SELMODRAFT_438193 [Selaginella moellendorffii]
Length=136

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_008461433.1| PREDICTED: histone H3.v1-like [Cucumis melo]
Length=331

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 143/153 (93%), Gaps = 1/153 (1%)
 Frame = +2

Query  11   SNFCNLYIQFELSIVP-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  187
            SNF     QF L   P MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR
Sbjct  179  SNFRTQIFQFLLYQFPRMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  238

Query  188  PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvG  367
            PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVG
Sbjct  239  PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVG  298

Query  368  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  299  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  331


 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAV65112.1| histone 3 [Camellia sinensis]
Length=136

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAE+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD+QLARRIRGERA
Sbjct  121  MPKDMQLARRIRGERA  136



>ref|XP_004252600.1| PREDICTED: histone H3.2-like [Solanum lycopersicum]
 ref|XP_006364137.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_008795734.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
Length=136

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD+QLARRIRGERA
Sbjct  121  MPKDMQLARRIRGERA  136



>ref|XP_006368568.1| hypothetical protein POPTR_0001s05450g [Populus trichocarpa]
 gb|ERP65137.1| hypothetical protein POPTR_0001s05450g [Populus trichocarpa]
Length=221

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  56   PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST  235
            PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST
Sbjct  85   PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST  144

Query  236  ELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVT  415
            ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT
Sbjct  145  ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT  204

Query  416  IMPKDIQLARRIRGERA  466
            IMPKDIQLARRIRGERA
Sbjct  205  IMPKDIQLARRIRGERA  221



>ref|XP_001753449.1| histone H3 [Physcomitrella patens]
 ref|XP_001754164.1| histone H3 [Physcomitrella patens]
 ref|XP_001755072.1| histone H3 [Physcomitrella patens]
 ref|XP_001759106.1| histone H3 [Physcomitrella patens]
 ref|XP_001767746.1| histone H3 [Physcomitrella patens]
 ref|XP_001772912.1| histone H3 [Physcomitrella patens]
 ref|XP_001773579.1| histone H3 [Physcomitrella patens]
 ref|XP_001784559.1| histone H3 [Physcomitrella patens]
 ref|XP_001785890.1| histone H3 [Physcomitrella patens]
 gb|EDQ49299.1| histone H3 [Physcomitrella patens]
 gb|EDQ50624.1| histone H3 [Physcomitrella patens]
 gb|EDQ61617.1| histone H3 [Physcomitrella patens]
 gb|EDQ62314.1| histone H3 [Physcomitrella patens]
 gb|EDQ67497.1| histone H3 [Physcomitrella patens]
 gb|EDQ76175.1| histone H3 [Physcomitrella patens]
 gb|EDQ80016.1| histone H3 [Physcomitrella patens]
 gb|EDQ81065.1| histone H3 [Physcomitrella patens]
 gb|EDQ81672.1| histone H3 [Physcomitrella patens]
Length=136

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>sp|P08903.2|H32_ENCAL RecName: Full=Histone H3.2 [Encephalartos altensteinii]
Length=136

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004384835.1| PREDICTED: histone H3.1t-like isoform 1 [Trichechus manatus latirostris]
Length=146

 Score =   234 bits (598),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  32   IQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALRE  211
            +   L +V MARTKQTARKSTGGKAPRKQLATK ARKSAPATGGVKKPHR+RPGTVALRE
Sbjct  2    LNHSLILVVMARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALRE  61

Query  212  IRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLC  391
            IR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA E+YLVGLFEDTNLC
Sbjct  62   IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLC  121

Query  392  AIHAKRVTIMPKDIQLARRIRGERA  466
            AIHAKRVTIMPKDIQLARRIRGERA
Sbjct  122  AIHAKRVTIMPKDIQLARRIRGERA  146



>ref|XP_005852293.1| hypothetical protein CHLNCDRAFT_28967 [Chlorella variabilis]
 ref|XP_005843099.1| hypothetical protein CHLNCDRAFT_141512 [Chlorella variabilis]
 ref|XP_005843639.1| hypothetical protein CHLNCDRAFT_27828 [Chlorella variabilis]
 ref|XP_005843701.1| hypothetical protein CHLNCDRAFT_27880 [Chlorella variabilis]
 ref|XP_005847128.1| hypothetical protein CHLNCDRAFT_24354 [Chlorella variabilis]
 ref|XP_005847291.1| hypothetical protein CHLNCDRAFT_48847 [Chlorella variabilis]
 gb|EFN50577.1| hypothetical protein CHLNCDRAFT_28967 [Chlorella variabilis]
 gb|EFN50997.1| hypothetical protein CHLNCDRAFT_141512 [Chlorella variabilis]
 gb|EFN51537.1| hypothetical protein CHLNCDRAFT_27828 [Chlorella variabilis]
 gb|EFN51599.1| hypothetical protein CHLNCDRAFT_27880 [Chlorella variabilis]
 gb|EFN55026.1| hypothetical protein CHLNCDRAFT_24354 [Chlorella variabilis]
 gb|EFN55189.1| hypothetical protein CHLNCDRAFT_48847 [Chlorella variabilis]
 gb|KIZ01084.1| Histone H3 [Monoraphidium neglectum]
Length=136

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003630193.1| Histone H3 [Medicago truncatula]
 ref|XP_003630195.1| Histone H3 [Medicago truncatula]
Length=213

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/138 (98%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERALG  472
            MPKDIQLARRIRGER +G
Sbjct  121  MPKDIQLARRIRGERIVG  138



>ref|XP_001862696.1| Histone H3c [Culex quinquefasciatus]
 gb|EDS37388.1| Histone H3c [Culex quinquefasciatus]
Length=169

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKS
Sbjct  32   IAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  91

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV
Sbjct  92   TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV  151

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  152  TIMPKDIQLARRIRGERA  169



>ref|XP_008669425.1| PREDICTED: histone H3.2-like [Zea mays]
 tpg|DAA37858.1| TPA: histone H3.2 [Zea mays]
Length=169

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  34   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  93

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  94   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  153

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  154  MPKDIQLARRIRGERA  169



>gb|EFZ22370.1| hypothetical protein SINV_16114 [Solenopsis invicta]
Length=147

 Score =   234 bits (598),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            I  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQK
Sbjct  9    IFAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQK  68

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct  69   STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR  128

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  129  VTIMPKDIQLARRIRGERA  147



>ref|XP_004229367.1| PREDICTED: histone H3.2-like [Solanum lycopersicum]
 ref|XP_006349141.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
Length=136

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVG+FEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGVFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001865500.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS41772.1| histone H3.3 type 2 [Culex quinquefasciatus]
Length=158

 Score =   234 bits (598),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  23   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  82

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  83   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  142

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  143  MPKDIQLARRIRGERA  158



>gb|AAA33907.1| histone 3 [Oryza sativa]
 gb|AAA74190.1| histone H3 [Oryza sativa Indica Group]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQ+SAV ALQEAAE YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQTSAVRALQEAAERYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001745925.1| hypothetical protein [Monosiga brevicollis MX1]
 ref|XP_001747171.1| hypothetical protein [Monosiga brevicollis MX1]
 ref|XP_001749159.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85965.1| predicted protein [Monosiga brevicollis MX1]
 gb|EDQ88095.1| predicted protein [Monosiga brevicollis MX1]
 gb|EDQ89349.1| predicted protein [Monosiga brevicollis MX1]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSTAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACN40064.1| unknown [Picea sitchensis]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST+
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTD  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>sp|Q402E1.3|H32_LILLO RecName: Full=Histone H3.2 [Lilium longiflorum]
 dbj|BAE20250.1| histone H3 [Lilium longiflorum]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFK DLRFQSSAVAALQEA+E+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKADLRFQSSAVAALQEASESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002502604.1| histone H3 [Micromonas sp. RCC299]
 ref|XP_002509008.1| histone H3 [Micromonas sp. RCC299]
 ref|XP_003059221.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_003061708.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_003061754.1| histone H3 [Micromonas pusilla CCMP1545]
 gb|EEH54338.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54384.1| histone H3 [Micromonas pusilla CCMP1545]
 gb|EEH56353.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|ACO63862.1| histone H3 [Micromonas sp. RCC299]
 gb|ACO70266.1| histone H3 [Micromonas sp. RCC299]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAILALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_010260926.1| PREDICTED: histone H3.2-like [Nelumbo nucifera]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
             LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   FLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001418070.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_001420504.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_007509458.1| histone H3 [Bathycoccus prasinos]
 ref|XP_007509586.1| histone H3 [Bathycoccus prasinos]
 ref|XP_007514322.1| histone H3 [Bathycoccus prasinos]
 gb|ABO96363.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98797.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 emb|CCO19261.1| histone H3 [Bathycoccus prasinos]
 emb|CCO19389.1| histone H3 [Bathycoccus prasinos]
 emb|CCO15759.1| histone H3 [Bathycoccus prasinos]
 emb|CEF99669.1| Histone core [Ostreococcus tauri]
 emb|CEF98083.1| Histone core [Ostreococcus tauri]
Length=136

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD+QLARRIRGERA
Sbjct  121  MPKDVQLARRIRGERA  136



>ref|XP_009782179.1| PREDICTED: histone H3.2-like [Nicotiana sylvestris]
 ref|XP_010276199.1| PREDICTED: histone H3.2-like [Nelumbo nucifera]
Length=136

 Score =   234 bits (596),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIH KRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHGKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACG25071.1| histone H3 [Zea mays]
Length=136

 Score =   233 bits (595),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQT RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTTRKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|NP_001104686.1| histone cluster 3, H3 [Danio rerio]
 ref|XP_008303999.1| PREDICTED: histone H3-like [Stegastes partitus]
 ref|XP_009301184.1| PREDICTED: histone H3-like [Danio rerio]
 ref|XP_009296488.1| PREDICTED: histone H3-like [Danio rerio]
 ref|XP_010746473.1| PREDICTED: histone H3-like [Larimichthys crocea]
 ref|XP_010787183.1| PREDICTED: histone H3 [Notothenia coriiceps]
 gb|AAI54137.1| Zgc:173552 protein [Danio rerio]
Length=136

 Score =   233 bits (595),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004562239.1| PREDICTED: histone H3.2-like [Maylandia zebra]
Length=136

 Score =   233 bits (595),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV A+QEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAVQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003770651.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
Length=136

 Score =   233 bits (595),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+E+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CCD60248.1| histone H3, putative [Schistosoma mansoni]
 emb|CCD77737.1| putative histone H3 [Schistosoma mansoni]
Length=136

 Score =   233 bits (595),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_005527779.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
Length=138

 Score =   233 bits (595),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKS
Sbjct  1    MAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  60

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV
Sbjct  61   TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV  120

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  121  TIMPKDIQLARRIRGERA  138



>gb|EPY79586.1| histone H3.2-like protein [Camelus ferus]
Length=152

 Score =   234 bits (597),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = +2

Query  11   SNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  190
            S  C   + F L+   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RP
Sbjct  4    SKRCAGNLVFWLA---MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRP  60

Query  191  GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGL  370
            GTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGL
Sbjct  61   GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL  120

Query  371  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  121  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  152



>ref|XP_003977328.1| PREDICTED: histone H3.2-like, partial [Takifugu rubripes]
Length=155

 Score =   234 bits (597),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  20   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  79

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  80   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  139

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  140  MPKDIQLARRIRGERA  155



>ref|XP_001620157.1| hypothetical protein NEMVEDRAFT_v1g148952 [Nematostella vectensis]
 gb|EDO28057.1| predicted protein, partial [Nematostella vectensis]
Length=140

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  5    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  64

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  65   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  124

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  125  MPKDIQLARRIRGERA  140



>gb|EMC89182.1| Histone H3, partial [Columba livia]
 gb|EOB06698.1| Histone H3, partial [Anas platyrhynchos]
 gb|EOB06725.1| Histone H3, partial [Anas platyrhynchos]
Length=137

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  61

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  62   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  121

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  122  MPKDIQLARRIRGERA  137



>ref|XP_003384122.1| PREDICTED: histone H3-like [Amphimedon queenslandica]
 ref|XP_003384138.1| PREDICTED: histone H3-like [Amphimedon queenslandica]
Length=136

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|NP_038576.1| histone H3.2 [Mus musculus]
 ref|NP_473386.1| histone H3.2 [Mus musculus]
 ref|NP_724345.1| histone H3 [Drosophila melanogaster]
 ref|NP_835511.1| histone H3.2 [Mus musculus]
 ref|NP_835510.1| histone H3.2 [Mus musculus]
 ref|NP_835512.1| histone H3.2 [Mus musculus]
 ref|NP_835587.1| histone H3.2 [Mus musculus]
 ref|NP_783584.1| histone H3.2 [Mus musculus]
 ref|NP_066403.2| histone H3.2 [Homo sapiens]
 ref|NP_001005464.1| histone H3.2 [Homo sapiens]
 ref|NP_001016636.1| histone H3.2 [Xenopus (Silurana) tropicalis]
 ref|NP_001020347.1| histone [Danio rerio]
 ref|NP_001027285.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027289.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027294.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027298.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027303.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027308.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027313.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027318.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027323.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027328.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027333.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027338.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027343.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027348.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027353.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027358.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027363.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027368.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027373.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027378.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027383.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027387.1| histone H3 [Drosophila melanogaster]
 ref|NP_001040399.1| histone H3 [Bombyx mori]
 ref|NP_001091428.1| histone H3.2 [Xenopus laevis]
 ref|NP_001093643.1| H3 histone, family 2-like [Danio rerio]
 ref|NP_001101168.1| histone cluster 2, H3c2 [Rattus norvegicus]
 ref|NP_001116847.1| histone H3.2 [Homo sapiens]
 ref|NP_001160041.1| histone H3.2 [Bos taurus]
 ref|NP_835734.2| histone H3.2 [Mus musculus]
 ref|NP_001231571.1| histone H3.2 [Sus scrofa]
 ref|NP_001268409.1| histone H3.2-like [Gallus gallus]
 ref|NP_001268438.1| histone H3.2-like [Gallus gallus]
 ref|XP_969677.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_969597.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_975418.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_966487.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_001084245.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001120132.1| PREDICTED: histone H3-like [Apis mellifera]
 ref|XP_001232833.1| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_001233028.1| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_416193.2| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_001335303.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_001364839.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
 ref|XP_001514437.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001506572.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001513360.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001509264.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001500143.1| PREDICTED: histone H3.2-like [Equus caballus]
 ref|XP_001618211.1| hypothetical protein NEMVEDRAFT_v1g227799 [Nematostella vectensis]
 ref|XP_001618631.1| hypothetical protein NEMVEDRAFT_v1g227782 [Nematostella vectensis]
 ref|XP_001619112.1| hypothetical protein NEMVEDRAFT_v1g196006 [Nematostella vectensis]
 ref|XP_001619731.1| hypothetical protein NEMVEDRAFT_v1g227739 [Nematostella vectensis]
 ref|XP_001619868.1| hypothetical protein NEMVEDRAFT_v1g227737 [Nematostella vectensis]
 ref|XP_001622884.1| predicted protein [Nematostella vectensis]
 ref|XP_001622885.1| predicted protein [Nematostella vectensis]
 ref|XP_001628765.1| predicted protein [Nematostella vectensis]
 ref|XP_001628767.1| predicted protein [Nematostella vectensis]
 ref|XP_001632610.1| predicted protein [Nematostella vectensis]
 ref|XP_001633293.1| predicted protein [Nematostella vectensis]
 ref|XP_001638461.1| predicted protein [Nematostella vectensis]
 ref|XP_001638527.1| predicted protein [Nematostella vectensis]
 ref|XP_001639376.1| predicted protein [Nematostella vectensis]
 ref|XP_001640345.1| predicted protein [Nematostella vectensis]
 ref|XP_001640368.1| predicted protein [Nematostella vectensis]
 ref|XP_001640467.1| predicted protein [Nematostella vectensis]
 ref|XP_001640469.1| predicted protein [Nematostella vectensis]
 ref|XP_001608284.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599673.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001603659.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001607608.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001607935.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001607330.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001608235.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001608238.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599561.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599419.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001618759.1| hypothetical protein NEMVEDRAFT_v1g227772 [Nematostella vectensis]
 ref|XP_001618804.1| hypothetical protein NEMVEDRAFT_v1g227771 [Nematostella vectensis]
 ref|XP_001662236.1| AAEL012072-PA [Aedes aegypti]
 ref|XP_001656985.1| AAEL000492-PA [Aedes aegypti]
 ref|XP_001656989.1| AAEL000482-PA [Aedes aegypti]
 ref|XP_001656993.1| AAEL000506-PA [Aedes aegypti]
 ref|XP_001657156.1| AAEL003659-PA [Aedes aegypti]
 ref|XP_001657265.1| AAEL003852-PA [Aedes aegypti]
 ref|XP_001657268.1| AAEL003850-PA [Aedes aegypti]
 ref|XP_001657272.1| AAEL003856-PA [Aedes aegypti]
 ref|XP_001657274.1| AAEL003828-PA [Aedes aegypti]
 ref|XP_001657279.1| AAEL003836-PA [Aedes aegypti]
 ref|XP_305996.3| Anopheles gambiae str. PEST AGAP012559-PA [Anopheles gambiae 
str. PEST]
 ref|XP_307601.3| AGAP005025-PA [Anopheles gambiae str. PEST]
 ref|XP_307606.3| Anopheles gambiae str. PEST AGAP012572-PA [Anopheles gambiae 
str. PEST]
 ref|XP_560604.5| Anopheles gambiae str. PEST AGAP012573-PA [Anopheles gambiae 
str. PEST]
 ref|XP_315130.3| AGAP005024-PA [Anopheles gambiae str. PEST]
 ref|XP_318362.3| AGAP003910-PA [Anopheles gambiae str. PEST]
 ref|XP_001847464.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001862655.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862660.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001862665.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001862670.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001862678.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862687.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862694.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862700.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001865169.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001865497.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001950199.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_001964806.1| GF22293 [Drosophila ananassae]
 ref|XP_001964811.1| GF22265 [Drosophila ananassae]
 ref|XP_001964821.1| GF22200 [Drosophila ananassae]
 ref|XP_001967678.1| GF15887 [Drosophila ananassae]
 ref|XP_001967729.1| GF15922 [Drosophila ananassae]
 ref|XP_001967755.1| GF20380 [Drosophila ananassae]
 ref|XP_001967758.1| GF20359 [Drosophila ananassae]
 ref|XP_001967770.1| GF21522 [Drosophila ananassae]
 ref|XP_001967787.1| GF20165 [Drosophila ananassae]
 ref|XP_001967819.1| GF22855 [Drosophila ananassae]
 ref|XP_001967879.1| GF21669 [Drosophila ananassae]
 ref|XP_001967892.1| GF21608 [Drosophila ananassae]
 ref|XP_001973986.1| GG21334 [Drosophila erecta]
 ref|XP_001973988.1| GG21333 [Drosophila erecta]
 ref|XP_001973993.1| GG21330 [Drosophila erecta]
 ref|XP_001973998.1| GG21326 [Drosophila erecta]
 ref|XP_001974003.1| GG21323 [Drosophila erecta]
 ref|XP_001974008.1| GG21320 [Drosophila erecta]
 ref|XP_001974013.1| GG21316 [Drosophila erecta]
 ref|XP_001974018.1| GG21313 [Drosophila erecta]
 ref|XP_001974023.1| GG21310 [Drosophila erecta]
 ref|XP_001974028.1| GG21307 [Drosophila erecta]
 ref|XP_001982893.1| GG11010 [Drosophila erecta]
 ref|XP_001982898.1| GG11007 [Drosophila erecta]
 ref|XP_001982903.1| GG11004 [Drosophila erecta]
 ref|XP_001982908.1| GG11000 [Drosophila erecta]
 ref|XP_001982917.1| GG13024 [Drosophila erecta]
 ref|XP_001982922.1| GG13020 [Drosophila erecta]
 ref|XP_001982932.1| GG13014 [Drosophila erecta]
 ref|XP_001982948.1| GG12579 [Drosophila erecta]
 ref|XP_001982953.1| GG12575 [Drosophila erecta]
 ref|XP_001983005.1| GG19850 [Drosophila erecta]
 ref|XP_001983022.1| GG18243 [Drosophila erecta]
 ref|XP_001983043.1| GG12955 [Drosophila erecta]
 ref|XP_001983061.1| GG16369 [Drosophila erecta]
 ref|XP_001983067.1| GG19830 [Drosophila erecta]
 ref|XP_001983092.1| GG12990 [Drosophila erecta]
 ref|XP_001983100.1| GG19806 [Drosophila erecta]
 ref|XP_001983110.1| GG19816 [Drosophila erecta]
 ref|XP_001983112.1| GG16357 [Drosophila erecta]
 ref|XP_001983115.1| GG19791 [Drosophila erecta]
 ref|XP_001983116.1| GG13062 [Drosophila erecta]
 ref|XP_001983139.1| GG12995 [Drosophila erecta]
 ref|XP_001983140.1| GG13008 [Drosophila erecta]
 ref|XP_001996376.1| GH25148 [Drosophila grimshawi]
 ref|XP_001996381.1| GH25152 [Drosophila grimshawi]
 ref|XP_001996386.1| GH25155 [Drosophila grimshawi]
 ref|XP_001996391.1| GH25158 [Drosophila grimshawi]
 ref|XP_001996395.1| GH25160 [Drosophila grimshawi]
 ref|XP_001996399.1| GH25162 [Drosophila grimshawi]
 ref|XP_001996404.1| GH25165 [Drosophila grimshawi]
 ref|XP_001996409.1| GH25168 [Drosophila grimshawi]
 ref|XP_001996414.1| GH25173 [Drosophila grimshawi]
 ref|XP_001996419.1| GH25176 [Drosophila grimshawi]
 ref|XP_001996422.1| GH25177 [Drosophila grimshawi]
 ref|XP_001996426.1| GH25179 [Drosophila grimshawi]
 ref|XP_001996431.1| GH25183 [Drosophila grimshawi]
 ref|XP_001996435.1| GH25185 [Drosophila grimshawi]
 ref|XP_001996798.1| GH23344 [Drosophila grimshawi]
 ref|XP_001996804.1| GH23339 [Drosophila grimshawi]
 ref|XP_001996813.1| GH23334 [Drosophila grimshawi]
 ref|XP_001996816.1| GH23332 [Drosophila grimshawi]
 ref|XP_001997180.1| GH23876 [Drosophila grimshawi]
 ref|XP_001997205.1| GH10171 [Drosophila grimshawi]
 ref|XP_001997209.1| GH10149 [Drosophila grimshawi]
 ref|XP_001997410.1| GH23765 [Drosophila grimshawi]
 ref|XP_001997414.1| GH23762 [Drosophila grimshawi]
 ref|XP_001997685.1| GH23504 [Drosophila grimshawi]
 ref|XP_001997736.1| GH13936 [Drosophila grimshawi]
 ref|XP_001997787.1| GH23513 [Drosophila grimshawi]
 ref|XP_001997839.1| GH25000 [Drosophila grimshawi]
 ref|XP_001997901.1| GH23749 [Drosophila grimshawi]
 ref|XP_001997983.1| GH23469 [Drosophila grimshawi]
 ref|XP_001997993.1| GH23572 [Drosophila grimshawi]
 ref|XP_001998117.1| GH24949 [Drosophila grimshawi]
 ref|XP_001998773.1| GI23446 [Drosophila mojavensis]
 ref|XP_001998779.1| GI23442 [Drosophila mojavensis]
 ref|XP_001998783.1| GI23440 [Drosophila mojavensis]
 ref|XP_001998787.1| GI23438 [Drosophila mojavensis]
 ref|XP_002002201.1| GI17251 [Drosophila mojavensis]
 ref|XP_002002205.1| GI17253 [Drosophila mojavensis]
 ref|XP_002002209.1| GI17255 [Drosophila mojavensis]
 ref|XP_002002990.1| GI24857 [Drosophila mojavensis]
 ref|XP_002012537.1| GI16893 [Drosophila mojavensis]
 ref|XP_002012558.1| GI21876 [Drosophila mojavensis]
 ref|XP_002012640.1| GI11258 [Drosophila mojavensis]
 ref|XP_002012683.1| GI12713 [Drosophila mojavensis]
 ref|XP_002013119.1| GL23951 [Drosophila persimilis]
 ref|XP_002013125.1| GL23955 [Drosophila persimilis]
 ref|XP_002013130.1| GL23958 [Drosophila persimilis]
 ref|XP_002013135.1| GL23961 [Drosophila persimilis]
 ref|XP_002029055.1| GL17801 [Drosophila persimilis]
 ref|XP_002029392.1| GL22373 [Drosophila persimilis]
 ref|XP_002029490.1| GL19701 [Drosophila persimilis]
 ref|XP_002044743.1| GM19709 [Drosophila sechellia]
 ref|XP_002044746.1| GM19711 [Drosophila sechellia]
 ref|XP_002044756.1| GM19719 [Drosophila sechellia]
 ref|XP_002044761.1| GM19722 [Drosophila sechellia]
 ref|XP_002044765.1| GM19726 [Drosophila sechellia]
 ref|XP_002044770.1| GM19729 [Drosophila sechellia]
 ref|XP_002044955.1| GM13193 [Drosophila sechellia]
 ref|XP_002044960.1| GM13196 [Drosophila sechellia]
 ref|XP_002045027.1| GM11711 [Drosophila sechellia]
 ref|XP_002045032.1| GM11708 [Drosophila sechellia]
 ref|XP_002045046.1| GM13543 [Drosophila sechellia]
 ref|XP_002045054.1| GM22103 [Drosophila sechellia]
 ref|XP_002045058.1| GM21950 [Drosophila sechellia]
 ref|XP_002045092.1| GM19738 [Drosophila sechellia]
 ref|XP_002045256.1| GM13582 [Drosophila sechellia]
 ref|XP_002045356.1| GM11166 [Drosophila sechellia]
 ref|XP_002045363.1| GM12074 [Drosophila sechellia]
 ref|XP_002045368.1| GM12385 [Drosophila sechellia]
 ref|XP_002045378.1| GM19759 [Drosophila sechellia]
 ref|XP_002045385.1| GM11184 [Drosophila sechellia]
 ref|XP_002045390.1| GM11181 [Drosophila sechellia]
 ref|XP_002045409.1| GM13626 [Drosophila sechellia]
 ref|XP_002045494.1| GM19325 [Drosophila sechellia]
 ref|XP_002045512.1| GM19753 [Drosophila sechellia]
 ref|XP_002045517.1| GM18735 [Drosophila sechellia]
 ref|XP_002045522.1| GM16232 [Drosophila sechellia]
 ref|XP_002045595.1| GM16108 [Drosophila sechellia]
 ref|XP_002045615.1| GM19311 [Drosophila sechellia]
 ref|XP_002045619.1| GM17398 [Drosophila sechellia]
 ref|XP_002045639.1| GM13124 [Drosophila sechellia]
 ref|XP_002045689.1| GM26727 [Drosophila sechellia]
 ref|XP_002045695.1| GM13179 [Drosophila sechellia]
 ref|XP_002045699.1| GM19314 [Drosophila sechellia]
 ref|XP_002045729.1| GM10805 [Drosophila sechellia]
 ref|XP_002045779.1| GM18805 [Drosophila sechellia]
 ref|XP_002045782.1| GM15453 [Drosophila sechellia]
 ref|XP_002045809.1| GM11148 [Drosophila sechellia]
 ref|XP_002045812.1| GM16280 [Drosophila sechellia]
 ref|XP_002045829.1| GM24967 [Drosophila sechellia]
 ref|XP_002045835.1| GM19343 [Drosophila sechellia]
 ref|XP_002045863.1| GM17442 [Drosophila sechellia]
 ref|XP_002045876.1| GM19655 [Drosophila sechellia]
 ref|XP_002045918.1| GM16397 [Drosophila sechellia]
 ref|XP_002045937.1| GM13139 [Drosophila sechellia]
 ref|XP_002045949.1| GM23425 [Drosophila sechellia]
 ref|XP_002045972.1| GM15133 [Drosophila sechellia]
 ref|XP_002045990.1| GM11042 [Drosophila sechellia]
 ref|XP_002046018.1| GM19648 [Drosophila sechellia]
 ref|XP_002046072.1| GM16257 [Drosophila sechellia]
 ref|XP_002052265.1| GJ22585 [Drosophila virilis]
 ref|XP_002052270.1| GJ22552 [Drosophila virilis]
 ref|XP_002052273.1| GJ22537 [Drosophila virilis]
 ref|XP_002053092.1| GJ23692 [Drosophila virilis]
 ref|XP_002053096.1| GJ23694 [Drosophila virilis]
 ref|XP_002053101.1| GJ23698 [Drosophila virilis]
 ref|XP_002053106.1| GJ23701 [Drosophila virilis]
 ref|XP_002053110.1| GJ23703 [Drosophila virilis]
 ref|XP_002053117.1| GJ23707 [Drosophila virilis]
 ref|XP_002053122.1| GJ23711 [Drosophila virilis]
 ref|XP_002060410.1| GJ15448 [Drosophila virilis]
 ref|XP_002060424.1| GJ16344 [Drosophila virilis]
 ref|XP_002060427.1| GJ16346 [Drosophila virilis]
 ref|XP_002060451.1| GJ19811 [Drosophila virilis]
 ref|XP_002060477.1| GJ18401 [Drosophila virilis]
 ref|XP_002060488.1| GJ15165 [Drosophila virilis]
 ref|XP_002060513.1| GJ18405 [Drosophila virilis]
 ref|XP_002060514.1| GJ18585 [Drosophila virilis]
 ref|XP_002060537.1| GJ17075 [Drosophila virilis]
 ref|XP_002060571.1| GJ16113 [Drosophila virilis]
 ref|XP_002060604.1| GK19157 [Drosophila willistoni]
 ref|XP_002069210.1| GK10380 [Drosophila willistoni]
 ref|XP_002069215.1| GK18893 [Drosophila willistoni]
 ref|XP_002075740.1| GK19237 [Drosophila willistoni]
 ref|XP_002076069.1| GK21132 [Drosophila willistoni]
 ref|XP_002077254.1| GD21986 [Drosophila simulans]
 ref|XP_002077334.1| GD11866 [Drosophila simulans]
 ref|XP_002077350.1| GD11987 [Drosophila simulans]
 ref|XP_002077373.1| GD12595 [Drosophila simulans]
 ref|XP_002077379.1| GD12699 [Drosophila simulans]
 ref|XP_002077391.1| GD13036 [Drosophila simulans]
 ref|XP_002077396.1| GD19005 [Drosophila simulans]
 ref|XP_002077467.1| GD17998 [Drosophila simulans]
 ref|XP_002077482.1| GD14456 [Drosophila simulans]
 ref|XP_002077497.1| GD13666 [Drosophila simulans]
 ref|XP_002077505.1| GD14852 [Drosophila simulans]
 ref|XP_002077522.1| GD15113 [Drosophila simulans]
 ref|XP_002077545.1| GD15434 [Drosophila simulans]
 ref|XP_002077567.1| GD15753 [Drosophila simulans]
 ref|XP_002112565.1| conserved hypothetical protein [Trichoplax adhaerens]
 ref|XP_002128382.1| PREDICTED: histone H3 [Ciona intestinalis]
 ref|XP_002129014.1| PREDICTED: histone H3 [Ciona intestinalis]
 ref|XP_002194141.1| PREDICTED: histone H3.2-like [Taeniopygia guttata]
 ref|XP_002193332.1| PREDICTED: histone H3.2-like [Taeniopygia guttata]
 ref|XP_002430909.1| histone H3 [Pediculus humanus corporis]
 ref|XP_002430918.1| histone H3 [Pediculus humanus corporis]
 ref|XP_002586356.1| hypothetical protein BRAFLDRAFT_62634 [Branchiostoma floridae]
 ref|XP_002586365.1| hypothetical protein BRAFLDRAFT_62637 [Branchiostoma floridae]
 ref|XP_002595648.1| hypothetical protein BRAFLDRAFT_64784 [Branchiostoma floridae]
 ref|XP_002595666.1| hypothetical protein BRAFLDRAFT_64800 [Branchiostoma floridae]
 ref|XP_002595678.1| hypothetical protein BRAFLDRAFT_64812 [Branchiostoma floridae]
 ref|XP_002595709.1| hypothetical protein BRAFLDRAFT_56969 [Branchiostoma floridae]
 ref|XP_002595710.1| hypothetical protein BRAFLDRAFT_56970 [Branchiostoma floridae]
 ref|XP_002595719.1| hypothetical protein BRAFLDRAFT_56975 [Branchiostoma floridae]
 ref|XP_002595735.1| hypothetical protein BRAFLDRAFT_64865 [Branchiostoma floridae]
 ref|XP_002731238.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002732482.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002732963.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002733415.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002736572.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002737855.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002738083.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002738089.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002738203.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002740695.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002741072.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002741741.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002741826.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002666951.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_002941390.1| PREDICTED: histone H3.2-like isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_002942339.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002943524.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944659.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944964.1| PREDICTED: histone H3.2-like isoform 2 [Xenopus (Silurana) tropicalis]
 ref|XP_002944966.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002945363.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_003221089.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_003224524.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_003227268.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_001952101.2| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_003248421.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_003251619.1| PREDICTED: histone H3-like isoform 1 [Apis mellifera]
 ref|XP_003259200.1| PREDICTED: histone H3.2-like [Nomascus leucogenys]
 ref|XP_003355255.1| PREDICTED: histone H3.2-like [Sus scrofa]
 ref|XP_003391250.1| PREDICTED: histone H3 [Amphimedon queenslandica]
 ref|XP_003392965.1| PREDICTED: histone H3-like [Bombus terrestris]
 ref|XP_003392969.1| PREDICTED: histone H3-like [Bombus terrestris]
 ref|XP_003409561.1| PREDICTED: histone H3 [Loxodonta africana]
 ref|XP_003409565.1| PREDICTED: histone H3 [Loxodonta africana]
 ref|XP_001508660.2| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_003424487.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599179.2| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_003425535.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_540285.2| PREDICTED: histone H3.2-like [Canis lupus familiaris]
 ref|XP_540290.2| PREDICTED: histone H3.2-like [Canis lupus familiaris]
 ref|XP_003451202.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003451214.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003457066.1| PREDICTED: histone H3.2-like isoform X1 [Oreochromis niloticus]
 ref|XP_003459141.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003459144.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003459573.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003460246.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003460381.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003463260.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_003468833.1| PREDICTED: histone H3.2-like isoform X1 [Cavia porcellus]
 ref|XP_003478903.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_003489849.1| PREDICTED: histone H3-like [Bombus impatiens]
 ref|XP_003489853.1| PREDICTED: histone H3-like [Bombus impatiens]
 ref|XP_003492166.1| PREDICTED: histone H3-like [Bombus impatiens]
 ref|XP_003502222.1| PREDICTED: histone H3 [Cricetulus griseus]
 ref|XP_003697960.1| PREDICTED: histone H3-like [Apis florea]
 ref|XP_003697994.1| PREDICTED: histone H3-like [Apis florea]
 ref|XP_003697995.1| PREDICTED: histone H3-like isoform 1 [Apis florea]
 ref|XP_003697996.1| PREDICTED: histone H3-like isoform 2 [Apis florea]
 ref|XP_003703729.1| PREDICTED: histone H3-like [Megachile rotundata]
 ref|XP_003703731.1| PREDICTED: histone H3-like [Megachile rotundata]
 ref|XP_003707914.1| PREDICTED: histone H3-like [Megachile rotundata]
 ref|XP_003768756.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
 ref|XP_002834873.2| PREDICTED: histone H3 [Pongo abelii]
 ref|XP_003800470.1| PREDICTED: histone H3.2-like [Otolemur garnettii]
 ref|XP_003803809.1| PREDICTED: histone H3.2-like [Otolemur garnettii]
 ref|XP_003803812.1| PREDICTED: histone H3.2-like [Otolemur garnettii]
 ref|XP_003808846.1| PREDICTED: histone H3 [Pan paniscus]
 ref|XP_003942033.1| PREDICTED: histone H3 [Saimiri boliviensis boliviensis]
 ref|XP_003967841.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003967881.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003972552.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003976988.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979103.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979222.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979633.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979798.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979802.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_004002478.1| PREDICTED: histone H3.2-like [Ovis aries]
 ref|XP_004026580.1| PREDICTED: histone H3.2-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004026581.1| PREDICTED: histone H3.2-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004026585.1| PREDICTED: histone H3.2-like [Gorilla gorilla gorilla]
 ref|XP_004026595.1| PREDICTED: histone H3.2-like [Gorilla gorilla gorilla]
 ref|XP_004076082.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_004175929.1| PREDICTED: histone H3.2-like [Taeniopygia guttata]
 ref|XP_004285166.1| PREDICTED: histone H3.2-like [Orcinus orca]
 ref|XP_004285171.1| PREDICTED: histone H3.2-like [Orcinus orca]
 ref|XP_004389662.1| PREDICTED: histone H3.2-like [Trichechus manatus latirostris]
 ref|XP_004404232.1| PREDICTED: histone H3.2-like [Odobenus rosmarus divergens]
 ref|XP_004461694.1| PREDICTED: histone H3.2-like [Dasypus novemcinctus]
 ref|XP_004461699.1| PREDICTED: histone H3.2-like [Dasypus novemcinctus]
 ref|XP_004556917.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004556983.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004564943.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004576159.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004588885.1| PREDICTED: histone H3.2-like [Ochotona princeps]
 ref|XP_004588887.1| PREDICTED: histone H3.2-like [Ochotona princeps]
 ref|XP_004588890.1| PREDICTED: histone H3.2-like [Ochotona princeps]
 ref|XP_004670879.1| PREDICTED: histone H3.2-like [Jaculus jaculus]
 ref|XP_004670895.1| PREDICTED: histone H3.2-like [Jaculus jaculus]
 ref|XP_004628473.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004628479.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004632476.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004640161.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004640166.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004640178.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004716622.1| PREDICTED: histone H3.2-like [Echinops telfairi]
 ref|XP_004782631.1| PREDICTED: histone H3.2-like [Mustela putorius furo]
 ref|XP_004821252.1| PREDICTED: histone H3.2-like [Mustela putorius furo]
 ref|XP_002943900.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913874.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913911.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913918.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913923.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913929.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004915673.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004917039.1| PREDICTED: histone H3.2-like isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_002945479.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919085.1| PREDICTED: histone H3.2-like isoform X2 [Xenopus (Silurana) tropicalis]
 ref|XP_004919101.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002945274.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919124.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919171.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919181.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919334.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944235.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004934098.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934117.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934133.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934172.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934194.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004847622.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004847875.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004853987.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004853991.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004937729.1| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_005003349.1| PREDICTED: histone H3.2-like isoform X2 [Cavia porcellus]
 ref|XP_005007814.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_005007816.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_005012214.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012216.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012224.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012227.1| PREDICTED: histone H3.2-like isoform X1 [Anas platyrhynchos]
 ref|XP_005012228.1| PREDICTED: histone H3.2-like isoform X2 [Anas platyrhynchos]
 ref|XP_005012229.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012232.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005110442.1| PREDICTED: histone H3-like [Aplysia californica]
 ref|XP_005066529.1| PREDICTED: histone H3.2-like [Mesocricetus auratus]
 ref|XP_005039661.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039662.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039665.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039667.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039673.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005062980.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005150321.1| PREDICTED: histone H3.2-like [Melopsittacus undulatus]
 ref|XP_005150329.1| PREDICTED: histone H3.2-like isoform X1 [Melopsittacus undulatus]
 ref|XP_005150330.1| PREDICTED: histone H3.2-like isoform X2 [Melopsittacus undulatus]
 ref|XP_005150332.1| PREDICTED: histone H3.2-like [Melopsittacus undulatus]
 ref|XP_002666952.2| PREDICTED: histone H3 [Danio rerio]
 ref|XP_005308989.1| PREDICTED: histone H3 [Chrysemys picta bellii]
 ref|XP_005355003.1| PREDICTED: histone H3.2-like [Microtus ochrogaster]
 ref|XP_005355005.1| PREDICTED: histone H3.2-like [Microtus ochrogaster]
 ref|XP_005331191.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
 ref|XP_005331196.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
 ref|XP_005337112.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
 ref|XP_005399005.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005403357.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005403365.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005403367.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005441372.1| PREDICTED: histone H3.2-like [Falco cherrug]
 ref|XP_005480799.1| PREDICTED: histone H3.2-like [Zonotrichia albicollis]
 ref|XP_005455907.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005459205.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005462224.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005463512.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005519546.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
 ref|XP_005519547.1| PREDICTED: histone H3.2-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005519549.1| PREDICTED: histone H3.2-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005519556.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005519557.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005527767.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005527780.1| PREDICTED: histone H3.2-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005527783.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005505469.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515111.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515112.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515115.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515124.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515125.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005542115.1| PREDICTED: histone H3.2-like [Macaca fascicularis]
 ref|XP_005630793.1| PREDICTED: histone H3.2-like [Canis lupus familiaris]
 ref|XP_005663570.1| PREDICTED: histone H3.2-like isoform X1 [Sus scrofa]
 ref|XP_005663571.1| PREDICTED: histone H3.2-like isoform X2 [Sus scrofa]
 ref|XP_005734222.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005750283.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005751312.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005755872.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005811245.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005815223.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005817667.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005817698.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005937149.1| PREDICTED: histone H3.2-like [Haplochromis burtoni]
 ref|XP_005949985.1| PREDICTED: histone H3.2-like [Haplochromis burtoni]
 ref|XP_005959640.1| PREDICTED: histone H3.2-like [Pantholops hodgsonii]
 ref|XP_006014939.1| PREDICTED: histone H3.2-like [Alligator sinensis]
 ref|XP_006014941.1| PREDICTED: histone H3.2-like [Alligator sinensis]
 ref|XP_006024238.1| PREDICTED: histone H3.2-like isoform X2 [Alligator sinensis]
 ref|XP_006095231.1| PREDICTED: histone H3.2-like [Myotis lucifugus]
 ref|XP_006125953.1| PREDICTED: histone H3.2-like [Pelodiscus sinensis]
 ref|XP_006125959.1| PREDICTED: histone H3.2-like isoform X2 [Pelodiscus sinensis]
 ref|XP_006125973.1| PREDICTED: histone H3.2-like [Pelodiscus sinensis]
 ref|XP_006128691.1| PREDICTED: histone H3.2-like [Pelodiscus sinensis]
 ref|XP_006186635.1| PREDICTED: histone H3.2-like [Camelus ferus]
 ref|XP_006195501.1| PREDICTED: histone H3.2-like [Camelus ferus]
 ref|XP_006216974.1| PREDICTED: histone H3.2-like [Vicugna pacos]
 ref|XP_006219813.1| PREDICTED: histone H3.2-like [Vicugna pacos]
 ref|XP_006268900.1| PREDICTED: histone H3.2-like [Alligator mississippiensis]
 ref|XP_006269558.1| PREDICTED: histone H3.2-like [Alligator mississippiensis]
 ref|XP_006222468.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_006254052.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_006570899.1| PREDICTED: histone H3-like [Apis mellifera]
 ref|XP_006618073.1| PREDICTED: histone H3-like [Apis dorsata]
 ref|XP_006621110.1| PREDICTED: histone H3-like [Apis dorsata]
 ref|XP_006621124.1| PREDICTED: histone H3-like [Apis dorsata]
 ref|XP_006665102.1| PREDICTED: histone H3-like [Oryza brachyantha]
 ref|XP_006781035.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006781085.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006781097.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006808339.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006750234.1| PREDICTED: histone H3.2-like [Leptonychotes weddellii]
 ref|XP_006750238.1| PREDICTED: histone H3.2-like [Leptonychotes weddellii]
 ref|XP_006820299.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_006902296.1| PREDICTED: histone H3.2-like [Elephantulus edwardii]
 ref|XP_006902299.1| PREDICTED: histone H3.2-like [Elephantulus edwardii]
 ref|XP_006861408.1| PREDICTED: histone H3.2-like isoform X1 [Chrysochloris asiatica]
 ref|XP_006861409.1| PREDICTED: histone H3.2-like isoform X2 [Chrysochloris asiatica]
 ref|XP_006982638.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_006993207.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_006993210.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_006993226.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_007070175.1| PREDICTED: histone H3.2-like [Chelonia mydas]
 ref|XP_007064098.1| PREDICTED: histone H3.2-like isoform X1 [Chelonia mydas]
 ref|XP_007064099.1| PREDICTED: histone H3.2-like isoform X2 [Chelonia mydas]
 ref|XP_006049258.1| PREDICTED: histone H3.2-like [Bubalus bubalis]
 ref|XP_006049260.1| PREDICTED: histone H3.2-like [Bubalus bubalis]
 ref|XP_007178006.1| PREDICTED: histone H3.2-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007423264.1| PREDICTED: histone H3.2-like isoform X1 [Python bivittatus]
 ref|XP_007423265.1| PREDICTED: histone H3.2-like isoform X2 [Python bivittatus]
 ref|XP_007427782.1| PREDICTED: histone H3.2-like [Python bivittatus]
 ref|XP_007445389.1| PREDICTED: histone H3.2-like [Python bivittatus]
 ref|XP_007483142.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
 ref|XP_007555955.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007561740.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007561744.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007574072.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007575250.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007541924.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007531637.1| PREDICTED: histone H3 [Erinaceus europaeus]
 ref|XP_007534740.1| PREDICTED: histone H3 [Erinaceus europaeus]
 ref|XP_007640990.1| PREDICTED: histone H3 [Cricetulus griseus]
 ref|XP_007634641.1| PREDICTED: histone H3 [Cricetulus griseus]
 ref|XP_007634657.1| PREDICTED: histone H3 isoform X2 [Cricetulus griseus]
 ref|XP_007883034.1| PREDICTED: histone H3 [Callorhinchus milii]
 ref|XP_007949167.1| PREDICTED: histone H3 [Orycteropus afer afer]
 ref|XP_007949170.1| PREDICTED: histone H3 [Orycteropus afer afer]
 ref|XP_008018003.1| PREDICTED: histone H3 [Chlorocebus sabaeus]
 ref|XP_008115366.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_008190047.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_008190048.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_008172411.1| PREDICTED: histone H3 [Chrysemys picta bellii]
 ref|XP_008262731.1| PREDICTED: LOW QUALITY PROTEIN: histone H3-like [Oryctolagus 
cuniculus]
 ref|XP_008278491.1| PREDICTED: histone H3 [Stegastes partitus]
 ref|XP_008292395.1| PREDICTED: histone H3 [Stegastes partitus]
 ref|XP_008294073.1| PREDICTED: histone H3 [Stegastes partitus]
 ref|XP_008308957.1| PREDICTED: histone H3 [Cynoglossus semilaevis]
 ref|XP_008412290.1| PREDICTED: histone H3 [Poecilia reticulata]
 ref|XP_008419898.1| PREDICTED: histone H3 [Poecilia reticulata]
 ref|XP_008477668.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008479071.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008482959.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008482965.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008482968.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008484708.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008495139.1| PREDICTED: histone H3 [Calypte anna]
 ref|XP_008491721.1| PREDICTED: histone H3 [Calypte anna]
 ref|XP_008560152.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008560312.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008560345.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008545619.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008545947.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008548645.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008550905.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008552420.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008556698.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008557900.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008557955.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008583791.1| PREDICTED: histone H3 [Galeopterus variegatus]
 ref|XP_008634730.1| PREDICTED: histone H3 [Corvus brachyrhynchos]
 ref|XP_008634732.1| PREDICTED: histone H3 isoform X2 [Corvus brachyrhynchos]
 ref|XP_008693968.1| PREDICTED: histone H3 [Ursus maritimus]
 ref|XP_008772193.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_008759568.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_008769899.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_008824858.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008830081.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008830090.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008830109.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008841937.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008958392.1| PREDICTED: histone H3 [Pan paniscus]
 ref|XP_008982500.1| PREDICTED: histone H3 [Callithrix jacchus]
 ref|XP_009017733.1| hypothetical protein HELRODRAFT_79198 [Helobdella robusta]
 ref|XP_009018939.1| hypothetical protein HELRODRAFT_92562 [Helobdella robusta]
 ref|XP_009021573.1| hypothetical protein HELRODRAFT_92640 [Helobdella robusta]
 ref|XP_009022419.1| hypothetical protein HELRODRAFT_92700 [Helobdella robusta]
 ref|XP_009052125.1| hypothetical protein LOTGIDRAFT_147117 [Lottia gigantea]
 ref|XP_009054644.1| hypothetical protein LOTGIDRAFT_176709 [Lottia gigantea]
 ref|XP_009056376.1| hypothetical protein LOTGIDRAFT_145440 [Lottia gigantea]
 ref|XP_009059094.1| hypothetical protein LOTGIDRAFT_147816 [Lottia gigantea]
 ref|XP_009059299.1| hypothetical protein LOTGIDRAFT_147849 [Lottia gigantea]
 ref|XP_009065730.1| hypothetical protein LOTGIDRAFT_146472 [Lottia gigantea]
 ref|XP_009067270.1| hypothetical protein LOTGIDRAFT_148546 [Lottia gigantea]
 ref|XP_009084837.1| PREDICTED: histone H3 [Serinus canaria]
 ref|XP_009084840.1| PREDICTED: histone H3 [Serinus canaria]
 ref|XP_009084853.1| PREDICTED: histone H3 [Serinus canaria]
 ref|XP_009197942.1| PREDICTED: histone H3 [Papio anubis]
 ref|XP_009288329.1| PREDICTED: histone H3 [Aptenodytes forsteri]
 ref|XP_009288342.1| PREDICTED: histone H3 [Aptenodytes forsteri]
 ref|XP_009243259.1| PREDICTED: histone H3 [Pongo abelii]
 ref|XP_009296460.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_009296462.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_009428350.1| PREDICTED: histone H3 [Pan troglodytes]
 ref|XP_009428464.1| PREDICTED: histone H3 [Pan troglodytes]
 ref|XP_009675852.1| PREDICTED: histone H3 [Struthio camelus australis]
 ref|XP_009638415.1| PREDICTED: histone H3 [Egretta garzetta]
 ref|XP_009896818.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_009896826.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_009896827.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_009896828.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_010186631.1| PREDICTED: histone H3 [Mesitornis unicolor]
 ref|XP_010211924.1| PREDICTED: histone H3 [Tinamus guttatus]
 ref|XP_010211925.1| PREDICTED: histone H3 [Tinamus guttatus]
 ref|XP_010216917.1| PREDICTED: histone H3 [Tinamus guttatus]
 ref|XP_010223167.1| PREDICTED: histone H3 isoform X1 [Tinamus guttatus]
 ref|XP_010223168.1| PREDICTED: histone H3 isoform X2 [Tinamus guttatus]
 ref|XP_010371591.1| PREDICTED: histone H3 [Rhinopithecus roxellana]
 ref|XP_010374671.1| PREDICTED: histone H3 [Rhinopithecus roxellana]
 ref|XP_010353240.1| PREDICTED: histone H3 [Rhinopithecus roxellana]
 ref|XP_010409007.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010409008.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010409015.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010409018.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010567513.1| PREDICTED: histone H3 [Haliaeetus leucocephalus]
 ref|XP_010567521.1| PREDICTED: histone H3 [Haliaeetus leucocephalus]
 ref|XP_010567525.1| PREDICTED: histone H3 [Haliaeetus leucocephalus]
 ref|XP_010621019.1| PREDICTED: histone H3 [Fukomys damarensis]
 ref|XP_010621295.1| PREDICTED: histone H3 [Fukomys damarensis]
 ref|XP_010634567.1| PREDICTED: histone H3 isoform X1 [Fukomys damarensis]
 ref|XP_010725973.1| PREDICTED: histone H3 [Meleagris gallopavo]
 ref|XP_010746616.1| PREDICTED: histone H3 [Larimichthys crocea]
 ref|XP_010754598.1| PREDICTED: histone H3 [Larimichthys crocea]
 ref|XP_010754652.1| PREDICTED: histone H3 [Larimichthys crocea]
 ref|XP_010825132.1| PREDICTED: histone H3 [Bos taurus]
 ref|XP_010837041.1| PREDICTED: histone H3 [Bison bison bison]
 ref|XP_010837046.1| PREDICTED: histone H3 [Bison bison bison]
 ref|XP_010956830.1| PREDICTED: histone H3 [Camelus bactrianus]
 ref|XP_011057615.1| PREDICTED: histone H3 [Acromyrmex echinatior]
 ref|XP_011062466.1| PREDICTED: histone H3 [Acromyrmex echinatior]
 ref|XP_011151028.1| PREDICTED: histone H3 [Harpegnathos saltator]
 ref|XP_011166327.1| PREDICTED: histone H3 [Solenopsis invicta]
 ref|XP_011165753.1| PREDICTED: histone H3 [Solenopsis invicta]
 ref|XP_011216220.1| PREDICTED: histone H3 [Ailuropoda melanoleuca]
 ref|XP_011268848.1| PREDICTED: histone H3 [Camponotus floridanus]
 ref|XP_011264340.1| PREDICTED: histone H3 [Camponotus floridanus]
 ref|XP_011265838.1| PREDICTED: histone H3 [Camponotus floridanus]
 ref|XP_011311110.1| PREDICTED: histone H3 [Fopius arisanus]
 ref|XP_011312022.1| PREDICTED: histone H3 [Fopius arisanus]
 ref|XP_011313108.1| PREDICTED: histone H3 [Fopius arisanus]
 ref|XP_011350491.1| PREDICTED: histone H3 [Cerapachys biroi]
 ref|XP_011416643.1| PREDICTED: histone H3 [Crassostrea gigas]
 ref|XP_011416652.1| PREDICTED: histone H3 [Crassostrea gigas]
 ref|XP_011478933.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011473870.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011479935.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011472070.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011491737.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011495696.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011496729.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011497548.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011501815.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011501822.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 sp|P02299.4|H3_DROME RecName: Full=Histone H3 [Drosophila melanogaster]
 sp|P84230.2|H32_CAIMO RecName: Full=Histone H3.2 [Cairina moschata]
 sp|P84234.2|H32_ONCMY RecName: Full=Histone H3.2 [Oncorhynchus mykiss]
 sp|P84235.2|H3_PLADU RecName: Full=Histone H3 [Platynereis dumerilii]
 sp|P84236.2|H3_DROHY RecName: Full=Histone H3 [Drosophila hydei]
 sp|P84237.2|H3_TIGCA RecName: Full=Histone H3 [Tigriopus californicus]
 sp|P84238.2|H3_CHITH RecName: Full=Histone H3; Short=H3 [Chironomus thummi thummi]
 sp|P84239.2|H3_URECA RecName: Full=Histone H3 [Urechis caupo]
 sp|P84228.2|H32_MOUSE RecName: Full=Histone H3.2 [Mus musculus]
 sp|P84229.2|H32_CHICK RecName: Full=Histone H3.2; AltName: Full=Histone H3 class I 
[Gallus gallus]
 sp|P84233.2|H32_XENLA RecName: Full=Histone H3.2 [Xenopus laevis]
 sp|Q71DI3.3|H32_HUMAN RecName: Full=Histone H3.2; AltName: Full=Histone H3/m; AltName: 
Full=Histone H3/o [Homo sapiens]
 sp|Q6LBE8.3|H32_MUSPA RecName: Full=Histone H3.2 [Mus pahari]
 sp|Q4QRF4.3|H32_DANRE RecName: Full=Histone H3.2 [Danio rerio]
 sp|Q28D37.3|H32_XENTR RecName: Full=Histone H3.2 [Xenopus (Silurana) tropicalis]
 sp|P84227.2|H32_BOVIN RecName: Full=Histone H3.2 [Bos taurus]
 sp|P84231.2|H32_ICTBU RecName: Full=Histone H3.2 [Ictiobus bubalus]
 sp|P84232.2|H32_PORAF RecName: Full=Histone H3.2 [Poroderma africanum]
 pir||S09655 histone H3 - fruit fly (Drosophila hydei)
 pir||A56618 histone H3 - spoonworm (Urechis caupo)
 pir||A56654 histone H3 - Tigriopus californicus
 pir||A56580 histone H3 - midge (Chironomus thummi thummi)
 pir||I49397 histone H3.2 protein - shrew mouse
 pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein
 pdb|1EQZ|C Chain C, X-Ray Structure Of The Nucleosome Core Particle At 2.5 
A Resolution
 pdb|1EQZ|G Chain G, X-Ray Structure Of The Nucleosome Core Particle At 2.5 
A Resolution
 pdb|1HQ3|C Chain C, Crystal Structure Of The Histone-Core-Octamer In KclPHOSPHATE
 pdb|1HQ3|G Chain G, Crystal Structure Of The Histone-Core-Octamer In KclPHOSPHATE
 pdb|1TZY|C Chain C, Crystal Structure Of The Core-Histone Octamer To 1.90 
Angstrom Resolution
 pdb|1TZY|G Chain G, Crystal Structure Of The Core-Histone Octamer To 1.90 
Angstrom Resolution
 pdb|2ARO|C Chain C, Crystal Structure Of The Native Histone Octamer To 2.1 
Angstrom Resolution, Crystalised In The Presence Of S-nitrosoglutathione
 pdb|2ARO|G Chain G, Crystal Structure Of The Native Histone Octamer To 2.1 
Angstrom Resolution, Crystalised In The Presence Of S-nitrosoglutathione
 pdb|2F8N|A Chain A, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes
 pdb|2F8N|E Chain E, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes
 pdb|4LD9|A Chain A, Crystal Structure Of The N-terminally Acetylated Bah 
Domain Of Sir3 Bound To The Nucleosome Core Particle
 pdb|4LD9|E Chain E, Crystal Structure Of The N-terminally Acetylated Bah 
Domain Of Sir3 Bound To The Nucleosome Core Particle
 pdb|4KGC|A Chain A, Nucleosome Core Particle Containing (eta6-p-cymene)-(1, 
2- Ethylenediamine)-ruthenium
 pdb|4KGC|E Chain E, Nucleosome Core Particle Containing (eta6-p-cymene)-(1, 
2- Ethylenediamine)-ruthenium
 pdb|4UUZ|A Chain A, Mcm2-histone Complex
 gb|AAK58062.1|AF378198_2 histone H3 [Rhynchosciara americana]
 emb|CAA39771.1| histone H3 [Chironomus thummi]
 emb|CAA36805.1| histone H3 [Drosophila hydei]
 emb|CAA34919.1| unnamed protein product [Drosophila hydei]
 emb|CAA37417.1| unnamed protein product [Platynereis dumerilii]
 emb|CAA36638.1| histone H3 [Tigriopus californicus]
 emb|CAA41696.1| H3 histone [Urechis caupo]
 emb|CAA25840.1| unnamed protein product [Mus musculus]
 emb|CAA32855.1| unnamed protein product [Cairina moschata]
 emb|CAA32856.1| unnamed protein product [Cairina moschata]
 emb|CAA26138.1| unnamed protein product [Gallus gallus]
 emb|CAA44180.1| histone H3-IV [Gallus gallus]
 emb|CAA44181.1| histone H3-V [Gallus gallus]
 emb|CAA25529.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CAA26813.1| unnamed protein product [Xenopus laevis]
 emb|CAA26818.1| unnamed protein product [Xenopus laevis]
 emb|CAA26890.1| unnamed protein product [Xenopus laevis]
 gb|AAC41552.1| histone H3 [Tigriopus californicus]
 gb|AAA48796.1| histone H3 [Gallus gallus]
 gb|AAA49765.1| histone H3 [Xenopus laevis]
 emb|CAA51324.1| histone H3 [Chironomus thummi]
 gb|AAA37764.1| histone H3.2 [Mus musculus domesticus]
 gb|AAA37810.1| histone H3 [Mus musculus]
 gb|AAA37812.1| histone H3 [Mus musculus]
 gb|AAA49770.1| histone H3 [Xenopus laevis]
 emb|CAA56577.1| histone H3 protein [Mus musculus]
 emb|CAA56573.1| histone H3.2 protein [Mus pahari]
 gb|AAB04760.1| histone H3.2-F [Mus musculus]
 gb|AAB04764.1| histone H3.2-B [Mus musculus]
 gb|AAB04771.1| histone H3.2-615 [Mus musculus]
 gb|AAB04772.1| histone H3.2-616 [Mus musculus]
 gb|AAC60003.1| histone H3-VI [Gallus gallus]
 gb|AAC60004.1| histone H3-VII [Gallus gallus]
 gb|AAC60005.1| histone H3-VIII [Gallus gallus]
 gb|AAC15916.1| histone H3 [Chaetopterus variopedatus]
 dbj|BAA93621.1| histone H3 [Drosophila melanogaster]
 dbj|BAA93622.1| histone H3 [Drosophila simulans]
 dbj|BAA93623.1| histone H3 [Drosophila sechellia]
 dbj|BAA93624.1| histone H3 [Drosophila mauritiana]
 dbj|BAA93625.1| histone H3 [Drosophila teissieri]
 dbj|BAA93626.1| histone H3 [Drosophila yakuba]
 dbj|BAA93628.1| histone H3 [Drosophila orena]
 dbj|BAB26714.1| unnamed protein product [Mus musculus]
 dbj|BAB32097.1| unnamed protein product [Mus musculus]
 gb|AAH15270.1| Histone cluster 2, H3c2 [Mus musculus]
 gb|AAL54861.1| histone H3 [Aplysia californica]
 gb|AAN11127.1| histone H3 [Drosophila melanogaster]
 emb|CAD37818.1| histone H3 [Mytilus edulis]
 emb|CAD37822.1| histone H3 [Mytilus edulis]
 emb|CAD37824.1| histone H3 [Mytilus edulis]
 gb|AAN39283.1| histone H3 [Homo sapiens]
 gb|AAO06251.1| histone protein Hist2h2bb [Mus musculus]
 gb|AAO06257.1| histone protein Hist1h3f [Mus musculus]
 gb|AAO06258.1| histone protein Hist1h3e [Mus musculus]
 gb|AAO06259.1| histone protein Hist1h3d [Mus musculus]
 gb|AAO06260.1| histone protein Hist1h3c [Mus musculus]
 gb|AAO06261.1| histone protein Hist1h3b [Mus musculus]
 gb|AAO06265.1| histone protein Hist2h3b [Mus musculus]
 gb|AAP94646.1| histone H3 [Mytilus galloprovincialis]
 gb|AAP94666.1| histone H3 [Mytilus trossulus]
 gb|AAP94667.1| histone H3 [Mytilus galloprovincialis]
 gb|AAP94668.1| histone H3 [Mytilus edulis]
 dbj|BAD02415.1| histone 3 [Drosophila takahashii]
 dbj|BAD02416.1| histone 3 [Drosophila ficusphila]
 dbj|BAD02417.1| histone 3 [Drosophila immigrans]
 dbj|BAD02418.1| histone 3 [Drosophila lutescens]
 dbj|BAD02419.1| histone 3 [Drosophila americana]
 emb|CAF89505.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF97259.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF98791.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF98798.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF98835.1| unnamed protein product, partial [Tetraodon nigroviridis]
 gb|AAT68254.1| histone H3/o [Homo sapiens]
 emb|CAI12559.1| histone cluster 2, H3d [Homo sapiens]
 emb|CAI12561.1| histone cluster 2, H3c [Homo sapiens]
 emb|CAI12566.1| histone cluster 2, H3a [Homo sapiens]
 gb|AAH97060.1| Zgc:113984 [Danio rerio]
 gb|AAZ66481.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66485.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66490.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66494.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66499.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66504.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66509.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66514.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66519.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66524.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66529.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66534.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66539.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66544.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66549.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66554.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66559.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66564.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66569.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66574.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66579.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66583.1| histone H3 [Drosophila melanogaster]
 gb|AAI03550.1| Histone cluster 1, H3f [Mus musculus]
 gb|AAI01956.1| Histone cluster 1, H3f [Mus musculus]
 gb|AAI01955.1| Histone cluster 1, H3f [Mus musculus]
 gb|AAI01957.1| Histone cluster 1, H3f [Mus musculus]
 emb|CAJ82338.1| histone 2, H3c [Xenopus (Silurana) tropicalis]
 emb|CAJ82528.1| histone 2, H3c [Xenopus (Silurana) tropicalis]
 gb|ABD76393.1| histone H3 [Azumapecten farreri]
 gb|ABF51317.1| histone H3 [Bombyx mori]
 gb|EAT35786.1| AAEL012072-PA [Aedes aegypti]
 gb|EAT44809.1| AAEL003852-PA [Aedes aegypti]
 gb|EAT44812.1| AAEL003850-PA [Aedes aegypti]
 gb|EAT44816.1| AAEL003856-PA [Aedes aegypti]
 gb|EAT44818.1| AAEL003828-PA [Aedes aegypti]
 gb|EAT44823.1| AAEL003836-PA [Aedes aegypti]
 gb|EAT45038.1| AAEL003659-PA [Aedes aegypti]
 gb|EAT48477.1| AAEL000492-PA [Aedes aegypti]
 gb|EAT48481.1| AAEL000482-PA [Aedes aegypti]
 gb|EAT48485.1| AAEL000506-PA [Aedes aegypti]
 gb|AAH74969.2| Histone cluster 2, H3a [Homo sapiens]
 gb|AAI20803.1| Histone cluster 1, H3c [Mus musculus]
 gb|AAI20801.1| Histone cluster 1, H3c [Mus musculus]
 gb|AAI30636.1| Histone cluster 2, H3a [Homo sapiens]
 gb|AAI30638.1| Histone cluster 2, H3a [Homo sapiens]
 gb|AAI29334.1| Zgc:158629 protein [Danio rerio]
 gb|AAI32491.1| Histone cluster 2, H3c2 [Mus musculus]
 gb|AAI32489.1| Histone cluster 2, H3c2 [Mus musculus]
 gb|AAI33777.1| LOC100049126 protein [Xenopus laevis]
 dbj|BAF56193.1| histone 3 [Drosophila americana]
 gb|EDL32538.1| mCG122935 [Mus musculus]
 gb|EDL32540.1| mCG140859 [Mus musculus]
 gb|EDL32552.1| mCG7728 [Mus musculus]
 gb|EDL32556.1| mCG7727 [Mus musculus]
 gb|EDL32559.1| mCG7741 [Mus musculus]
 gb|EDL38879.1| mCG126480 [Mus musculus]
 gb|EDL38883.1| mCG16737 [Mus musculus]
 gb|EDL85636.1| rCG51970 [Rattus norvegicus]
 gb|EDL86583.1| rCG45187 [Rattus norvegicus]
 gb|EDL86588.1| rCG45215 [Rattus norvegicus]
 gb|AAI48479.1| Histone cluster 2, H3c, partial [synthetic construct]
 gb|EDO26111.1| predicted protein [Nematostella vectensis]
 gb|EDO26531.1| predicted protein [Nematostella vectensis]
 gb|EDO26659.1| predicted protein [Nematostella vectensis]
 gb|EDO26704.1| predicted protein [Nematostella vectensis]
 gb|EDO27012.1| predicted protein [Nematostella vectensis]
 gb|EDO27631.1| predicted protein [Nematostella vectensis]
 gb|EDO27768.1| predicted protein [Nematostella vectensis]
 gb|EDO30784.1| predicted protein [Nematostella vectensis]
 gb|EDO30785.1| predicted protein [Nematostella vectensis]
 gb|EDO36702.1| predicted protein [Nematostella vectensis]
 gb|EDO36704.1| predicted protein [Nematostella vectensis]
 gb|EDO40547.1| predicted protein [Nematostella vectensis]
 gb|EDO41230.1| predicted protein [Nematostella vectensis]
 gb|EDO46398.1| predicted protein [Nematostella vectensis]
 gb|EDO46464.1| predicted protein [Nematostella vectensis]
 gb|EDO47313.1| predicted protein [Nematostella vectensis]
 gb|EDO48282.1| predicted protein [Nematostella vectensis]
 gb|EDO48305.1| predicted protein [Nematostella vectensis]
 gb|EDO48404.1| predicted protein [Nematostella vectensis]
 gb|EDO48406.1| predicted protein [Nematostella vectensis]
 gb|AAI52074.1| Zgc:158629 protein [Danio rerio]
 gb|EAA13673.3| AGAP003910-PA [Anopheles gambiae str. PEST]
 gb|EAA10498.3| AGAP005024-PA [Anopheles gambiae str. PEST]
 gb|EAA03406.3| AGAP012572-PA [Anopheles gambiae str. PEST]
 gb|EAL42097.3| AGAP012573-PA [Anopheles gambiae str. PEST]
 gb|EAA03397.3| AGAP005025-PA [Anopheles gambiae str. PEST]
 gb|EAA03005.3| AGAP012559-PA [Anopheles gambiae str. PEST]
 gb|ABV25908.1| histone H3 [Ruditapes philippinarum]
 gb|ABV25913.1| histone H3 [Ruditapes decussatus]
 gb|ABV25918.1| histone H3 [Venerupis corrugata]
 gb|AAI53075.1| Histone cluster 2, H3c [synthetic construct]
 gb|ABW86653.1| histone H3 [Anthonomus grandis]
 gb|AAI56787.1| Histone cluster 1, H3e [synthetic construct]
 gb|AAI56108.1| Histone cluster 2, H3b, partial [synthetic construct]
 gb|AAI56966.1| Histone cluster 2, H3b [synthetic construct]
 gb|EDS26248.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37347.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37352.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS37357.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS37362.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37370.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37379.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37386.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37392.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS41247.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS41769.1| histone H3.2 [Culex quinquefasciatus]
 gb|AAI60302.1| Histone cluster 1, H3b [synthetic construct]
 gb|AAI60303.1| Histone cluster 1, H3d [synthetic construct]
 gb|EDV24675.1| conserved hypothetical protein [Trichoplax adhaerens]
 gb|EDV29956.1| GF21608 [Drosophila ananassae]
 gb|EDV32940.1| GF22293 [Drosophila ananassae]
 gb|EDV32945.1| GF22265 [Drosophila ananassae]
 gb|EDV32955.1| GF22200 [Drosophila ananassae]
 gb|EDV33672.1| GF15887 [Drosophila ananassae]
 gb|EDV44862.1| GF15922 [Drosophila ananassae]
 gb|EDV44896.1| GF21522 [Drosophila ananassae]
 gb|EDV44912.1| GF21669 [Drosophila ananassae]
 gb|EDV44935.1| GF22855 [Drosophila ananassae]
 gb|EDV44936.1| GF20380 [Drosophila ananassae]
 gb|EDV44939.1| GF20359 [Drosophila ananassae]
 gb|EDV44946.1| GF20165 [Drosophila ananassae]
 gb|EDV45005.1| GG12995 [Drosophila erecta]
 gb|EDV45006.1| GG13062 [Drosophila erecta]
 gb|EDV45059.1| GG18243 [Drosophila erecta]
 gb|EDV45064.1| GG13008 [Drosophila erecta]
 gb|EDV45065.1| GG19791 [Drosophila erecta]
 gb|EDV45077.1| GG16357 [Drosophila erecta]
 gb|EDV45082.1| GG19850 [Drosophila erecta]
 gb|EDV45088.1| GG19806 [Drosophila erecta]
 gb|EDV45095.1| GG12990 [Drosophila erecta]
 gb|EDV45121.1| GG13024 [Drosophila erecta]
 gb|EDV45126.1| GG13020 [Drosophila erecta]
 gb|EDV45136.1| GG13014 [Drosophila erecta]
 gb|EDV45188.1| GG19830 [Drosophila erecta]
 gb|EDV45294.1| GG12579 [Drosophila erecta]
 gb|EDV45299.1| GG12575 [Drosophila erecta]
 gb|EDV45309.1| GG11010 [Drosophila erecta]
 gb|EDV45314.1| GG11007 [Drosophila erecta]
 gb|EDV45319.1| GG11004 [Drosophila erecta]
 gb|EDV45324.1| GG11000 [Drosophila erecta]
 gb|EDV45329.1| GG12955 [Drosophila erecta]
 gb|EDV45336.1| GG16369 [Drosophila erecta]
 gb|EDV54386.1| GG21334 [Drosophila erecta]
 gb|EDV54388.1| GG21333 [Drosophila erecta]
 gb|EDV54393.1| GG21330 [Drosophila erecta]
 gb|EDV54398.1| GG21326 [Drosophila erecta]
 gb|EDV54403.1| GG21323 [Drosophila erecta]
 gb|EDV54408.1| GG21320 [Drosophila erecta]
 gb|EDV54413.1| GG21316 [Drosophila erecta]
 gb|EDV54418.1| GG21313 [Drosophila erecta]
 gb|EDV54423.1| GG21310 [Drosophila erecta]
 gb|EDV54428.1| GG21307 [Drosophila erecta]
 gb|EDV60036.1| GG19816 [Drosophila erecta]
 gb|EDV90267.1| GH24949 [Drosophila grimshawi]
 gb|EDV94008.1| GH23344 [Drosophila grimshawi]
 gb|EDV94014.1| GH23339 [Drosophila grimshawi]
 gb|EDV94023.1| GH23334 [Drosophila grimshawi]
 gb|EDV94026.1| GH23332 [Drosophila grimshawi]
 gb|EDV94107.1| GH25148 [Drosophila grimshawi]
 gb|EDV94112.1| GH25152 [Drosophila grimshawi]
 gb|EDV94117.1| GH25155 [Drosophila grimshawi]
 gb|EDV94122.1| GH25158 [Drosophila grimshawi]
 gb|EDV94126.1| GH25160 [Drosophila grimshawi]
 gb|EDV94130.1| GH25162 [Drosophila grimshawi]
 gb|EDV94135.1| GH25165 [Drosophila grimshawi]
 gb|EDV94140.1| GH25168 [Drosophila grimshawi]
 gb|EDV94145.1| GH25173 [Drosophila grimshawi]
 gb|EDV94150.1| GH25176 [Drosophila grimshawi]
 gb|EDV94153.1| GH25177 [Drosophila grimshawi]
 gb|EDV94157.1| GH25179 [Drosophila grimshawi]
 gb|EDV94162.1| GH25183 [Drosophila grimshawi]
 gb|EDV94166.1| GH25185 [Drosophila grimshawi]
 gb|EDV99503.1| GH23572 [Drosophila grimshawi]
 gb|EDV99506.1| GH23513 [Drosophila grimshawi]
 gb|EDW04452.1| GH23469 [Drosophila grimshawi]
 gb|EDW04513.1| GH23765 [Drosophila grimshawi]
 gb|EDW04517.1| GH23762 [Drosophila grimshawi]
 gb|EDW04674.1| GH13936 [Drosophila grimshawi]
 gb|EDW04714.1| GH25000 [Drosophila grimshawi]
 gb|EDW04770.1| GH23504 [Drosophila grimshawi]
 gb|EDW04806.1| GH23749 [Drosophila grimshawi]
 gb|EDW05040.1| GH23876 [Drosophila grimshawi]
 gb|EDW05150.1| GH10171 [Drosophila grimshawi]
 gb|EDW05154.1| GH10149 [Drosophila grimshawi]
 gb|EDW05308.1| GI21876 [Drosophila mojavensis]
 gb|EDW05415.1| GI11258 [Drosophila mojavensis]
 gb|EDW05445.1| GI12713 [Drosophila mojavensis]
 gb|EDW11643.1| GI17251 [Drosophila mojavensis]
 gb|EDW11647.1| GI17253 [Drosophila mojavensis]
 gb|EDW11651.1| GI17255 [Drosophila mojavensis]
 gb|EDW12432.1| GI24857 [Drosophila mojavensis]
 gb|EDW14234.1| GI23446 [Drosophila mojavensis]
 gb|EDW14240.1| GI23442 [Drosophila mojavensis]
 gb|EDW14244.1| GI23440 [Drosophila mojavensis]
 gb|EDW14248.1| GI23438 [Drosophila mojavensis]
 gb|EDW19823.1| GI16893 [Drosophila mojavensis]
 gb|EDW24105.1| GL23951 [Drosophila persimilis]
 gb|EDW24111.1| GL23955 [Drosophila persimilis]
 gb|EDW24116.1| GL23958 [Drosophila persimilis]
 gb|EDW24121.1| GL23961 [Drosophila persimilis]
 gb|EDW25250.1| GL19701 [Drosophila persimilis]
 gb|EDW26935.1| GL17801 [Drosophila persimilis]
 gb|EDW39515.1| GL22373 [Drosophila persimilis]
 gb|EDW43609.1| GM13626 [Drosophila sechellia]
 gb|EDW43638.1| GM17442 [Drosophila sechellia]
 gb|EDW43653.1| GM19655 [Drosophila sechellia]
 gb|EDW44132.1| GM16397 [Drosophila sechellia]
 gb|EDW44548.1| GM13139 [Drosophila sechellia]
 gb|EDW44571.1| GM23425 [Drosophila sechellia]
 gb|EDW44606.1| GM15133 [Drosophila sechellia]
 gb|EDW44932.1| GM11042 [Drosophila sechellia]
 gb|EDW44977.1| GM19648 [Drosophila sechellia]
 gb|EDW45313.1| GM16257 [Drosophila sechellia]
 gb|EDW49036.1| GM13193 [Drosophila sechellia]
 gb|EDW49041.1| GM13196 [Drosophila sechellia]
 gb|EDW49155.1| GM13582 [Drosophila sechellia]
 gb|EDW50884.1| GM19325 [Drosophila sechellia]
 gb|EDW51014.1| GM19753 [Drosophila sechellia]
 gb|EDW51094.1| GM18735 [Drosophila sechellia]
 gb|EDW51100.1| GM16232 [Drosophila sechellia]
 gb|EDW51456.1| GM11711 [Drosophila sechellia]
 gb|EDW51461.1| GM11708 [Drosophila sechellia]
 gb|EDW52632.1| GM13543 [Drosophila sechellia]
 gb|EDW52670.1| GM22103 [Drosophila sechellia]
 gb|EDW52674.1| GM21950 [Drosophila sechellia]
 gb|EDW52840.1| GM19738 [Drosophila sechellia]
 gb|EDW53645.1| GM11166 [Drosophila sechellia]
 gb|EDW53701.1| GM16108 [Drosophila sechellia]
 gb|EDW53787.1| GM19311 [Drosophila sechellia]
 gb|EDW53839.1| GM17398 [Drosophila sechellia]
 gb|EDW53862.1| GM12074 [Drosophila sechellia]
 gb|EDW53867.1| GM12385 [Drosophila sechellia]
 gb|EDW54673.1| GM13124 [Drosophila sechellia]
 gb|EDW55411.1| GM26727 [Drosophila sechellia]
 gb|EDW55418.1| GM13179 [Drosophila sechellia]
 gb|EDW55422.1| GM19314 [Drosophila sechellia]
 gb|EDW55439.1| GM19759 [Drosophila sechellia]
 gb|EDW55853.1| GM11184 [Drosophila sechellia]
 gb|EDW55858.1| GM11181 [Drosophila sechellia]
 gb|EDW55876.1| GM10805 [Drosophila sechellia]
 gb|EDW56411.1| GM18805 [Drosophila sechellia]
 gb|EDW56416.1| GM19709 [Drosophila sechellia]
 gb|EDW56419.1| GM19711 [Drosophila sechellia]
 gb|EDW56429.1| GM19719 [Drosophila sechellia]
 gb|EDW56434.1| GM19722 [Drosophila sechellia]
 gb|EDW56438.1| GM19726 [Drosophila sechellia]
 gb|EDW56443.1| GM19729 [Drosophila sechellia]
 gb|EDW56446.1| GM15453 [Drosophila sechellia]
 gb|EDW56484.1| GM11148 [Drosophila sechellia]
 gb|EDW56487.1| GM16280 [Drosophila sechellia]
 gb|EDW56511.1| GM24967 [Drosophila sechellia]
 gb|EDW56522.1| GM19343 [Drosophila sechellia]
 gb|EDW57347.1| GJ16113 [Drosophila virilis]
 gb|EDW57469.1| GJ15448 [Drosophila virilis]
 gb|EDW64420.1| GJ22585 [Drosophila virilis]
 gb|EDW64425.1| GJ22552 [Drosophila virilis]
 gb|EDW64428.1| GJ22537 [Drosophila virilis]
 gb|EDW66612.1| GJ23692 [Drosophila virilis]
 gb|EDW66616.1| GJ23694 [Drosophila virilis]
 gb|EDW66621.1| GJ23698 [Drosophila virilis]
 gb|EDW66626.1| GJ23701 [Drosophila virilis]
 gb|EDW66630.1| GJ23703 [Drosophila virilis]
 gb|EDW66637.1| GJ23707 [Drosophila virilis]
 gb|EDW66642.1| GJ23711 [Drosophila virilis]
 gb|EDW71477.1| GJ18585 [Drosophila virilis]
 gb|EDW71505.1| GJ18405 [Drosophila virilis]
 gb|EDW71523.1| GJ17075 [Drosophila virilis]
 gb|EDW71533.1| GJ18401 [Drosophila virilis]
 gb|EDW71545.1| GJ19811 [Drosophila virilis]
 gb|EDW71550.1| GJ15165 [Drosophila virilis]
 gb|EDW71553.1| GJ16344 [Drosophila virilis]
 gb|EDW71556.1| GJ16346 [Drosophila virilis]
 gb|EDW71590.1| GK19157 [Drosophila willistoni]
 gb|EDW80196.1| GK10380 [Drosophila willistoni]
 gb|EDW80201.1| GK18893 [Drosophila willistoni]
 gb|EDW86726.1| GK19237 [Drosophila willistoni]
 gb|EDW87055.1| GK21132 [Drosophila willistoni]
 gb|EDX15926.1| GD21986 [Drosophila simulans]
 gb|EDX16012.1| GD11866 [Drosophila simulans]
 gb|EDX16028.1| GD11987 [Drosophila simulans]
 gb|EDX16055.1| GD12595 [Drosophila simulans]
 gb|EDX16062.1| GD12699 [Drosophila simulans]
 gb|EDX16075.1| GD13036 [Drosophila simulans]
 gb|EDX16081.1| GD19005 [Drosophila simulans]
 gb|EDX16157.1| GD17998 [Drosophila simulans]
 gb|EDX16172.1| GD14456 [Drosophila simulans]
 gb|EDX16188.1| GD13666 [Drosophila simulans]
 gb|EDX16197.1| GD14852 [Drosophila simulans]
 gb|EDX16214.1| GD15113 [Drosophila simulans]
 gb|EDX16237.1| GD15434 [Drosophila simulans]
 gb|EDX16261.1| GD15753 [Drosophila simulans]
 dbj|BAG73252.1| Histone H3.1 [synthetic construct]
 gb|EEB18171.1| histone H3 [Pediculus humanus corporis]
 gb|EEB18180.1| histone H3 [Pediculus humanus corporis]
 gb|AAI39252.1| Hist2h3b protein [Mus musculus]
 gb|AAI39253.1| Hist2h3b protein [Mus musculus]
 gb|ACO11545.1| Histone H3 [Caligus rogercresseyi]
 gb|ACO15243.1| Histone H3 [Caligus clemensi]
 gb|EEN42367.1| hypothetical protein BRAFLDRAFT_62634 [Branchiostoma floridae]
 gb|EEN42376.1| hypothetical protein BRAFLDRAFT_62637 [Branchiostoma floridae]
 gb|EEN51660.1| hypothetical protein BRAFLDRAFT_64784 [Branchiostoma floridae]
 gb|EEN51678.1| hypothetical protein BRAFLDRAFT_64800 [Branchiostoma floridae]
 gb|EEN51690.1| hypothetical protein BRAFLDRAFT_64812 [Branchiostoma floridae]
 gb|EEN51721.1| hypothetical protein BRAFLDRAFT_56969 [Branchiostoma floridae]
 gb|EEN51722.1| hypothetical protein BRAFLDRAFT_56970 [Branchiostoma floridae]
 gb|EEN51731.1| hypothetical protein BRAFLDRAFT_56975 [Branchiostoma floridae]
 gb|EEN51747.1| hypothetical protein BRAFLDRAFT_64865 [Branchiostoma floridae]
 dbj|BAH72344.1| ACYPI007201 [Acyrthosiphon pisum]
 gb|EFA13237.1| hypothetical protein TcasGA2_TC006933 [Tribolium castaneum]
 gb|EFA13385.1| hypothetical protein TcasGA2_TC016050 [Tribolium castaneum]
 gb|EFA13540.1| hypothetical protein TcasGA2_TC005139 [Tribolium castaneum]
 gb|EFA13671.1| hypothetical protein TcasGA2_TC001497 [Tribolium castaneum]
 gb|EFB29319.1| hypothetical protein PANDA_021728 [Ailuropoda melanoleuca]
 emb|CAP53903.1| histone H3 [Xenoturbella bocki]
 tpg|DAA31651.1| TPA: histone H3.2 [Bos taurus]
 tpg|DAA31726.1| TPA: histone cluster 2, H3c2-like [Bos taurus]
 tpg|DAA31730.1| TPA: histone cluster 2, H3c2-like [Bos taurus]
 gb|EFN61843.1| Histone H3 [Camponotus floridanus]
 gb|EFN62817.1| Histone H3 [Camponotus floridanus]
 gb|EFN72896.1| Histone H3 [Camponotus floridanus]
 gb|EFN76783.1| Histone H3 [Harpegnathos saltator]
 gb|EFN76878.1| Histone H3 [Harpegnathos saltator]
 emb|CBY36196.1| unnamed protein product [Oikopleura dioica]
 emb|CBY37787.1| unnamed protein product [Oikopleura dioica]
 emb|CBY12294.1| unnamed protein product [Oikopleura dioica]
 gb|EFX62753.1| hypothetical protein DAPPUDRAFT_67712 [Daphnia pulex]
 gb|EFX71392.1| hypothetical protein DAPPUDRAFT_255862 [Daphnia pulex]
 gb|EFX86865.1| hypothetical protein DAPPUDRAFT_235594 [Daphnia pulex]
 gb|EFX86883.1| hypothetical protein DAPPUDRAFT_235620 [Daphnia pulex]
 gb|EFX86890.1| hypothetical protein DAPPUDRAFT_44125 [Daphnia pulex]
 gb|EFX86911.1| hypothetical protein DAPPUDRAFT_44149 [Daphnia pulex]
 gb|EFX86921.1| hypothetical protein DAPPUDRAFT_44114 [Daphnia pulex]
 gb|EFX86944.1| hypothetical protein DAPPUDRAFT_43874 [Daphnia pulex]
 gb|EFX86961.1| hypothetical protein DAPPUDRAFT_43597 [Daphnia pulex]
 gb|EFX86977.1| hypothetical protein DAPPUDRAFT_235802 [Daphnia pulex]
 gb|EFX87022.1| hypothetical protein DAPPUDRAFT_43441 [Daphnia pulex]
 gb|EFX87061.1| hypothetical protein DAPPUDRAFT_44115 [Daphnia pulex]
 gb|EFX87072.1| hypothetical protein DAPPUDRAFT_43440 [Daphnia pulex]
 gb|EFX87254.1| hypothetical protein DAPPUDRAFT_43467 [Daphnia pulex]
 gb|EFX87270.1| hypothetical protein DAPPUDRAFT_43863 [Daphnia pulex]
 gb|EFX87305.1| hypothetical protein DAPPUDRAFT_43402 [Daphnia pulex]
 gb|EFX87341.1| hypothetical protein DAPPUDRAFT_43405 [Daphnia pulex]
 gb|EFX87367.1| hypothetical protein DAPPUDRAFT_44153 [Daphnia pulex]
 gb|EFX87388.1| hypothetical protein DAPPUDRAFT_43482 [Daphnia pulex]
 gb|EFX87398.1| hypothetical protein DAPPUDRAFT_43862 [Daphnia pulex]
 gb|EFX87419.1| hypothetical protein DAPPUDRAFT_43602 [Daphnia pulex]
 gb|EFX87430.1| hypothetical protein DAPPUDRAFT_44116 [Daphnia pulex]
 gb|EFX87440.1| hypothetical protein DAPPUDRAFT_235586 [Daphnia pulex]
 gb|EFX88870.1| hypothetical protein DAPPUDRAFT_304645 [Daphnia pulex]
 gb|EGI63565.1| Histone H3 [Acromyrmex echinatior]
 gb|AEH58055.1| histone H3 [Mimachlamys varia]
 gb|EGV94272.1| Histone H3 [Cricetulus griseus]
 gb|EGV94275.1| Histone H3 [Cricetulus griseus]
 gb|EGV94289.1| Histone H3 [Cricetulus griseus]
 gb|EGV94292.1| Histone H3 [Cricetulus griseus]
 gb|EGV94772.1| Histone H3 [Cricetulus griseus]
 gb|EGV96117.1| Histone H3 [Cricetulus griseus]
 gb|EHB09823.1| Histone H3 [Heterocephalus glaber]
 gb|EHB11504.1| Histone H3 [Heterocephalus glaber]
 gb|EHH15154.1| hypothetical protein EGK_01209 [Macaca mulatta]
 gb|EHH25687.1| hypothetical protein EGK_21183 [Macaca mulatta]
 gb|EHH50254.1| hypothetical protein EGM_01058 [Macaca fascicularis]
 gb|EHH62657.1| hypothetical protein EGM_21076 [Macaca fascicularis]
 gb|EHJ75639.1| hypothetical protein KGM_19632 [Danaus plexippus]
 gb|EKC28014.1| Histone H3 [Crassostrea gigas]
 gb|EKC28020.1| Histone H3 [Crassostrea gigas]
 gb|EKC28025.1| Histone H3 [Crassostrea gigas]
 gb|EKC28030.1| Histone H3 [Crassostrea gigas]
 gb|EKC28035.1| Histone H3 [Crassostrea gigas]
 gb|ELK06004.1| Histone H3 [Pteropus alecto]
 gb|ELT87490.1| hypothetical protein CAPTEDRAFT_113088 [Capitella teleta]
 gb|ELT88273.1| hypothetical protein CAPTEDRAFT_183410 [Capitella teleta]
 gb|ELT91938.1| hypothetical protein CAPTEDRAFT_143680 [Capitella teleta]
 gb|ELT92790.1| hypothetical protein CAPTEDRAFT_140172 [Capitella teleta]
 gb|ELT94370.1| hypothetical protein CAPTEDRAFT_103051 [Capitella teleta]
 gb|ELT95343.1| hypothetical protein CAPTEDRAFT_139827 [Capitella teleta]
 gb|ELT97390.1| hypothetical protein CAPTEDRAFT_98969 [Capitella teleta]
 gb|ELT97809.1| hypothetical protein CAPTEDRAFT_145086 [Capitella teleta]
 gb|ELT97815.1| hypothetical protein CAPTEDRAFT_145096 [Capitella teleta]
 gb|ELU01210.1| hypothetical protein CAPTEDRAFT_177743 [Capitella teleta]
 gb|ELU01981.1| hypothetical protein CAPTEDRAFT_114963 [Capitella teleta]
 gb|ELU02042.1| hypothetical protein CAPTEDRAFT_128643 [Capitella teleta]
 gb|ELU02630.1| hypothetical protein CAPTEDRAFT_146003 [Capitella teleta]
 gb|ELU03396.1| hypothetical protein CAPTEDRAFT_96020 [Capitella teleta]
 gb|ELU04790.1| hypothetical protein CAPTEDRAFT_97620 [Capitella teleta]
 gb|ELU12646.1| hypothetical protein CAPTEDRAFT_185601 [Capitella teleta]
 gb|ELU12731.1| hypothetical protein CAPTEDRAFT_91648 [Capitella teleta]
 gb|ELU15444.1| hypothetical protein CAPTEDRAFT_4232 [Capitella teleta]
 gb|ELU15997.1| hypothetical protein CAPTEDRAFT_106383 [Capitella teleta]
 gb|EMC86815.1| Histone H3 [Columba livia]
 gb|EMC89183.1| Histone H3 [Columba livia]
 gb|EMC89190.1| Histone H3 [Columba livia]
 gb|EMC89195.1| Histone H3 [Columba livia]
 gb|EMP31830.1| Histone H3 [Chelonia mydas]
 gb|EMP31838.1| Histone H3 [Chelonia mydas]
 gb|EMP31846.1| Histone H3 [Chelonia mydas]
 gb|EMP31852.1| Histone H3 [Chelonia mydas]
 gb|EMS65048.1| Histone H3 [Triticum urartu]
 gb|EOB06755.1| Histone H3, partial [Anas platyrhynchos]
 gb|EPY72766.1| histone cluster 2, H3c2-like protein [Camelus ferus]
 gb|ERE77558.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ERE77567.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ERE78119.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ERE88447.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ESN99479.1| hypothetical protein HELRODRAFT_92700 [Helobdella robusta]
 gb|ESO00330.1| hypothetical protein HELRODRAFT_92640 [Helobdella robusta]
 gb|ESO02962.1| hypothetical protein HELRODRAFT_92562 [Helobdella robusta]
 gb|ESO04464.1| hypothetical protein HELRODRAFT_79198 [Helobdella robusta]
 gb|ESO82042.1| hypothetical protein LOTGIDRAFT_148546 [Lottia gigantea]
 gb|ESO83577.1| hypothetical protein LOTGIDRAFT_146472 [Lottia gigantea]
 gb|ESO90012.1| hypothetical protein LOTGIDRAFT_147849 [Lottia gigantea]
 gb|ESO90218.1| hypothetical protein LOTGIDRAFT_147816 [Lottia gigantea]
 gb|ESO92938.1| hypothetical protein LOTGIDRAFT_145440 [Lottia gigantea]
 gb|ESO94670.1| hypothetical protein LOTGIDRAFT_176709 [Lottia gigantea]
 gb|ESO97192.1| hypothetical protein LOTGIDRAFT_147117 [Lottia gigantea]
 gb|ETE61490.1| hypothetical protein L345_12748, partial [Ophiophagus hannah]
 gb|ETN62627.1| histone H3 [Anopheles darlingi]
 gb|ETN66359.1| histone H3 [Anopheles darlingi]
 gb|EYB97094.1| hypothetical protein Y032_0143g2383 [Ancylostoma ceylanicum]
 gb|EYB97107.1| hypothetical protein Y032_0143g2395 [Ancylostoma ceylanicum]
 gb|EYC33917.1| hypothetical protein Y032_0001g163 [Ancylostoma ceylanicum]
 gb|EYC41370.1| hypothetical protein Y032_0571g115 [Ancylostoma ceylanicum]
 gb|EYC41378.1| hypothetical protein Y032_0571g123 [Ancylostoma ceylanicum]
 gb|EYC41386.1| hypothetical protein Y032_0571g131 [Ancylostoma ceylanicum]
 gb|AHN53414.1| histone H3C [Nuttalliella namaqua]
 gb|EZA45107.1| histone H3-like protein-1 [Microplitis demolitor]
 gb|EZA45746.1| histone H3-like protein-3 [Microplitis demolitor]
 gb|EZA46993.1| Histone H3 [Cerapachys biroi]
 gb|EZA48677.1| Histone H3 [Cerapachys biroi]
 gb|KDR07175.1| Histone H3 [Zootermopsis nevadensis]
 gb|AIC53007.1| HIST2H3C, partial [synthetic construct]
 gb|AII16468.1| histone H3c, partial [Paracyclopina nana]
 gb|KFM02243.1| Histone H3 [Aptenodytes forsteri]
 gb|KFM02261.1| Histone H3 [Aptenodytes forsteri]
 gb|KFO28174.1| Histone H3 [Fukomys damarensis]
 gb|KFO33710.1| Histone H3 [Fukomys damarensis]
 gb|KFO61364.1| Histone H3 [Corvus brachyrhynchos]
 gb|KFO61377.1| Histone H3 [Corvus brachyrhynchos]
 gb|KFO96022.1| Histone H3 [Calypte anna]
 gb|KFP00617.1| Histone H3 [Calypte anna]
 gb|KFP17070.1| Histone H3 [Egretta garzetta]
 gb|KFQ38516.1| Histone H3 [Mesitornis unicolor]
 gb|KFQ38517.1| Histone H3 [Mesitornis unicolor]
 gb|KFQ39994.1| Histone H3 [Mesitornis unicolor]
 gb|KFR08209.1| Histone H3 [Nipponia nippon]
 gb|KFU93231.1| Histone H3 [Chaetura pelagica]
 gb|KFU93232.1| Histone H3 [Chaetura pelagica]
 gb|KFV65813.1| Histone H3 [Picoides pubescens]
 gb|KFV65818.1| Histone H3 [Picoides pubescens]
 gb|KFV65826.1| Histone H3 [Picoides pubescens]
 gb|KFV65827.1| Histone H3 [Picoides pubescens]
 gb|KFV65834.1| Histone H3 [Picoides pubescens]
 gb|KFV65844.1| Histone H3 [Picoides pubescens]
 gb|KFV65845.1| Histone H3 [Picoides pubescens]
 gb|KFV65846.1| Histone H3 [Picoides pubescens]
 gb|KGL80000.1| Histone H3 [Tinamus guttatus]
 gb|KGL84315.1| Histone H3 [Tinamus guttatus]
 gb|KGL87479.1| Histone H3 [Charadrius vociferus]
 gb|KGL87482.1| Histone H3 [Charadrius vociferus]
 gb|KHJ75865.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHJ79715.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHJ91401.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KIH45863.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH55445.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH66228.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=136

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ELU16492.1| hypothetical protein CAPTEDRAFT_90093 [Capitella teleta]
Length=136

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA++AYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASKAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001619077.1| hypothetical protein NEMVEDRAFT_v1g227757 [Nematostella vectensis]
 gb|EDO26977.1| predicted protein [Nematostella vectensis]
Length=136

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQ+A+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQKASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003769946.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
Length=186

 Score =   235 bits (599),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            S + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQ
Sbjct  47   SSIAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ  106

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  107  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  166

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKDIQLARRIRGERA
Sbjct  167  RVTIMPKDIQLARRIRGERA  186



>ref|XP_004139024.1| PREDICTED: histone H3.2-like [Cucumis sativus]
Length=136

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAI+AKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIYAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_005756396.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 ref|XP_005758885.1| hypothetical protein EMIHUDRAFT_77317 [Emiliania huxleyi CCMP1516]
 ref|XP_005759343.1| hypothetical protein EMIHUDRAFT_68589 [Emiliania huxleyi CCMP1516]
 ref|XP_005759345.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 ref|XP_005775029.1| putative histone H3, partial [Emiliania huxleyi CCMP1516]
 ref|XP_005775371.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 ref|XP_005776092.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 ref|XP_005778416.1| hypothetical protein EMIHUDRAFT_73737 [Emiliania huxleyi CCMP1516]
 ref|XP_005784138.1| putative histone H3, partial [Emiliania huxleyi CCMP1516]
 ref|XP_005784140.1| hypothetical protein EMIHUDRAFT_79538 [Emiliania huxleyi CCMP1516]
 ref|XP_005785938.1| hypothetical protein EMIHUDRAFT_79498 [Emiliania huxleyi CCMP1516]
 gb|EOD03967.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 gb|EOD06456.1| hypothetical protein EMIHUDRAFT_77317 [Emiliania huxleyi CCMP1516]
 gb|EOD06914.1| hypothetical protein EMIHUDRAFT_68589 [Emiliania huxleyi CCMP1516]
 gb|EOD06916.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 gb|EOD22600.1| putative histone H3, partial [Emiliania huxleyi CCMP1516]
 gb|EOD22942.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 gb|EOD23663.1| putative histone H3 [Emiliania huxleyi CCMP1516]
 gb|EOD25987.1| hypothetical protein EMIHUDRAFT_73737 [Emiliania huxleyi CCMP1516]
 gb|EOD31709.1| putative histone H3, partial [Emiliania huxleyi CCMP1516]
 gb|EOD31711.1| hypothetical protein EMIHUDRAFT_79538 [Emiliania huxleyi CCMP1516]
 gb|EOD33509.1| hypothetical protein EMIHUDRAFT_79498 [Emiliania huxleyi CCMP1516]
Length=136

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVVALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004562913.1| PREDICTED: histone H3-like centromeric protein CSE4-like [Maylandia 
zebra]
Length=275

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  32   IQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALRE  211
            I+ E S+V MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALRE
Sbjct  131  IRGERSVVAMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALRE  190

Query  212  IRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLC  391
            IR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLC
Sbjct  191  IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC  250

Query  392  AIHAKRVTIMPKDIQLARRIRGERA  466
            AIHAKRVTIMPKDIQLARRIRGERA
Sbjct  251  AIHAKRVTIMPKDIQLARRIRGERA  275


 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERAL  469
            MPKDIQLARRIRGER++
Sbjct  121  MPKDIQLARRIRGERSV  137



>ref|XP_003788936.1| PREDICTED: histone H3.1-like [Otolemur garnettii]
Length=175

 Score =   234 bits (598),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  44   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKY  223
            L ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+Y
Sbjct  35   LEVLVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY  94

Query  224  QKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHA  403
            QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHA
Sbjct  95   QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHA  154

Query  404  KRVTIMPKDIQLARRIRGERA  466
            KRVTIMPKDIQLARRIRGERA
Sbjct  155  KRVTIMPKDIQLARRIRGERA  175



>ref|XP_009601229.1| PREDICTED: histone H3.2-like [Nicotiana tomentosiformis]
Length=136

 Score =   233 bits (594),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEATEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIR ERA
Sbjct  121  MPKDIQLARRIRAERA  136



>ref|XP_005337122.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
Length=140

 Score =   233 bits (595),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQK
Sbjct  2    VLAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQK  61

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRL REIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct  62   STELLIRKLPFQRLAREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR  121

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  122  VTIMPKDIQLARRIRGERA  140



>ref|XP_003113948.1| hypothetical protein CRE_27089 [Caenorhabditis remanei]
 ref|XP_003114519.1| hypothetical protein CRE_27393 [Caenorhabditis remanei]
 ref|XP_003115561.1| hypothetical protein CRE_18972 [Caenorhabditis remanei]
 ref|XP_003748083.1| PREDICTED: histone H3-like [Metaseiulus occidentalis]
 gb|EFP00049.1| hypothetical protein CRE_18972 [Caenorhabditis remanei]
 gb|EFP05286.1| hypothetical protein CRE_27089 [Caenorhabditis remanei]
 gb|EFP05857.1| hypothetical protein CRE_27393 [Caenorhabditis remanei]
 gb|ETN68913.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|ETN81277.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|ETN85399.1| core histone H2A/H2B/H3/H4 [Necator americanus]
Length=136

 Score =   233 bits (594),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|KDP20192.1| hypothetical protein JCGZ_07912 [Jatropha curcas]
Length=226

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  91   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  150

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  151  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  210

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  211  MPKDIQLARRIRGERA  226



>gb|EGI60526.1| Histone H3 [Acromyrmex echinatior]
Length=138

 Score =   233 bits (594),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  3    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  62

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  63   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  122

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  123  MPKDIQLARRIRGERA  138



>ref|XP_011088023.1| PREDICTED: histone H3.2-like [Sesamum indicum]
Length=191

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 145/160 (91%), Gaps = 5/160 (3%)
 Frame = +2

Query  2    SIHSNFCNLY--IQFELSI---VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV  166
            S  + F +LY  I F       + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
Sbjct  32   SSQNQFPSLYRSIHFNHKYDKTLQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV  91

Query  167  KKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqea  346
            KKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA
Sbjct  92   KKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA  151

Query  347  aeaylvGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            AEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  152  AEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  191



>ref|XP_006162733.1| PREDICTED: histone H3.1-like [Tupaia chinensis]
Length=152

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = +2

Query  23   NLYIQFELSIVP-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV  199
            +L+  F   I P MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RP TV
Sbjct  4    SLFSLFAYLITPTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPATV  63

Query  200  ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFED  379
            ALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFED
Sbjct  64   ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFED  123

Query  380  TNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            TNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  124  TNLCAIHAKRVTIMPKDIQLARRIRGERA  152



>ref|XP_001862674.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862721.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862725.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37366.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37413.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37417.1| histone H3 type 2 [Culex quinquefasciatus]
Length=146

 Score =   233 bits (595),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKS
Sbjct  9    IAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  68

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV
Sbjct  69   TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV  128

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  129  TIMPKDIQLARRIRGERA  146



>ref|XP_008331672.1| PREDICTED: histone H3-like [Cynoglossus semilaevis]
Length=181

 Score =   234 bits (598),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  46   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  105

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  106  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  165

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  166  MPKDIQLARRIRGERA  181



>ref|XP_001632617.1| predicted protein [Nematostella vectensis]
 gb|EDO40554.1| predicted protein [Nematostella vectensis]
Length=220

 Score =   236 bits (602),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002164221.1| PREDICTED: histone H3-like [Hydra vulgaris]
Length=136

 Score =   233 bits (594),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSTAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001619752.1| hypothetical protein NEMVEDRAFT_v1g231526 [Nematostella vectensis]
 gb|EDO27652.1| predicted protein [Nematostella vectensis]
Length=148

 Score =   233 bits (595),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001862705.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001862709.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862713.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862717.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862729.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37397.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS37401.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37405.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37409.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37421.1| histone H3 type 2 [Culex quinquefasciatus]
Length=155

 Score =   234 bits (596),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKS
Sbjct  18   IAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  77

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV
Sbjct  78   TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV  137

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  138  TIMPKDIQLARRIRGERA  155



>ref|XP_004933313.1| PREDICTED: histone H3-like [Bombyx mori]
 gb|EHJ66926.1| hypothetical protein KGM_11800 [Danaus plexippus]
 gb|ETN77637.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|EYB95538.1| hypothetical protein Y032_0158g3226 [Ancylostoma ceylanicum]
 gb|KIH51123.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH61688.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=136

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARR+RGERA
Sbjct  121  MPKDIQLARRVRGERA  136



>ref|XP_003768748.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
Length=136

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LL+RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLVRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAI57347.1| Unknown (protein for MGC:147886) [Xenopus (Silurana) tropicalis]
Length=136

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQ+A+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQDASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001618260.1| hypothetical protein NEMVEDRAFT_v1g196043 [Nematostella vectensis]
 gb|EDO26160.1| predicted protein [Nematostella vectensis]
Length=136

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSLAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone 
Variant H3.2
 pdb|3AV1|E Chain E, The Human Nucleosome Structure Containing The Histone 
Variant H3.2
Length=139

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  64   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  123

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  124  MPKDIQLARRIRGERA  139



>ref|XP_005150559.1| PREDICTED: histone H3.2-like [Melopsittacus undulatus]
Length=161

 Score =   234 bits (596),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_007177425.1| PREDICTED: histone H3.1-like isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007471302.1| PREDICTED: histone H3.1-like isoform X1 [Lipotes vexillifer]
Length=150

 Score =   233 bits (595),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQK
Sbjct  12   VLVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQK  71

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKR
Sbjct  72   STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKR  131

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  132  VTIMPKDIQLARRIRGERA  150



>gb|AEW46685.1| histone type 2 [Ulva linza]
Length=136

 Score =   233 bits (594),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQD+KTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDYKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD+QLARRIRGERA
Sbjct  121  MPKDVQLARRIRGERA  136



>ref|XP_001892001.1| histone H3 [Brugia malayi]
 gb|AFI61664.1| histone 3 [Ruditapes philippinarum]
 gb|AFI61668.1| histone 3 [Ruditapes philippinarum]
 gb|AFI61669.1| histone 3 [Ruditapes philippinarum]
 gb|AFI61671.1| histone 3 [Ruditapes variegatus]
 gb|AFI61672.1| histone 3 [Ruditapes variegatus]
 gb|AFI61673.1| histone 3 [Ruditapes variegatus]
 gb|AFI61674.1| histone 3 [Ruditapes variegatus]
 gb|EFO18482.2| histone H3 [Loa loa]
 gb|EJW80937.1| histone H3 [Wuchereria bancrofti]
 gb|ERG81775.1| histone h3 [Ascaris suum]
 emb|CDP93712.1| Protein Bm3425 [Brugia malayi]
 gb|KHN75672.1| Histone H3 [Toxocara canis]
 gb|KHN83108.1| Histone H3 [Toxocara canis]
Length=136

 Score =   233 bits (594),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003145584.1| histone type 2 [Loa loa]
Length=160

 Score =   234 bits (596),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  25   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  84

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  85   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  144

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  145  MPKDIQLARRIRGERA  160



>gb|AFI61666.1| histone 3 [Ruditapes philippinarum]
Length=136

 Score =   233 bits (594),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQ+A+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQKASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CEF65438.1| Histone H3 [Strongyloides ratti]
Length=136

 Score =   233 bits (593),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIR++PFQRLVREIAQDFKTDLRFQSSAV ALQE+AEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRRMPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002422632.1| histone H3, putative [Pediculus humanus corporis]
 ref|XP_002422650.1| histone H3, putative [Pediculus humanus corporis]
 gb|EEB09894.1| histone H3, putative [Pediculus humanus corporis]
 gb|EEB09912.1| histone H3, putative [Pediculus humanus corporis]
Length=153

 Score =   233 bits (595),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  18   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  77

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  78   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  137

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  138  MPKDIQLARRIRGERA  153



>gb|KJB81635.1| hypothetical protein B456_013G154100 [Gossypium raimondii]
Length=225

 Score =   236 bits (602),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  90   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  149

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  150  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  209

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  210  MPKDIQLARRIRGERA  225



>ref|XP_004576699.1| PREDICTED: histone H3.2-like [Maylandia zebra]
Length=140

 Score =   233 bits (594),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_006288773.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella]
 gb|EOA21671.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella]
Length=175

 Score =   234 bits (597),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  38   FELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR  217
            FE     MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR
Sbjct  33   FEEEEKTMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIR  92

Query  218  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAI  397
            KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAI
Sbjct  93   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  152

Query  398  HAKRVTIMPKDIQLARRIRGERA  466
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  153  HAKRVTIMPKDIQLARRIRGERA  175



>ref|XP_002422654.1| histone H3, putative [Pediculus humanus corporis]
 gb|EEB09916.1| histone H3, putative [Pediculus humanus corporis]
Length=156

 Score =   233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  21   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  80

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  81   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  140

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  141  MPKDIQLARRIRGERA  156



>ref|XP_004977985.1| PREDICTED: histone H3-like centromeric protein CSE4-like [Setaria 
italica]
Length=278

 Score =   238 bits (606),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 137/138 (99%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
             PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS
Sbjct  141  APMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  200

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRV
Sbjct  201  TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRV  260

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  261  TIMPKDIQLARRIRGERA  278


 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAO06264.1| histone protein Hist2h3c1 [Mus musculus]
 gb|AAH94041.1| Histone cluster 2, H3c1 [Mus musculus]
 gb|EDL38877.1| mCG140445 [Mus musculus]
Length=181

 Score =   234 bits (597),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            S+  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQ
Sbjct  42   SVFAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ  101

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  102  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  161

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKDIQLARRIRGERA
Sbjct  162  RVTIMPKDIQLARRIRGERA  181



>gb|EFB20850.1| hypothetical protein PANDA_018542 [Ailuropoda melanoleuca]
Length=141

 Score =   233 bits (594),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  44   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKY  223
            L    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+Y
Sbjct  1    LQFFQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY  60

Query  224  QKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHA  403
            QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHA
Sbjct  61   QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHA  120

Query  404  KRVTIMPKDIQLARRIRGERA  466
            KRVTIMPKDIQLARRIRGERA
Sbjct  121  KRVTIMPKDIQLARRIRGERA  141



>emb|CDS28816.1| histone cluster 2, H3c2 [Hymenolepis microstoma]
Length=136

 Score =   233 bits (593),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRK+PFQRLVREIAQDFKTDLRFQS+AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKMPFQRLVREIAQDFKTDLRFQSTAVSALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|KHN31394.1| Histone H3.3 [Glycine soja]
Length=186

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 140/159 (88%), Gaps = 8/159 (5%)
 Frame = +2

Query  14   NFCNLYIQFELS--------IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK  169
            N C L+IQ   S           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVK
Sbjct  28   NLCILFIQDSASAFRKQRPKYFEMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVK  87

Query  170  KPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaa  349
            KPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAA
Sbjct  88   KPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAA  147

Query  350  eaylvGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  148  EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  186



>ref|XP_010919158.1| PREDICTED: histone H3.3-like [Elaeis guineensis]
Length=136

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAE YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEVYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004076085.2| PREDICTED: histone H3-like [Oryzias latipes]
Length=171

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  36   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  95

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  96   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  155

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  156  MPKDIQLARRIRGERA  171



>ref|XP_004717866.1| PREDICTED: histone H3.2-like [Echinops telfairi]
Length=136

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAREAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACD37543.1| histone H3 [Adineta vaga]
 gb|ACD37558.1| histone H3 [Adineta vaga]
 gb|ACF75484.1| histone H3 [Adineta vaga]
 gb|ACF75493.1| histone H3 [Adineta vaga]
Length=136

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG+KKPHRFRPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGIKKPHRFRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE+ E+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESCESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACD37575.1| histone H3 [Philodina roseola]
 gb|ACD37586.1| histone H3 [Philodina roseola]
 gb|ACF75501.1| histone H3 [Philodina roseola]
 gb|ACF75519.1| histone H3 [Philodina roseola]
Length=136

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG+KKPHRFRPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGIKKPHRFRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA E+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004349092.1| histone [Capsaspora owczarzaki ATCC 30864]
Length=140

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            ++ MARTKQTARKSTGGKAPRKQLATKAARK+APATGGVKKPHR+RPGTVALREIR+YQK
Sbjct  2    VLAMARTKQTARKSTGGKAPRKQLATKAARKTAPATGGVKKPHRYRPGTVALREIRRYQK  61

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSA++ALQE+AEAYLVGLFEDTNLCAIHA+R
Sbjct  62   STELLIRKLPFQRLVREIAQDFKTDLRFQSSAISALQESAEAYLVGLFEDTNLCAIHARR  121

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKDIQLARRIRGERA
Sbjct  122  VTIMPKDIQLARRIRGERA  140



>emb|CAA32434.1| H3 histone [Drosophila melanogaster]
Length=136

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR+TI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRITI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|EFB20876.1| hypothetical protein PANDA_018573 [Ailuropoda melanoleuca]
Length=142

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  7    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  66

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  67   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  126

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  127  MPKDIQLARRIRGERA  142



>emb|CAB02546.1| histone H3 [Homo sapiens]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EA LVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEATLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AFI61670.1| histone 3 [Ruditapes variegatus]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV A QEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLAPQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_011086031.1| PREDICTED: histone H3.2-like [Sesamum indicum]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLA RIRGERA
Sbjct  121  MPKDIQLAGRIRGERA  136



>gb|KFV65812.1| Histone H3 [Picoides pubescens]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGK+PRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKSPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001419259.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97552.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 emb|CEG01325.1| Histone core [Ostreococcus tauri]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSTAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CAR63687.1| Putative protein similar to H3 histone, family 2 isoform 2 [Angiostrongylus 
cantonensis]
Length=143

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  8    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  67

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  68   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  127

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  128  MPKDIQLARRIRGERA  143



>gb|EFB20847.1| hypothetical protein PANDA_018538 [Ailuropoda melanoleuca]
Length=139

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKS
Sbjct  2    LEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  61

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRV
Sbjct  62   TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRV  121

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  122  TIMPKDIQLARRIRGERA  139



>ref|XP_003088464.1| hypothetical protein CRE_05346 [Caenorhabditis remanei]
 ref|XP_003107753.1| hypothetical protein CRE_12684 [Caenorhabditis remanei]
 ref|XP_003107968.1| hypothetical protein CRE_12510 [Caenorhabditis remanei]
 gb|EFO91168.1| hypothetical protein CRE_05346 [Caenorhabditis remanei]
 gb|EFO93652.1| hypothetical protein CRE_12684 [Caenorhabditis remanei]
 gb|EFO93867.1| hypothetical protein CRE_12510 [Caenorhabditis remanei]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|EFB20869.1| hypothetical protein PANDA_018566 [Ailuropoda melanoleuca]
 gb|EFB21579.1| hypothetical protein PANDA_016832 [Ailuropoda melanoleuca]
Length=137

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  61

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  62   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  121

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  122  MPKDIQLARRIRGERA  137



>gb|EFB20866.1| hypothetical protein PANDA_018563 [Ailuropoda melanoleuca]
Length=137

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  61

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  62   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  121

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  122  MPKDIQLARRIRGERA  137



>ref|XP_006801198.1| PREDICTED: histone H3.3-like isoform X1 [Neolamprologus brichardi]
 ref|XP_006801199.1| PREDICTED: histone H3.3-like isoform X2 [Neolamprologus brichardi]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRFRPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRFRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001870860.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS34378.1| histone H3.2 [Culex quinquefasciatus]
Length=145

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  10   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  69

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AVAALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  70   LLIRKLPFQRLVREIAQDFKTDLRFQSAAVAALQEASEAYLVGLFEDTNLCAIHAKRVTI  129

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  130  MPKDIQLARRIRGERA  145



>ref|XP_007179127.1| PREDICTED: histone H3.1-like isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=138

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  3    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  62

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EA LVGLFEDTNLCAIHAKRVTI
Sbjct  63   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEACLVGLFEDTNLCAIHAKRVTI  122

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  123  MPKDIQLARRIRGERA  138



>ref|XP_005843780.1| hypothetical protein CHLNCDRAFT_59160 [Chlorella variabilis]
 gb|EFN51678.1| hypothetical protein CHLNCDRAFT_59160 [Chlorella variabilis]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_320335.2| AGAP012197-PA [Anopheles gambiae str. PEST]
 ref|XP_320336.2| AGAP012196-PA [Anopheles gambiae str. PEST]
 gb|EAA00515.2| AGAP012197-PA [Anopheles gambiae str. PEST]
 gb|EAA00132.2| AGAP012196-PA [Anopheles gambiae str. PEST]
 gb|ETN61962.1| histone H3 [Anopheles darlingi]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AVAALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAVAALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_006024249.1| PREDICTED: histone H3.2-like [Alligator sinensis]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALRE+R+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREMRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CAA34274.1| unnamed protein product [Mus musculus]
 gb|AAA48797.1| histone H3 [Gallus gallus]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCA+HAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAMHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001061048.2| PREDICTED: histone H3.1 [Rattus norvegicus]
 ref|XP_003751756.2| PREDICTED: histone H3.1 [Rattus norvegicus]
Length=198

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +2

Query  26   LYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  205
            L + F  S   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  52   LSLSFGRSRHTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  111

Query  206  REIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTN  385
            REIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTN
Sbjct  112  REIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTN  171

Query  386  LCAIHAKRVTIMPKDIQLARRIRGERA  466
            LCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  172  LCAIHAKRVTIMPKDIQLARRIRGERA  198



>ref|XP_001640436.1| predicted protein [Nematostella vectensis]
 ref|XP_002613950.1| hypothetical protein BRAFLDRAFT_67487 [Branchiostoma floridae]
 ref|XP_006813652.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 gb|EDO48373.1| predicted protein [Nematostella vectensis]
 gb|EEN69959.1| hypothetical protein BRAFLDRAFT_67487 [Branchiostoma floridae]
 emb|CBM82512.1| histone H3 protein [Balanoglossus clavigerus]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRL+REIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLIREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_005066350.1| PREDICTED: histone H3.2-like [Mesocricetus auratus]
Length=164

 Score =   233 bits (594),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  29   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  88

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  89   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  148

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  149  MPKDIQLARRIRGERA  164



>ref|XP_008992030.1| PREDICTED: histone H3.1 [Callithrix jacchus]
Length=155

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  20   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  79

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  80   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  139

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  140  MPKDIQLARRIRGERA  155



>ref|XP_010547605.1| PREDICTED: histone H3.2-like [Tarenaya hassleriana]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRL REIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLGREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_009345124.1| PREDICTED: histone H3.2-like [Pyrus x bretschneideri]
Length=136

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG KKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGGKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|NP_001183546.1| uncharacterized LOC100502113 [Zea mays]
 gb|ACG40473.1| histone H3 [Zea mays]
 gb|ACR37474.1| unknown [Zea mays]
 gb|ACR37478.1| unknown [Zea mays]
 gb|ACR37540.1| unknown [Zea mays]
 gb|ACR38114.1| unknown [Zea mays]
 tpg|DAA56682.1| TPA: histone H3 [Zea mays]
Length=136

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIR ERA
Sbjct  121  MPKDIQLARRIRVERA  136



>ref|NP_003520.1| histone H3.1 [Homo sapiens]
 ref|NP_003522.1| histone H3.1 [Homo sapiens]
 ref|NP_003523.1| histone H3.1 [Homo sapiens]
 ref|NP_003524.1| histone H3.1 [Homo sapiens]
 ref|NP_003525.1| histone H3.1 [Homo sapiens]
 ref|NP_003526.1| histone H3.1 [Homo sapiens]
 ref|NP_003527.1| histone H3.1 [Homo sapiens]
 ref|NP_003528.1| histone H3.1 [Homo sapiens]
 ref|NP_066298.1| histone H3.1 [Homo sapiens]
 ref|NP_003521.2| histone H3.1 [Homo sapiens]
 ref|NP_659539.1| histone H3.1 [Mus musculus]
 ref|NP_835513.1| histone H3.1 [Mus musculus]
 ref|NP_835514.1| histone H3.1 [Mus musculus]
 ref|NP_038578.2| histone H3.1 [Mus musculus]
 ref|NP_001013074.1| histone H3.1 [Rattus norvegicus]
 ref|NP_001180643.1| histone H3.1 [Macaca mulatta]
 ref|NP_001274345.1| histone H3.1 [Sus scrofa]
 ref|XP_545428.1| PREDICTED: histone H3.1-like [Canis lupus familiaris]
 ref|XP_545429.1| PREDICTED: histone H3.1-like [Canis lupus familiaris]
 ref|XP_874006.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_001083954.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001084296.1| PREDICTED: histone H3.1-like [Macaca mulatta]
 ref|XP_001087706.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001088298.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001088393.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001095574.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001096897.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_527254.2| PREDICTED: histone H3.1 [Pan troglodytes]
 ref|XP_001498082.2| PREDICTED: histone H3.1-like [Equus caballus]
 ref|XP_001916433.1| PREDICTED: histone H3.1-like [Equus caballus]
 ref|XP_002714250.1| PREDICTED: histone H3.1 [Oryctolagus cuniculus]
 ref|XP_002714261.1| PREDICTED: histone H3.1 [Oryctolagus cuniculus]
 ref|XP_002746186.1| PREDICTED: histone H3.1 [Callithrix jacchus]
 ref|XP_002803686.1| PREDICTED: histone H3.1-like [Macaca mulatta]
 ref|XP_002803695.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_002697506.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_002697575.1| PREDICTED: histone H3.1 isoform X2 [Bos taurus]
 ref|XP_002816565.1| PREDICTED: histone H3.1 [Pongo abelii]
 ref|XP_002816571.1| PREDICTED: histone H3.1 isoform X2 [Pongo abelii]
 ref|XP_002928564.1| PREDICTED: histone H3.1 [Ailuropoda melanoleuca]
 ref|XP_002928566.1| PREDICTED: histone H3.1 [Ailuropoda melanoleuca]
 ref|XP_002928575.1| PREDICTED: histone H3.1 [Ailuropoda melanoleuca]
 ref|XP_002928576.1| PREDICTED: histone H3.1 [Ailuropoda melanoleuca]
 ref|XP_003263291.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_003263321.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_003263325.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_003272012.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_003272015.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_003416469.1| PREDICTED: histone H3.1 [Loxodonta africana]
 ref|XP_854287.2| PREDICTED: histone H3.1-like [Canis lupus familiaris]
 ref|XP_003468857.1| PREDICTED: histone H3.1-like [Cavia porcellus]
 ref|XP_003788835.1| PREDICTED: histone H3.1-like [Otolemur garnettii]
 ref|XP_003788836.1| PREDICTED: histone H3.1-like [Otolemur garnettii]
 ref|XP_003788843.1| PREDICTED: histone H3.1-like [Otolemur garnettii]
 ref|XP_003804475.1| PREDICTED: histone H3.1 [Pan paniscus]
 ref|XP_003804597.1| PREDICTED: histone H3.1 [Pan paniscus]
 ref|XP_003829731.1| PREDICTED: histone H3.1 [Pan paniscus]
 ref|XP_003897202.1| PREDICTED: histone H3.1 [Papio anubis]
 ref|XP_003897273.1| PREDICTED: histone H3.1 [Papio anubis]
 ref|XP_003927331.1| PREDICTED: histone H3.1 [Saimiri boliviensis boliviensis]
 ref|XP_003950813.1| PREDICTED: histone H3.1 [Pan troglodytes]
 ref|XP_003985741.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_003985773.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_003985776.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_003985778.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_004019075.1| PREDICTED: histone H3.1-like [Ovis aries]
 ref|XP_004043428.1| PREDICTED: histone H3.1-like [Gorilla gorilla gorilla]
 ref|XP_004043431.1| PREDICTED: histone H3.1-like [Gorilla gorilla gorilla]
 ref|XP_004043462.1| PREDICTED: histone H3.1-like [Gorilla gorilla gorilla]
 ref|XP_004043511.1| PREDICTED: histone H2A type 1-like isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004043523.1| PREDICTED: histone H3.1-like [Gorilla gorilla gorilla]
 ref|XP_004087107.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_004088810.1| PREDICTED: histone H2A type 1-D-like isoform 1 [Nomascus leucogenys]
 ref|XP_004088816.1| PREDICTED: histone H3.1-like [Nomascus leucogenys]
 ref|XP_004273521.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004273522.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004273528.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004273540.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004273550.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004286146.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004286147.1| PREDICTED: histone H3.1-like [Orcinus orca]
 ref|XP_004316315.1| PREDICTED: histone H3.1-like [Tursiops truncatus]
 ref|XP_004317751.1| PREDICTED: histone H3.1-like [Tursiops truncatus]
 ref|XP_004329202.1| PREDICTED: histone H3.1-like [Tursiops truncatus]
 ref|XP_004329206.1| PREDICTED: histone H3.1-like [Tursiops truncatus]
 ref|XP_004384060.1| PREDICTED: histone H3.1-like [Trichechus manatus latirostris]
 ref|XP_004384064.1| PREDICTED: histone H3.1-like [Trichechus manatus latirostris]
 ref|XP_004387122.1| PREDICTED: histone H3.1-like [Trichechus manatus latirostris]
 ref|XP_004406571.1| PREDICTED: histone H3.1-like [Odobenus rosmarus divergens]
 ref|XP_004413685.1| PREDICTED: histone H3.1-like [Odobenus rosmarus divergens]
 ref|XP_004413708.1| PREDICTED: histone H3.1-like [Odobenus rosmarus divergens]
 ref|XP_004432107.1| PREDICTED: histone H3.1-like [Ceratotherium simum simum]
 ref|XP_004441871.1| PREDICTED: histone H3.1-like [Ceratotherium simum simum]
 ref|XP_004463548.1| PREDICTED: histone H3.1-like [Dasypus novemcinctus]
 ref|XP_004463555.1| PREDICTED: histone H3.1-like [Dasypus novemcinctus]
 ref|XP_004463558.1| PREDICTED: histone H3.1-like [Dasypus novemcinctus]
 ref|XP_004463576.1| PREDICTED: histone H3.1-like [Dasypus novemcinctus]
 ref|XP_004481902.1| PREDICTED: histone H3.1-like [Dasypus novemcinctus]
 ref|XP_004481910.1| PREDICTED: histone H3.1-like [Dasypus novemcinctus]
 ref|XP_004596554.1| PREDICTED: histone H3.1-like [Ochotona princeps]
 ref|XP_004596557.1| PREDICTED: histone H3.1-like [Ochotona princeps]
 ref|XP_004598446.1| PREDICTED: histone H3.1-like [Ochotona princeps]
 ref|XP_004621954.1| PREDICTED: histone H3.1-like [Sorex araneus]
 ref|XP_004694908.1| PREDICTED: histone H3.1-like [Condylura cristata]
 ref|XP_004694912.1| PREDICTED: histone H3.1-like [Condylura cristata]
 ref|XP_004694926.1| PREDICTED: histone H3.1-like [Condylura cristata]
 ref|XP_004695477.1| PREDICTED: histone H3.1-like [Condylura cristata]
 ref|XP_004787910.1| PREDICTED: histone H3.1-like [Mustela putorius furo]
 ref|XP_004787960.1| PREDICTED: histone H3.1-like [Mustela putorius furo]
 ref|XP_004847593.1| PREDICTED: histone H3.1-like [Heterocephalus glaber]
 ref|XP_003468925.2| PREDICTED: histone H3.1-like [Cavia porcellus]
 ref|XP_005066524.1| PREDICTED: histone H3.1-like [Mesocricetus auratus]
 ref|XP_005066532.1| PREDICTED: histone H3.1-like [Mesocricetus auratus]
 ref|XP_005196706.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_005223855.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_005355009.1| PREDICTED: histone H3.1-like [Microtus ochrogaster]
 ref|XP_005369967.1| PREDICTED: histone H3.1-like [Microtus ochrogaster]
 ref|XP_005337116.1| PREDICTED: histone H3.1-like [Ictidomys tridecemlineatus]
 ref|XP_005399006.1| PREDICTED: histone H3.1-like [Chinchilla lanigera]
 ref|XP_005403349.1| PREDICTED: histone H3.1-like [Chinchilla lanigera]
 ref|XP_005403387.1| PREDICTED: histone H3.1-like [Chinchilla lanigera]
 ref|XP_005553796.1| PREDICTED: histone H3.1-like [Macaca fascicularis]
 ref|XP_005553872.1| PREDICTED: histone H3.1-like [Macaca fascicularis]
 ref|XP_005553917.1| PREDICTED: histone H3.1-like [Macaca fascicularis]
 ref|XP_005603668.1| PREDICTED: histone H3.1-like [Equus caballus]
 ref|XP_005603682.1| PREDICTED: histone H3.1-like [Equus caballus]
 ref|XP_005603692.1| PREDICTED: histone H3.1-like [Equus caballus]
 ref|XP_005603693.1| PREDICTED: histone H3.1-like isoform X1 [Equus caballus]
 ref|XP_005603694.1| PREDICTED: histone H3.1-like isoform X2 [Equus caballus]
 ref|XP_005640156.1| PREDICTED: histone H3.1-like [Canis lupus familiaris]
 ref|XP_005640158.1| PREDICTED: histone H3.1-like [Canis lupus familiaris]
 ref|XP_005640184.1| PREDICTED: histone H3.1-like [Canis lupus familiaris]
 ref|XP_005696812.1| PREDICTED: histone H3.1-like [Capra hircus]
 ref|XP_005696814.1| PREDICTED: histone H3.1-like isoform X1 [Capra hircus]
 ref|XP_005696815.1| PREDICTED: histone H3.1-like isoform X2 [Capra hircus]
 ref|XP_005867474.1| PREDICTED: histone H3.1-like [Myotis brandtii]
 ref|XP_005892276.1| PREDICTED: histone H3.1-like [Bos mutus]
 ref|XP_005960876.1| PREDICTED: histone H3.1-like [Pantholops hodgsonii]
 ref|XP_006105752.1| PREDICTED: histone H3.1-like [Myotis lucifugus]
 ref|XP_006105756.1| PREDICTED: histone H3.1-like [Myotis lucifugus]
 ref|XP_006105758.1| PREDICTED: histone H3.1-like [Myotis lucifugus]
 ref|XP_006105767.1| PREDICTED: histone H3.1-like [Myotis lucifugus]
 ref|XP_006105903.1| PREDICTED: histone H3.1-like [Myotis lucifugus]
 ref|XP_006107726.1| PREDICTED: histone H3.1-like [Myotis lucifugus]
 ref|XP_006182228.1| PREDICTED: histone H3.1-like [Camelus ferus]
 ref|XP_006182238.1| PREDICTED: histone H3.1-like [Camelus ferus]
 ref|XP_006182259.1| PREDICTED: histone H3.1-like [Camelus ferus]
 ref|XP_006219002.1| PREDICTED: histone H3.1-like [Vicugna pacos]
 ref|XP_006162707.1| PREDICTED: histone H3.1-like [Tupaia chinensis]
 ref|XP_006162719.1| PREDICTED: histone H3.1-like [Tupaia chinensis]
 ref|XP_006168566.1| PREDICTED: histone H3.1-like [Tupaia chinensis]
 ref|XP_006760033.1| PREDICTED: histone H3.1-like [Myotis davidii]
 ref|XP_006760038.1| PREDICTED: histone H3.1-like [Myotis davidii]
 ref|XP_006735958.1| PREDICTED: histone H3.1-like [Leptonychotes weddellii]
 ref|XP_006735982.1| PREDICTED: histone H3.1-like [Leptonychotes weddellii]
 ref|XP_006736830.1| PREDICTED: histone H3.1-like [Leptonychotes weddellii]
 ref|XP_006888684.1| PREDICTED: histone H3.1-like [Elephantulus edwardii]
 ref|XP_006888694.1| PREDICTED: histone H3.1-like [Elephantulus edwardii]
 ref|XP_006872832.1| PREDICTED: histone H3.1-like [Chrysochloris asiatica]
 ref|XP_006872875.1| PREDICTED: histone H3.1-like [Chrysochloris asiatica]
 ref|XP_006872879.1| PREDICTED: histone H3.1-like [Chrysochloris asiatica]
 ref|XP_006923545.1| PREDICTED: histone H3.1-like [Pteropus alecto]
 ref|XP_006931427.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_006931452.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_006993204.1| PREDICTED: histone H3.1-like [Peromyscus maniculatus bairdii]
 ref|XP_006993221.1| PREDICTED: histone H3.1-like [Peromyscus maniculatus bairdii]
 ref|XP_006999014.1| PREDICTED: histone H3.1-like [Peromyscus maniculatus bairdii]
 ref|XP_007105887.1| PREDICTED: histone H3.1-like [Physeter catodon]
 ref|XP_007105896.1| PREDICTED: histone H3.1-like [Physeter catodon]
 ref|XP_007128664.1| PREDICTED: histone H3.1-like [Physeter catodon]
 ref|XP_007128672.1| PREDICTED: histone H3.1-like isoform X2 [Physeter catodon]
 ref|XP_007128684.1| PREDICTED: histone H3.1-like [Physeter catodon]
 ref|XP_006040927.1| PREDICTED: histone H3.1-like [Bubalus bubalis]
 ref|XP_006048071.1| PREDICTED: histone H3.1-like [Bubalus bubalis]
 ref|XP_006048085.1| PREDICTED: histone H3.1-like [Bubalus bubalis]
 ref|XP_007177426.1| PREDICTED: histone H3.1-like isoform X2 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007471300.1| PREDICTED: histone H3.1-like isoform X2 [Lipotes vexillifer]
 ref|XP_007471303.1| PREDICTED: histone H3.1-like isoform X2 [Lipotes vexillifer]
 ref|XP_007449313.1| PREDICTED: histone H3.1-like [Lipotes vexillifer]
 ref|XP_007534631.1| PREDICTED: histone H3.1 isoform X2 [Erinaceus europaeus]
 ref|XP_007534641.1| PREDICTED: histone H3.1 [Erinaceus europaeus]
 ref|XP_007534650.1| PREDICTED: histone H3.1 [Erinaceus europaeus]
 ref|XP_007634651.1| PREDICTED: histone H3.1 isoform X2 [Cricetulus griseus]
 ref|XP_007634658.1| PREDICTED: histone H3.1 [Cricetulus griseus]
 ref|XP_007948021.1| PREDICTED: histone H3.1 [Orycteropus afer afer]
 ref|XP_007948037.1| PREDICTED: histone H3.1 isoform X2 [Orycteropus afer afer]
 ref|XP_007948048.1| PREDICTED: histone H3.1 [Orycteropus afer afer]
 ref|XP_007971599.1| PREDICTED: histone H3.1 [Chlorocebus sabaeus]
 ref|XP_007971664.1| PREDICTED: histone H3.1 [Chlorocebus sabaeus]
 ref|XP_007971678.1| PREDICTED: histone H3.1 [Chlorocebus sabaeus]
 ref|XP_008055791.1| PREDICTED: histone H3.1 [Tarsius syrichta]
 ref|XP_008070424.1| PREDICTED: histone H3.1 [Tarsius syrichta]
 ref|XP_008070425.1| PREDICTED: histone H3.1 [Tarsius syrichta]
 ref|XP_008260675.1| PREDICTED: histone H3.1 [Oryctolagus cuniculus]
 ref|XP_008260677.1| PREDICTED: histone H3.1 [Oryctolagus cuniculus]
 ref|XP_008260682.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.1-like [Oryctolagus 
cuniculus]
 ref|XP_008260692.1| PREDICTED: histone H3.1 [Oryctolagus cuniculus]
 ref|XP_008246699.1| PREDICTED: histone H3.1 [Oryctolagus cuniculus]
 ref|XP_008526336.1| PREDICTED: histone H3.1 isoform X1 [Equus przewalskii]
 ref|XP_008526339.1| PREDICTED: histone H3.1 [Equus przewalskii]
 ref|XP_008539711.1| PREDICTED: histone H3.1 [Equus przewalskii]
 ref|XP_008539720.1| PREDICTED: histone H3.1 [Equus przewalskii]
 ref|XP_008566068.1| PREDICTED: histone H3.1 [Galeopterus variegatus]
 ref|XP_008580157.1| PREDICTED: histone H3.1 [Galeopterus variegatus]
 ref|XP_008585846.1| PREDICTED: histone H3.1 [Galeopterus variegatus]
 ref|XP_008585848.1| PREDICTED: histone H3.1 [Galeopterus variegatus]
 ref|XP_008691196.1| PREDICTED: histone H3.1 [Ursus maritimus]
 ref|XP_008691242.1| PREDICTED: histone H3.1 [Ursus maritimus]
 ref|XP_008824859.1| PREDICTED: histone H3.1 [Nannospalax galili]
 ref|XP_008992035.1| PREDICTED: histone H3.1 [Callithrix jacchus]
 ref|XP_008992101.1| PREDICTED: histone H3.1 [Callithrix jacchus]
 ref|XP_008958127.1| PREDICTED: histone H3.1 [Pan paniscus]
 ref|XP_009202840.1| PREDICTED: histone H3.1 [Papio anubis]
 ref|XP_009202845.1| PREDICTED: histone H3.1 [Papio anubis]
 ref|XP_009202849.1| PREDICTED: histone H3.1 [Papio anubis]
 ref|XP_009202890.1| PREDICTED: histone H3.1 [Papio anubis]
 ref|XP_009239775.1| PREDICTED: histone H3.1 [Pongo abelii]
 ref|XP_009239776.1| PREDICTED: histone H3.1 [Pongo abelii]
 ref|XP_009239779.1| PREDICTED: histone H3.1 isoform X2 [Pongo abelii]
 ref|XP_009239782.1| PREDICTED: histone H3.1 [Pongo abelii]
 ref|XP_009448912.1| PREDICTED: histone H3.1 [Pan troglodytes]
 ref|XP_009448913.1| PREDICTED: histone H3.1 [Pan troglodytes]
 ref|XP_009448914.1| PREDICTED: histone H3.1 [Pan troglodytes]
 ref|XP_009448972.1| PREDICTED: histone H3.1 [Pan troglodytes]
 ref|XP_010362889.1| PREDICTED: histone H3.1 isoform X2 [Rhinopithecus roxellana]
 ref|XP_010362939.1| PREDICTED: histone H3.1 [Rhinopithecus roxellana]
 ref|XP_010362950.1| PREDICTED: histone H3.1 [Rhinopithecus roxellana]
 ref|XP_010362991.1| PREDICTED: histone H3.1 [Rhinopithecus roxellana]
 ref|XP_010363131.1| PREDICTED: histone H3.1 [Rhinopithecus roxellana]
 ref|XP_010363154.1| PREDICTED: histone H3.1 [Rhinopithecus roxellana]
 ref|XP_010372527.1| PREDICTED: histone H3.1 [Rhinopithecus roxellana]
 ref|XP_010336290.1| PREDICTED: histone H3.1 [Saimiri boliviensis boliviensis]
 ref|XP_010331010.1| PREDICTED: histone H3.1 [Saimiri boliviensis boliviensis]
 ref|XP_010621292.1| PREDICTED: histone H3.1 [Fukomys damarensis]
 ref|XP_010823711.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_010823719.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_010823755.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_010816767.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_010816811.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_010816818.1| PREDICTED: histone H3.1 [Bos taurus]
 ref|XP_010841730.1| PREDICTED: histone H3.1 [Bison bison bison]
 ref|XP_010841740.1| PREDICTED: histone H3.1 [Bison bison bison]
 ref|XP_010841742.1| PREDICTED: histone H3.1 [Bison bison bison]
 ref|XP_010973015.1| PREDICTED: histone H3.1 [Camelus dromedarius]
 ref|XP_011280366.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_011280381.1| PREDICTED: histone H3.1 [Felis catus]
 ref|XP_011364639.1| PREDICTED: histone H3.1 [Pteropus vampyrus]
 sp|P68431.2|H31_HUMAN RecName: Full=Histone H3.1; AltName: Full=Histone H3/a; AltName: 
Full=Histone H3/b; AltName: Full=Histone H3/c; AltName: 
Full=Histone H3/d; AltName: Full=Histone H3/f; AltName: Full=Histone 
H3/h; AltName: Full=Histone H3/i; AltName: Full=Histone 
H3/j; AltName: Full=Histone H3/k; AltName: Full=Histone 
H3/l [Homo sapiens]
 sp|P68432.2|H31_BOVIN RecName: Full=Histone H3.1 [Bos taurus]
 sp|P68433.2|H31_MOUSE RecName: Full=Histone H3.1 [Mus musculus]
 sp|Q6LED0.3|H31_RAT RecName: Full=Histone H3.1 [Rattus norvegicus]
 sp|Q6LBF0.3|H31_MUSPA RecName: Full=Histone H3.1 [Mus pahari]
 pir||I57019 H3 histone - rat
 pir||I49398 histone H3.1 protein - shrew mouse
 pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle
 pdb|2CV5|E Chain E, Crystal Structure Of Human Nucleosome Core Particle
 pdb|1U35|A Chain A, Crystal Structure Of The Nucleosome Core Particle Containing 
The Histone Domain Of Macroh2a
 pdb|1U35|E Chain E, Crystal Structure Of The Nucleosome Core Particle Containing 
The Histone Domain Of Macroh2a
 emb|CAA40407.1| histone H3 [Homo sapiens]
 emb|CAA24952.1| unnamed protein product [Homo sapiens]
 emb|CAA25839.1| unnamed protein product [Mus musculus]
 emb|CAA34512.1| unnamed protein product [Mus musculus]
 gb|AAA63185.1| histone H3.1 [Homo sapiens]
 gb|AAA19824.1| H3 histone [Rattus norvegicus]
 gb|AAA37811.1| histone H3 [Mus musculus]
 gb|AAA37813.1| histone H3 [Mus musculus]
 emb|CAA56572.1| histone 3.1 protein [Mus pahari]
 emb|CAA56571.1| histone H3.1 protein [Mus pahari]
 emb|CAA86403.1| histone H3a [Homo sapiens]
 gb|AAB04763.1| histone H3.1-I [Mus musculus]
 gb|AAB04765.1| histone H3.1-D [Mus musculus]
 emb|CAB02547.1| histone H3 [Homo sapiens]
 emb|CAB02548.1| histone H3 [Homo sapiens]
 emb|CAB06030.1| histone H3 [Homo sapiens]
 emb|CAB06032.1| histone H3 [Homo sapiens]
 emb|CAA58540.1| histone H3 [Homo sapiens]
 emb|CAA72968.1| Histone H3 [Mus musculus]
 dbj|BAB24722.1| unnamed protein product [Mus musculus]
 dbj|BAB31493.1| unnamed protein product [Mus musculus]
 gb|AAH31333.1| Histone cluster 1, H3d [Homo sapiens]
 gb|AAN10051.1| histone H3 [Homo sapiens]
 gb|AAN10052.1| histone H3 [Homo sapiens]
 gb|AAN10053.1| histone H3 [Homo sapiens]
 gb|AAN10054.1| histone H3 [Homo sapiens]
 gb|AAN10055.1| histone H3 [Homo sapiens]
 gb|AAN10056.1| histone H3 [Homo sapiens]
 gb|AAN10057.1| histone H3 [Homo sapiens]
 gb|AAN10058.1| histone H3 [Homo sapiens]
 gb|AAN10059.1| histone H3 [Homo sapiens]
 gb|AAN10060.1| histone H3 [Homo sapiens]
 gb|AAO06254.1| histone protein Hist1h3h [Mus musculus]
 gb|AAO06255.1| histone protein Hist1h3i [Mus musculus]
 gb|AAO06256.1| histone protein Hist1h3g [Mus musculus]
 gb|AAO06262.1| histone protein Hist1h3a [Mus musculus]
 gb|AAH66247.1| Histone cluster 1, H3a [Homo sapiens]
 gb|AAH66245.1| Histone cluster 1, H3a [Homo sapiens]
 gb|AAH66246.1| Histone cluster 1, H3a [Homo sapiens]
 gb|AAH67491.1| Histone cluster 1, H3a [Homo sapiens]
 gb|AAH67492.1| Histone cluster 1, H3f [Homo sapiens]
 gb|AAH67490.1| Histone cluster 1, H3a [Homo sapiens]
 gb|AAH69133.1| Histone cluster 1, H3b [Homo sapiens]
 gb|AAH69818.1| Histone cluster 1, H3f [Homo sapiens]
 gb|AAH69303.1| Histone cluster 1, H3a [Homo sapiens]
 emb|CAG46656.1| HIST1H3A [Homo sapiens]
 emb|CAG46780.1| HIST1H3F [Homo sapiens]
 emb|CAG46808.1| HIST1H3F [Homo sapiens]
 emb|CAG46811.1| HIST1H3E [Homo sapiens]
 gb|AAH96128.1| Histone cluster 1, H3h [Homo sapiens]
 gb|AAH96130.1| Histone cluster 1, H3h [Homo sapiens]
 gb|AAH96133.1| Histone cluster 1, H3b [Homo sapiens]
 gb|AAH96131.1| Histone cluster 1, H3f [Homo sapiens]
 gb|AAH96129.1| Histone cluster 1, H3h [Homo sapiens]
 gb|AAH96132.1| Histone cluster 1, H3b [Homo sapiens]
 gb|AAH96134.1| Histone cluster 1, H3b [Homo sapiens]
 gb|AAH99630.1| Histone cluster 1, H3b [Homo sapiens]
 dbj|BAE33402.1| unnamed protein product [Mus musculus]
 gb|AAI11922.1| HIST1H3J protein, partial [synthetic construct]
 gb|AAH69305.2| Histone cluster 1, H3i [Homo sapiens]
 gb|AAI16384.1| Hist1h3i protein [Mus musculus]
 gb|AAI15817.1| Hist1h3a protein [Mus musculus]
 gb|AAI25356.1| Histone cluster 1, H3g [Mus musculus]
 gb|AAI25358.1| Histone cluster 1, H3g [Mus musculus]
 gb|AAI27611.1| HIST1H3C protein [Homo sapiens]
 gb|EAW55508.1| histone 1, H3a [Homo sapiens]
 gb|EAW55511.1| histone 1, H3b [Homo sapiens]
 gb|EAW55514.1| histone 1, H3c [Homo sapiens]
 gb|EAW55539.1| hCG2043425 [Homo sapiens]
 gb|EAW55547.1| hCG17998 [Homo sapiens]
 gb|EAW55551.1| histone 1, H3f [Homo sapiens]
 gb|EAW55553.1| histone 1, H3g [Homo sapiens]
 gb|EAX03108.1| histone 1, H3h [Homo sapiens]
 gb|EAX03120.1| histone 1, H3i [Homo sapiens]
 gb|EAX03122.1| histone 1, H3j [Homo sapiens]
 gb|ABM83721.1| histone 1, H3d [synthetic construct]
 gb|ABM87041.1| histone 1, H3d [synthetic construct]
 gb|EDL32535.1| mCG16990 [Mus musculus]
 gb|EDL32561.1| mCG7740 [Mus musculus]
 gb|EDL32629.1| mCG23034 [Mus musculus]
 gb|EDL32634.1| mCG23030 [Mus musculus]
 gb|AAI43047.1| HIST1H3H protein [Homo sapiens]
 gb|EDL84559.1| rCG23084 [Rattus norvegicus]
 gb|EDL84566.1| rCG23116 [Rattus norvegicus]
 gb|EDL86564.1| rCG45152 [Rattus norvegicus]
 gb|EDL86592.1| rCG45200 [Rattus norvegicus]
 gb|AAI48251.1| HIST1H3H protein [Homo sapiens]
 gb|AAI48244.1| HIST1H3H protein [Homo sapiens]
 gb|ABZ92502.1| histone cluster 1, H3e [synthetic construct]
 gb|ABZ92503.1| histone cluster 1, H3g [synthetic construct]
 gb|ABZ92504.1| histone cluster 1, H3h [synthetic construct]
 gb|AAI60079.1| Histone cluster 1, H3c [synthetic construct]
 dbj|BAG36628.1| unnamed protein product [Homo sapiens]
 dbj|BAG36832.1| unnamed protein product [Homo sapiens]
 dbj|BAG34929.1| unnamed protein product [Homo sapiens]
 dbj|BAG38198.1| unnamed protein product [Homo sapiens]
 dbj|BAG73248.1| histone cluster 1, H3b [synthetic construct]
 gb|EFB20874.1| hypothetical protein PANDA_018571 [Ailuropoda melanoleuca]
 gb|EFB21590.1| hypothetical protein PANDA_016843 [Ailuropoda melanoleuca]
 tpg|DAA16173.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16175.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16178.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16187.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16190.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16192.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16251.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16255.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 tpg|DAA16263.1| TPA: histone cluster 1, H3f-like [Bos taurus]
 dbj|BAJ21191.1| histone cluster 1, H3e [synthetic construct]
 dbj|BAJ21192.1| histone cluster 1, H3g [synthetic construct]
 dbj|BAJ20241.1| histone cluster 1, H3d [synthetic construct]
 gb|ADQ32889.1| histone cluster 1, H3a [synthetic construct]
 gb|ADR82713.1| histone cluster 1, H3j [synthetic construct]
 gb|AEI00724.1| histone cluster 1 [Sus scrofa]
 gb|EGV96118.1| Histone H3.1 [Cricetulus griseus]
 gb|EGV96123.1| Histone H3.1 [Cricetulus griseus]
 gb|EHB11497.1| Histone H3.1 [Heterocephalus glaber]
 gb|EHB13137.1| Histone H3.1 [Heterocephalus glaber]
 gb|EHH18008.1| Histone H3/a [Macaca mulatta]
 gb|EHH18011.1| Histone H3/a [Macaca mulatta]
 gb|EHH18014.1| Histone H3/a [Macaca mulatta]
 gb|EHH18031.1| Histone H3/a [Macaca mulatta]
 gb|EHH18034.1| Histone H3/a [Macaca mulatta]
 gb|EHH18038.1| hypothetical protein EGK_14567 [Macaca mulatta]
 gb|EHH18060.1| Histone H3/a [Macaca mulatta]
 gb|EHH18068.1| hypothetical protein EGK_14603 [Macaca mulatta]
 gb|EHH18070.1| Histone H3/a [Macaca mulatta]
 gb|EHH52780.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52782.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52785.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52796.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52802.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52809.1| hypothetical protein EGM_13324 [Macaca fascicularis]
 gb|EHH52823.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52829.1| Histone H3/a [Macaca fascicularis]
 gb|EHH52831.1| Histone H3/a [Macaca fascicularis]
 gb|ELK02659.1| Histone H3.1 [Pteropus alecto]
 gb|ELK02661.1| Histone H3.1 [Pteropus alecto]
 gb|ELK33055.1| Histone H3.1 [Myotis davidii]
 gb|ELK33071.1| Histone H3.1 [Myotis davidii]
 gb|ELR58911.1| Histone H3.1 [Bos mutus]
 gb|ELV10780.1| Histone H3.1 [Tupaia chinensis]
 gb|ELV13504.1| Histone H3.1 [Tupaia chinensis]
 gb|EPQ08520.1| Histone H3.1 [Myotis brandtii]
 gb|EPY83084.1| histone 1, H2ai isoform 3-like protein [Camelus ferus]
 gb|EPY83089.1| histone 1, H2ai isoform 3-like protein [Camelus ferus]
 gb|EPY83097.1| histone 1, H2ai isoform 3-like protein [Camelus ferus]
 gb|EPY83116.1| histone 1, H2ai isoform 3-like protein [Camelus ferus]
 gb|ERE77555.1| histone H3.1-like protein [Cricetulus griseus]
 gb|AHJ25763.1| histone H3.1-like protein, partial [Panthera tigris altaica]
 gb|AIC50095.1| HIST1H3A, partial [synthetic construct]
 gb|AIC50096.1| HIST1H3C, partial [synthetic construct]
 gb|AIC50097.1| HIST1H3E, partial [synthetic construct]
 gb|AIC50098.1| HIST1H3G, partial [synthetic construct]
 gb|AIC50099.1| HIST1H3H, partial [synthetic construct]
 gb|AIC50100.1| HIST1H3B, partial [synthetic construct]
 gb|AIC50245.1| HIST1H3F, partial [synthetic construct]
 gb|AIC55396.1| HIST1H3H, partial [synthetic construct]
 gb|AIC55502.1| HIST1H3F, partial [synthetic construct]
 gb|AIC55503.1| HIST1H3F, partial [synthetic construct]
 gb|KFO28172.1| Histone H3.1 [Fukomys damarensis]
 gb|KFO33864.1| Histone H3.1 [Fukomys damarensis]
 gb|KFO33888.1| Histone H3.1 [Fukomys damarensis]
Length=136

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_007513760.1| histone H3 [Bathycoccus prasinos]
 emb|CCO16285.1| histone H3 [Bathycoccus prasinos]
Length=136

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEA+EAYL GLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEASEAYLTGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_010916783.1| PREDICTED: histone H3-like centromeric protein CSE4 [Elaeis guineensis]
Length=281

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERAL  469
            MPKDIQLARRIRGERAL
Sbjct  121  MPKDIQLARRIRGERAL  137


 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 141/150 (94%), Gaps = 6/150 (4%)
 Frame = +2

Query  17   FCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  196
            F  +++Q       MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT
Sbjct  138  FLAIFLQ------AMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  191

Query  197  VALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFE  376
            VALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFE
Sbjct  192  VALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFE  251

Query  377  DTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            DTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  252  DTNLCAIHAKRVTIMPKDIQLARRIRGERA  281



>ref|XP_011496732.1| PREDICTED: histone H3-like [Ceratosolen solmsi marchali]
Length=136

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDF+TDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFQTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAY90124.1| histone 3 [Rheum australe]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKK HRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKSHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAE+YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAESYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD+QLARRIRGERA
Sbjct  121  MPKDMQLARRIRGERA  136



>gb|EFB21581.1| hypothetical protein PANDA_016834 [Ailuropoda melanoleuca]
Length=144

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  9    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  68

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  69   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  128

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  129  MPKDIQLARRIRGERA  144



>ref|XP_006024237.1| PREDICTED: histone H3.2-like isoform X1 [Alligator sinensis]
Length=162

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKS
Sbjct  25   IAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  84

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV
Sbjct  85   TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV  144

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  145  TIMPKDIQLARRIRGERA  162



>emb|CAN70652.1| hypothetical protein VITISV_010022 [Vitis vinifera]
Length=137

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  61

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  62   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  121

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  122  MPKDIQLARRIRGERA  137



>ref|XP_003724461.1| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
 ref|XP_003725435.1| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
 sp|P69071.2|H3_DERIM RecName: Full=Histone H3, embryonic [Dermasterias imbricata]
 sp|P69072.2|H3_LYTPI RecName: Full=Histone H3, embryonic [Lytechinus pictus]
 sp|P69073.2|H3_PARLI RecName: Full=Histone H3, embryonic [Paracentrotus lividus]
 sp|P69074.2|H3_PISBR RecName: Full=Histone H3, embryonic [Pisaster brevispinus]
 sp|P69075.2|H3_PISOC RecName: Full=Histone H3, embryonic [Pisaster ochraceus]
 sp|P69076.2|H3_PSAMI RecName: Full=Histone H3, embryonic [Psammechinus miliaris]
 sp|P69077.2|H3_PYCHE RecName: Full=Histone H3, embryonic [Pycnopodia helianthoides]
 sp|P69078.2|H3_SOLST RecName: Full=Histone H3, embryonic [Solaster stimpsoni]
 sp|P69079.2|H3_STRDR RecName: Full=Histone H3, embryonic [Strongylocentrotus droebachiensis]
 emb|CAA30388.1| unnamed protein product [Dermasterias imbricata]
 emb|CAA25242.1| unnamed protein product [Lytechinus pictus]
 emb|CAA25262.1| unnamed protein product [Lytechinus pictus]
 emb|CAA38050.1| H3 histone [Pisaster brevispinus]
 emb|CAA30387.1| unnamed protein product [Pisaster brevispinus]
 emb|CAA38054.1| histone H3 [Pycnopodia helianthoides]
 emb|CAA24375.1| unnamed protein product [Psammechinus miliaris]
 emb|CAA25632.1| histone H3 (aa 1-135) [Psammechinus miliaris]
 emb|CAA38052.1| histone H3 [Pisaster ochraceus]
 emb|CAA30386.1| unnamed protein product [Pisaster ochraceus]
 emb|CAA38056.1| histone H3 [Solaster stimpsoni]
 gb|AAA29441.1| histone H3 [Paracentrotus lividus]
 gb|AAA65843.1| histone H3 [Paracentrotus lividus]
 gb|AAA30026.1| histone H3 [Psammechinus miliaris]
 gb|AAB59206.1| histone H3 [Psammechinus miliaris]
 gb|AAA30053.1| histone H3 [Strongylocentrotus droebachiensis]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_008539398.1| PREDICTED: histone H3.1-like [Equus przewalskii]
Length=151

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 139/152 (91%), Gaps = 3/152 (2%)
 Frame = +2

Query  11   SNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  190
            S FC +     L    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RP
Sbjct  3    SFFCQIT---GLGKFVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRP  59

Query  191  GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGL  370
            GTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGL
Sbjct  60   GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL  119

Query  371  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  120  FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  151



>ref|XP_007163668.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris]
 gb|ESW35662.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris]
Length=202

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 141/153 (92%), Gaps = 3/153 (2%)
 Frame = +2

Query  17   FCNLYIQFELSIVP---MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  187
            F  ++  F +S++    MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+R
Sbjct  50   FFYMFTCFLMSLLALEQMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYR  109

Query  188  PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvG  367
            PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVG
Sbjct  110  PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVG  169

Query  368  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  170  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  202



>ref|XP_006580873.1| PREDICTED: histone H3-like centromeric protein CSE4-like [Glycine 
max]
Length=303

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/138 (99%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERALG  472
            MPKDIQLARRIRGERAL 
Sbjct  121  MPKDIQLARRIRGERALN  138


 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  168  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  227

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  228  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  287

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  288  MPKDIQLARRIRGERA  303



>pdb|3AFA|A Chain A, The Human Nucleosome Structure
 pdb|3AFA|E Chain E, The Human Nucleosome Structure
 pdb|3AZI|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k31q Mutation
 pdb|3AZI|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k31q Mutation
 pdb|3AZJ|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k44q Mutation
 pdb|3AZJ|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k44q Mutation
 pdb|3AZK|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k59q Mutation
 pdb|3AZK|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k59q Mutation
 pdb|3AZL|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k77q Mutation
 pdb|3AZL|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k77q Mutation
 pdb|3AZM|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k79q Mutation
 pdb|3AZM|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k79q Mutation
 pdb|3AZN|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k91q Mutation
 pdb|3AZN|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k91q Mutation
 pdb|3W96|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2a N- Terminal Region
 pdb|3W96|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2a N- Terminal Region
 pdb|3W97|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2b N- Terminal Region
 pdb|3W97|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2b N- Terminal Region
 pdb|3W99|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H4 N- Terminal Region
 pdb|3W99|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H4 N- Terminal Region
 pdb|3WA9|A Chain A, The Nucleosome Containing Human H2a.z.1
 pdb|3WA9|E Chain E, The Nucleosome Containing Human H2a.z.1
 pdb|3WAA|A Chain A, The Nucleosome Containing Human H2a.z.2
 pdb|3WAA|E Chain E, The Nucleosome Containing Human H2a.z.2
 pdb|3WKJ|A Chain A, The Nucleosome Containing Human Tsh2b
 pdb|3WKJ|E Chain E, The Nucleosome Containing Human Tsh2b
Length=139

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  64   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  123

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  124  MPKDIQLARRIRGERA  139



>ref|XP_002928569.2| PREDICTED: histone H3.1-like [Ailuropoda melanoleuca]
Length=176

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  44   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKY  223
            L    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+Y
Sbjct  36   LQFFQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY  95

Query  224  QKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHA  403
            QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHA
Sbjct  96   QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHA  155

Query  404  KRVTIMPKDIQLARRIRGERA  466
            KRVTIMPKDIQLARRIRGERA
Sbjct  156  KRVTIMPKDIQLARRIRGERA  176



>ref|XP_003259196.1| PREDICTED: histone H3.2-like isoform 1 [Nomascus leucogenys]
 ref|XP_004089974.1| PREDICTED: histone H3.2-like isoform 2 [Nomascus leucogenys]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR+TI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRLTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004576419.1| PREDICTED: histone H3.2-like [Maylandia zebra]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MP DIQLARRIRGERA
Sbjct  121  MPNDIQLARRIRGERA  136



>ref|NP_001078516.1| Histone H3.3 [Arabidopsis thaliana]
 gb|AEE87156.1| Histone H3.3 [Arabidopsis thaliana]
Length=164

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  53   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  232
            + MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKS
Sbjct  27   IKMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKS  86

Query  233  TELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRV  412
            TELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRV
Sbjct  87   TELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRV  146

Query  413  TIMPKDIQLARRIRGERA  466
            TIMPKDIQLARRIRGERA
Sbjct  147  TIMPKDIQLARRIRGERA  164



>gb|KGB39314.1| Histone H3 [Schistosoma haematobium]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_011347776.1| PREDICTED: histone H3-like [Cerapachys biroi]
Length=169

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 1/153 (1%)
 Frame = +2

Query  11   SNFCNLYIQFELSIVP-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  187
            ++ C   ++   +  P MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+R
Sbjct  17   ASLCCRLVRDSAAFDPDMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR  76

Query  188  PGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvG  367
            PGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVG
Sbjct  77   PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVG  136

Query  368  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  137  LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  169



>ref|XP_002045560.1| GM19670 [Drosophila sechellia]
 ref|XP_002045750.1| GM26661 [Drosophila sechellia]
 gb|EDW52706.1| GM19670 [Drosophila sechellia]
 gb|EDW55905.1| GM26661 [Drosophila sechellia]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQ ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQNARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>dbj|BAA20144.1| Histone H3 [Drosophila simulans]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKS PATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSVPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+E YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASETYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002633139.1| Hypothetical protein CBG05838 [Caenorhabditis briggsae]
 ref|XP_002633174.1| Hypothetical protein CBG05886 [Caenorhabditis briggsae]
 ref|XP_002633318.1| Hypothetical protein CBG06055 [Caenorhabditis briggsae]
 ref|XP_002633321.1| Hypothetical protein CBG06058 [Caenorhabditis briggsae]
 ref|XP_002639224.1| Hypothetical protein CBG03775 [Caenorhabditis briggsae]
 emb|CAP26312.1| Protein CBG06058 [Caenorhabditis briggsae]
 emb|CAP26315.1| Protein CBG06055 [Caenorhabditis briggsae]
 emb|CAP26459.1| Protein CBG05886 [Caenorhabditis briggsae]
 emb|CAP26494.1| Protein CBG05838 [Caenorhabditis briggsae]
 emb|CAP24611.1| Protein CBG03775 [Caenorhabditis briggsae]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE+AEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAP94665.1| histone H3 [Mytilus chilensis]
Length=136

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQL RRIRGERA
Sbjct  121  MPKDIQLVRRIRGERA  136



>ref|XP_009166091.1| hypothetical protein T265_13221, partial [Opisthorchis viverrini]
 gb|AAW24748.1| SJCHGC01198 protein [Schistosoma japonicum]
 emb|CAX72005.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72006.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72007.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72008.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72009.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72010.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72011.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX72012.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78697.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78698.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78700.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78701.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78702.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78703.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78704.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78705.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78706.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78707.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78708.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78709.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78710.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78711.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78712.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78713.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78714.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78715.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX78716.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX75182.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX75183.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX75184.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAX75185.1| Histone H3.3 [Schistosoma japonicum]
 emb|CAZ35552.1| histone H3, putative [Schistosoma mansoni]
 dbj|GAA29599.1| histone H3 [Clonorchis sinensis]
 gb|AFL48195.1| histone H3 [Schmidtea mediterranea]
 gb|EUB54600.1| Histone H3.3 [Echinococcus granulosus]
 gb|KER30170.1| hypothetical protein T265_13221, partial [Opisthorchis viverrini]
 emb|CDJ01096.1| expressed protein [Echinococcus multilocularis]
 emb|CDS18053.1| expressed protein [Echinococcus granulosus]
 emb|CDS38378.1| expressed protein [Echinococcus multilocularis]
 emb|CDS25794.1| histone H3 [Hymenolepis microstoma]
 gb|KFM77247.1| Histone H3.3, partial [Stegodyphus mimosarum]
 gb|KGB36963.1| Histone H3.3 [Schistosoma haematobium]
Length=136

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004712543.1| PREDICTED: histone H3.2-like [Echinops telfairi]
Length=136

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRL REIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLAREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003770631.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
Length=162

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  27   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  86

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  87   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  146

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  147  MPKDIQLARRIRGERA  162



>ref|WP_039311726.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 ref|NP_195713.1| Histone H3.3 [Arabidopsis thaliana]
 ref|NP_196659.1| histone H3.3 [Arabidopsis thaliana]
 ref|NP_849529.1| histone H3  [Arabidopsis thaliana]
 ref|NP_001031816.1| histone H3  [Arabidopsis thaliana]
 ref|NP_001050276.1| Os03g0390600 [Oryza sativa Japonica Group]
 ref|NP_001056693.1| Os06g0130900 [Oryza sativa Japonica Group]
 ref|NP_001078517.1| Histone H3.3 [Arabidopsis thaliana]
 ref|NP_001131417.1| uncharacterized LOC100192746 [Zea mays]
 ref|NP_001234218.1| histone H3 variant H3.3 [Solanum lycopersicum]
 ref|NP_001235785.1| uncharacterized protein LOC100305466 [Glycine max]
 ref|NP_001268032.1| histone H3.3 [Vitis vinifera]
 ref|XP_001752178.1| histone H3 [Physcomitrella patens]
 ref|XP_001752234.1| histone H3 [Physcomitrella patens]
 ref|XP_001752318.1| histone H3 [Physcomitrella patens]
 ref|XP_002300726.1| hypothetical protein POPTR_0002s02830g [Populus trichocarpa]
 ref|XP_002306294.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 ref|XP_002307702.1| histone H3-D family protein [Populus trichocarpa]
 ref|XP_002309961.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 ref|XP_002310848.1| hypothetical protein POPTR_0007s13920g [Populus trichocarpa]
 ref|XP_002270349.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_002278809.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_002278833.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_002467760.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor]
 ref|XP_002437756.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor]
 ref|XP_002510489.1| histone h3, putative [Ricinus communis]
 ref|XP_002510490.1| histone h3, putative [Ricinus communis]
 ref|XP_002513959.1| histone h3, putative [Ricinus communis]
 ref|XP_002531518.1| histone h3, putative [Ricinus communis]
 ref|XP_002873489.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002977792.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii]
 ref|XP_002986910.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii]
 ref|XP_003538608.1| PREDICTED: histone H3.3-like isoformX1 [Glycine max]
 ref|XP_003538611.1| PREDICTED: histone H3.3-like [Glycine max]
 ref|XP_003545047.1| PREDICTED: histone H3.3-like [Glycine max]
 ref|XP_003550410.1| PREDICTED: histone H3.3-like [Glycine max]
 ref|XP_003557131.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_003557133.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_003579868.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_003589384.1| Histone H3 [Medicago truncatula]
 ref|XP_003628560.1| Histone H3 [Medicago truncatula]
 ref|XP_003635681.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_004146875.1| PREDICTED: histone H3.3-like [Cucumis sativus]
 ref|XP_004152625.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus]
 ref|XP_004152626.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus]
 ref|XP_004162225.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus]
 ref|XP_004162226.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus]
 ref|XP_004168241.1| PREDICTED: histone H3.3-like [Cucumis sativus]
 ref|XP_004237940.1| PREDICTED: histone H3.3 [Solanum lycopersicum]
 ref|XP_004238326.1| PREDICTED: histone H3.3 [Solanum lycopersicum]
 ref|XP_004250115.1| PREDICTED: histone H3.3 [Solanum lycopersicum]
 ref|XP_004287213.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004288164.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004288400.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004299672.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004499230.1| PREDICTED: histone H3.3-like [Cicer arietinum]
 ref|XP_004509059.1| PREDICTED: histone H3.3-like [Cicer arietinum]
 ref|XP_004952850.1| PREDICTED: histone H3.3-like [Setaria italica]
 ref|XP_004964429.1| PREDICTED: histone H3.3-like [Setaria italica]
 ref|XP_004975802.1| PREDICTED: histone H3.3-like [Setaria italica]
 ref|XP_004984150.1| PREDICTED: histone H3.3-like isoform X1 [Setaria italica]
 ref|XP_004984151.1| PREDICTED: histone H3.3-like isoform X2 [Setaria italica]
 ref|XP_006342014.1| PREDICTED: histone H3.3-like [Solanum tuberosum]
 ref|XP_006353204.1| PREDICTED: histone H3.3-like [Solanum tuberosum]
 ref|XP_006363289.1| PREDICTED: histone H3.3-like [Solanum tuberosum]
 ref|XP_006366221.1| PREDICTED: histone H3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006366222.1| PREDICTED: histone H3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006284722.1| hypothetical protein CARUB_v10005986mg [Capsella rubella]
 ref|XP_006284727.1| hypothetical protein CARUB_v10005990mg [Capsella rubella]
 ref|XP_006302978.1| hypothetical protein CARUB_v10021126mg [Capsella rubella]
 ref|XP_006382893.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 ref|XP_006380404.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 ref|XP_006390289.1| hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum]
 ref|XP_006399597.1| hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum]
 ref|XP_006426330.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 ref|XP_006426331.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 ref|XP_006435124.1| hypothetical protein CICLE_v10002817mg [Citrus clementina]
 ref|XP_006466265.1| PREDICTED: histone H3.3-like [Citrus sinensis]
 ref|XP_006473607.1| PREDICTED: histone H3.3-like [Citrus sinensis]
 ref|XP_006591489.1| PREDICTED: histone H3.3-like isoform X2 [Glycine max]
 ref|XP_006650156.1| PREDICTED: histone H3.3-like isoform X1 [Oryza brachyantha]
 ref|XP_006650157.1| PREDICTED: histone H3.3-like isoform X2 [Oryza brachyantha]
 ref|XP_006652345.1| PREDICTED: histone H3.3-like [Oryza brachyantha]
 ref|XP_006655750.1| PREDICTED: histone H3.3-like [Oryza brachyantha]
 ref|XP_006827997.1| hypothetical protein AMTR_s00008p00237320 [Amborella trichopoda]
 ref|XP_006838082.1| hypothetical protein AMTR_s00225p00023630 [Amborella trichopoda]
 ref|XP_006849278.1| hypothetical protein AMTR_s00027p00248560 [Amborella trichopoda]
 ref|XP_007047866.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007160694.1| hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris]
 ref|XP_007163667.1| hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris]
 ref|XP_007207357.1| hypothetical protein PRUPE_ppa013166mg [Prunus persica]
 ref|XP_007223801.1| hypothetical protein PRUPE_ppa013185mg [Prunus persica]
 ref|XP_007226054.1| hypothetical protein PRUPE_ppa013183mg [Prunus persica]
 ref|XP_008235104.1| PREDICTED: histone H3.3 [Prunus mume]
 ref|XP_008219337.1| PREDICTED: histone H3.3 [Prunus mume]
 ref|XP_008221310.1| PREDICTED: histone H3.3 [Prunus mume]
 ref|XP_008372995.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008386124.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008338566.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008343325.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008444859.1| PREDICTED: histone H3.3 [Cucumis melo]
 ref|XP_008453806.1| PREDICTED: histone H3.3 [Cucumis melo]
 ref|XP_008645852.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008645853.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008645854.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008645855.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008659340.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008779899.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008790920.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008790921.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008810061.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008777683.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_009130061.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009125263.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009131189.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009104699.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009373084.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009365825.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009339588.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009348044.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009383133.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009391324.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009391325.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009417592.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009418322.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009622923.1| PREDICTED: histone H3.3 [Nicotiana tomentosiformis]
 ref|XP_009623907.1| PREDICTED: histone H3.3 [Nicotiana tomentosiformis]
 ref|XP_009589379.1| PREDICTED: histone H3.3 [Nicotiana tomentosiformis]
 ref|XP_009799309.1| PREDICTED: histone H3.3 [Nicotiana sylvestris]
 ref|XP_009799310.1| PREDICTED: histone H3.3 [Nicotiana sylvestris]
 ref|XP_009771876.1| PREDICTED: histone H3.3 [Nicotiana sylvestris]
 ref|XP_010061026.1| PREDICTED: histone H3.3 [Eucalyptus grandis]
 ref|XP_010027928.1| PREDICTED: histone H3.3 [Eucalyptus grandis]
 ref|XP_010105254.1| Histone [Morus notabilis]
 ref|XP_010267031.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010267040.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010272988.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010272989.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010272990.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010239970.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_010321293.1| PREDICTED: histone H3 variant H3.3 isoform X1 [Solanum lycopersicum]
 ref|XP_010419651.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010431986.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010431987.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010431988.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010437129.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010446577.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010446578.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010453132.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010491788.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010533621.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010533631.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010533639.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010536364.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010539857.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010539858.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010526662.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010526992.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010679856.1| PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681007.1| PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_011016807.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011022826.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011022827.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011025928.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_010939695.1| PREDICTED: histone H3.3 [Elaeis guineensis]
 ref|XP_011028962.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_010940939.1| PREDICTED: histone H3.3 [Elaeis guineensis]
 ref|XP_010909579.1| PREDICTED: histone H3.3 [Elaeis guineensis]
 ref|XP_011045138.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011013190.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011074645.1| PREDICTED: histone H3.3 [Sesamum indicum]
 ref|XP_011097534.1| PREDICTED: histone H3.3 [Sesamum indicum]
 ref|XP_011100034.1| PREDICTED: histone H3.3 [Sesamum indicum]
 ref|XP_011459532.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 sp|P59169.2|H33_ARATH RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 [Arabidopsis 
thaliana]
 sp|Q71V89.3|H33_GOSHI RecName: Full=Histone H3.3 [Gossypium hirsutum]
 sp|P69245.2|H33_LOLTE RecName: Full=Histone H3.3 [Lolium temulentum]
 sp|P69244.2|H33_MEDSA RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: 
Full=Minor histone H3 [Medicago sativa]
 sp|Q71H73.3|H33_VITVI RecName: Full=Histone H3.3 [Vitis vinifera]
 sp|Q6RUR1.3|H33_CAPAN RecName: Full=Histone H3.3 [Capsicum annuum]
 sp|Q71U98.3|H33_ORYCO RecName: Full=Histone H3.3 [Oryza coarctata]
 sp|Q711T2.3|H33_PINPS RecName: Full=Histone H3.3 [Pinus pinaster]
 sp|Q76N23.1|H33_TOBAC RecName: Full=Histone H3.3 [Nicotiana tabacum]
 sp|Q3C2E5.3|H33_LOLMU RecName: Full=Histone H3.3; AltName: Full=Replacement histone 
H3 [Lolium multiflorum]
 sp|A2XHJ3.1|H33_ORYSI RecName: Full=Histone H3.3; AltName: Full=H3.2 [Oryza sativa 
Indica Group]
 sp|Q0JCT1.2|H33_ORYSJ RecName: Full=Histone H3.3; AltName: Full=H3.2 [Oryza sativa 
Japonica Group]
 gb|AAK60325.1|AF385735_1 AT4g40030/T5J17_200 [Arabidopsis thaliana]
 emb|CAA42957.1| histone H3.3 like protein [Arabidopsis thaliana]
 emb|CAA42958.1| histone H3.3 like protein [Arabidopsis thaliana]
 gb|AAB49538.1| histone H3.2 [Medicago sativa]
 gb|AAB36493.1| histone H3.2 [Medicago sativa]
 gb|AAB36494.1| histone H3.2 [Medicago sativa]
 gb|AAB36497.1| histone H3.2 [Medicago sativa]
 gb|AAB36498.1| histone H3.2 [Medicago sativa]
 emb|CAA56153.1| histone H3 [Lolium temulentum]
 emb|CAA58445.1| histone H3 variant H3.3 [Solanum lycopersicum]
 gb|AAB97162.1| histone 3 [Gossypium hirsutum]
 dbj|BAA31218.1| histone H3 [Nicotiana tabacum]
 gb|AAC78105.1| histone H3 [Oryza sativa Japonica Group]
 gb|AAC97380.1| histone H3 [Oryza coarctata]
 emb|CAB38916.1| histone H3.3 [Arabidopsis thaliana]
 emb|CAB38917.1| Histon H3 [Arabidopsis thaliana]
 dbj|BAA84794.1| histone H3 [Oryza sativa Japonica Group]
 emb|CAB80666.1| histone H3.3 [Arabidopsis thaliana]
 emb|CAB80667.1| Histon H3 [Arabidopsis thaliana]
 emb|CAB96853.1| histon H3 protein [Arabidopsis thaliana]
 gb|AAL50088.1| AT5g10980/T30N20_250 [Arabidopsis thaliana]
 gb|AAL77728.1| AT4g40030/T5J17_200 [Arabidopsis thaliana]
 gb|AAM19891.1| AT5g10980/T30N20_250 [Arabidopsis thaliana]
 gb|AAM63725.1| histon H3 protein [Arabidopsis thaliana]
 gb|AAO00751.1| Histon H3 [Arabidopsis thaliana]
 gb|AAO29945.1| Histone H3 [Arabidopsis thaliana]
 emb|CAC84678.1| putative histone H3 [Pinus pinaster]
 gb|AAP30739.1| histone H3.3 [Vitis vinifera]
 gb|AAR06361.1| histone H3.2 protein [Oryza sativa Japonica Group]
 gb|AAR84425.1| histone H3-like protein [Capsicum annuum]
 gb|AAS19511.1| putative histone H3 [Oryza sativa Japonica Group]
 gb|AAX92697.1| histone 3 [Picea abies]
 gb|AAZ72655.1| histone H3.1 [Craterostigma plantagineum]
 gb|AAZ72656.1| histone H3.2 [Craterostigma plantagineum]
 dbj|BAE47073.1| replacement histone H3 [Lolium multiflorum]
 gb|ABF58917.1| At4g40040 [Arabidopsis thaliana]
 emb|CAJ38369.1| histin H3 [Plantago major]
 gb|ABF96358.1| Histone H3, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF96359.1| Histone H3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12190.1| Os03g0390600 [Oryza sativa Japonica Group]
 dbj|BAF18607.1| Os06g0130900 [Oryza sativa Japonica Group]
 gb|ABI97039.1| histone H3 [Robinia pseudoacacia]
 emb|CAH67105.1| H0818E04.22 [Oryza sativa Indica Group]
 emb|CAH67180.1| H0815C01.1 [Oryza sativa Indica Group]
 gb|ABK21404.1| unknown [Picea sitchensis]
 gb|ABK21875.1| unknown [Picea sitchensis]
 gb|ABK23002.1| unknown [Picea sitchensis]
 gb|ABK23658.1| unknown [Picea sitchensis]
 gb|ABK94527.1| unknown [Populus trichocarpa]
 gb|ABK94627.1| unknown [Populus trichocarpa]
 gb|ABK94832.1| unknown [Populus trichocarpa]
 gb|ABK96416.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EAY90303.1| hypothetical protein OsI_11878 [Oryza sativa Indica Group]
 gb|EAZ30915.1| hypothetical protein OsJ_14996 [Oryza sativa Japonica Group]
 gb|EAZ35710.1| hypothetical protein OsJ_19999 [Oryza sativa Japonica Group]
 gb|ABP04114.1| histone 3 [Lemna minor]
 emb|CAN70615.1| hypothetical protein VITISV_004842 [Vitis vinifera]
 emb|CAN80736.1| hypothetical protein VITISV_034858 [Vitis vinifera]
 emb|CAN81972.1| hypothetical protein VITISV_011984 [Vitis vinifera]
 gb|ABR16042.1| unknown [Picea sitchensis]
 gb|ABR16186.1| unknown [Picea sitchensis]
 gb|ABR16666.1| unknown [Picea sitchensis]
 gb|ABR16974.1| unknown [Picea sitchensis]
 gb|ABR16987.1| unknown [Picea sitchensis]
 gb|ABR17024.1| unknown [Picea sitchensis]
 gb|ABR18384.1| unknown [Picea sitchensis]
 gb|ABS11142.1| histone H3 [Solanum lycopersicum]
 gb|ABS83501.1| U box domain-containing protein [Oryza sativa Japonica Group]
 gb|EDQ82911.1| histone H3 [Physcomitrella patens]
 gb|EDQ82967.1| histone H3 [Physcomitrella patens]
 gb|EDQ83051.1| histone H3 [Physcomitrella patens]
 gb|ACA50511.1| histone H3 [Oryza sativa Japonica Group]
 gb|ACF79815.1| unknown [Zea mays]
 gb|ACF87291.1| unknown [Zea mays]
 gb|ACF88473.1| unknown [Zea mays]
 gb|ACG24535.1| histone H3 [Zea mays]
 gb|ACG24932.1| histone H3 [Zea mays]
 gb|ACG25002.1| histone H3 [Zea mays]
 gb|ACG25605.1| histone H3 [Zea mays]
 gb|ACG31041.1| histone H3 [Zea mays]
 gb|ACG31048.1| histone H3 [Zea mays]
 gb|ACG46136.1| histone H3 [Zea mays]
 dbj|BAG88589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77374.1| hypothetical protein OsI_16104 [Oryza sativa Indica Group]
 dbj|BAH19936.1| AT4G40040 [Arabidopsis thaliana]
 dbj|BAH20155.1| AT4G40040 [Arabidopsis thaliana]
 gb|EEE59182.1| hypothetical protein OsJ_11116 [Oryza sativa Japonica Group]
 gb|EEE79999.1| hypothetical protein POPTR_0002s02830g [Populus trichocarpa]
 gb|EEE90411.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 gb|EEE91298.1| hypothetical protein POPTR_0007s13920g [Populus trichocarpa]
 gb|EEE93290.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 gb|EEE94698.1| histone H3-D family protein [Populus trichocarpa]
 gb|EEF30872.1| histone h3, putative [Ricinus communis]
 gb|EEF48542.1| histone h3, putative [Ricinus communis]
 gb|EEF52676.1| histone h3, putative [Ricinus communis]
 gb|EEF52677.1| histone h3, putative [Ricinus communis]
 gb|ACN40144.1| unknown [Picea sitchensis]
 gb|ACN41024.1| unknown [Picea sitchensis]
 gb|ACN65412.1| histone 3.2 [Pteris vittata]
 gb|ACR37697.1| unknown [Zea mays]
 gb|EER89123.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor]
 gb|EER94758.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor]
 gb|ACU13139.1| unknown [Glycine max]
 gb|ADE77894.1| unknown [Picea sitchensis]
 gb|ADF59039.1| histone H3.2 [Jatropha curcas]
 gb|EFH49748.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata]
 emb|CBI17398.3| unnamed protein product [Vitis vinifera]
 emb|CBI33143.3| unnamed protein product [Vitis vinifera]
 gb|ADI87404.1| histone H3 [Oryza sativa]
 gb|ADI87405.1| histone H3 [Oryza sativa]
 gb|ADI87407.1| histone H3 [Oryza sativa]
 gb|EFJ11992.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii]
 gb|EFJ21130.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii]
 emb|CBI19808.3| unnamed protein product [Vitis vinifera]
 gb|ADR30795.1| histone H3.2 [Hevea brasiliensis]
 gb|ADV77197.1| histone H3, partial [Cladophora coelothrix]
 dbj|BAJ86347.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06635.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87590.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AED91617.1| histone H3.3 [Arabidopsis thaliana]
 gb|AEE87155.1| Histone H3.3 [Arabidopsis thaliana]
 gb|AEE87157.1| Histone H3.3 [Arabidopsis thaliana]
 gb|AEE87158.1| histone H3 [Arabidopsis thaliana]
 gb|AEE87159.1| histone H3 [Arabidopsis thaliana]
 dbj|BAL04972.1| histone H3 [Zoysia japonica]
 gb|AES59635.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AET03036.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AEZ52395.1| histone H3 [Wolffia australiana]
 gb|AFC88829.1| histone H23-like protein, partial [Miscanthus sinensis]
 gb|AFK33416.1| unknown [Lotus japonicus]
 gb|AFK38785.1| unknown [Medicago truncatula]
 gb|AFM30053.1| histone H3 [Chimonanthus praecox]
 gb|AFP44115.1| histone H3 [Lycoris longituba]
 gb|AFR23066.1| hypothetical protein [Oryza sativa]
 gb|AFW71934.1| histone H3 isoform 1 [Zea mays]
 gb|AFW71935.1| histone H3 isoform 2 [Zea mays]
 gb|AFW71936.1| histone H3 isoform 3 [Zea mays]
 gb|AFW75390.1| histone H3 [Zea mays]
 gb|AFW86018.1| histone H3 [Zea mays]
 tpg|DAA45651.1| TPA: histone H3 isoform 1 [Zea mays]
 tpg|DAA45652.1| TPA: histone H3 isoform 2 [Zea mays]
 gb|AFZ93649.1| histone H3 [Euphorbia lathyris]
 gb|EMJ08556.1| hypothetical protein PRUPE_ppa013166mg [Prunus persica]
 gb|EMJ25000.1| hypothetical protein PRUPE_ppa013185mg [Prunus persica]
 gb|EMJ27253.1| hypothetical protein PRUPE_ppa013183mg [Prunus persica]
 gb|EOA17620.1| hypothetical protein CARUB_v10005986mg [Capsella rubella]
 gb|EOA17625.1| hypothetical protein CARUB_v10005990mg [Capsella rubella]
 gb|EOA35876.1| hypothetical protein CARUB_v10021126mg [Capsella rubella]
 gb|EOX92023.1| Histone superfamily protein [Theobroma cacao]
 gb|AGN12774.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12775.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12782.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12783.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12800.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12801.1| histone H3 [Leavenworthia alabamica]
 gb|EPS60563.1| hypothetical protein M569_14240 [Genlisea aurea]
 gb|EPS61796.1| hypothetical protein M569_12997 [Genlisea aurea]
 gb|AGS80253.1| histone variant H3.3 [Prunus persica]
 gb|AGS80254.1| histone variant H3.3 [Prunus persica]
 gb|AGT16456.1| histone H3 [Saccharum hybrid cultivar R570]
 gb|AGT17152.1| histone H3 [Saccharum hybrid cultivar R570]
 gb|AGV54183.1| histone H3 [Phaseolus vulgaris]
 gb|AGW30401.1| histone 3 [Oryza sativa]
 gb|ERM95413.1| hypothetical protein AMTR_s00008p00237320 [Amborella trichopoda]
 gb|ERN00651.1| hypothetical protein AMTR_s00225p00023630 [Amborella trichopoda]
 gb|ERN10859.1| hypothetical protein AMTR_s00027p00248560 [Amborella trichopoda]
 gb|ERP58201.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 gb|ERP60690.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 gb|ESQ27575.1| hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum]
 gb|ESQ41050.1| hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum]
 gb|ESR39570.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 gb|ESR39571.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 gb|ESR48364.1| hypothetical protein CICLE_v10002817mg [Citrus clementina]
 gb|ESW32688.1| hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris]
 gb|ESW35661.1| hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris]
 gb|EXC04189.1| Histone [Morus notabilis]
 gb|EYU21874.1| hypothetical protein MIMGU_mgv1a016051mg [Erythranthe guttata]
 gb|EYU30983.1| hypothetical protein MIMGU_mgv1a016034mg [Erythranthe guttata]
 gb|KCW54575.1| hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis]
 gb|KCW54576.1| hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis]
 gb|KCW67925.1| hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis]
 gb|KCW67926.1| hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis]
 gb|AHZ58484.1| histone H3 [Syntrichia caninervis]
 gb|KDO60693.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
 gb|KDO60694.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
 gb|KDO60695.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
 gb|KDO84768.1| hypothetical protein CISIN_1g032662mg [Citrus sinensis]
 gb|KDP41416.1| hypothetical protein JCGZ_15823 [Jatropha curcas]
 gb|KEH31536.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 emb|CDP07429.1| unnamed protein product [Coffea canephora]
 emb|CDP01510.1| unnamed protein product [Coffea canephora]
 emb|CDP01921.1| unnamed protein product [Coffea canephora]
 gb|KFK32443.1| hypothetical protein AALP_AA6G242400 [Arabis alpina]
 gb|KFK41993.1| hypothetical protein AALP_AA2G198300 [Arabis alpina]
 emb|CDY69490.1| BnaCnng63830D [Brassica napus]
 emb|CDY68289.1| BnaAnng26750D [Brassica napus]
 emb|CDY39044.1| BnaA02g17330D [Brassica napus]
 emb|CDY13557.1| BnaC02g23680D [Brassica napus]
 emb|CDX85906.1| BnaC06g22280D [Brassica napus]
 emb|CDX85735.1| BnaA02g00780D [Brassica napus]
 emb|CDX78406.1| BnaA03g03180D [Brassica napus]
 emb|CDX70375.1| BnaC03g04590D [Brassica napus]
 emb|CDX69362.1| BnaC01g00910D [Brassica napus]
 emb|CDX68121.1| BnaA07g21610D [Brassica napus]
 gb|KGN62710.1| hypothetical protein Csa_2G369110 [Cucumis sativus]
 gb|KHG29682.1| Histone H3.3 [Gossypium arboreum]
 gb|KHL91128.1| hypothetical protein QW71_36435 [Paenibacillus sp. IHB B 3415]
 gb|KHN12662.1| Histone H3.3 [Glycine soja]
 gb|KHN31393.1| Histone H3.3 [Glycine soja]
 gb|KHN44355.1| Histone H3.3 [Glycine soja]
 gb|KHN44356.1| Histone H3.3 [Glycine soja]
 gb|KJB17321.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17322.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17323.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17324.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17325.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17326.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17328.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB27557.1| hypothetical protein B456_005G111200 [Gossypium raimondii]
 gb|KJB27558.1| hypothetical protein B456_005G111200 [Gossypium raimondii]
 gb|KJB27559.1| hypothetical protein B456_005G111200 [Gossypium raimondii]
 gb|KJB58990.1| hypothetical protein B456_009G234200 [Gossypium raimondii]
Length=136

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003746445.1| PREDICTED: uncharacterized protein LOC100902368 [Metaseiulus 
occidentalis]
Length=277

 Score =   236 bits (603),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  142  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  201

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  202  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  261

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  262  MPKDIQLARRIRGERA  277



>gb|AAX19362.1| replacement histone H3.3 [Ruditapes philippinarum]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ AL EA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALSEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001967747.1| GF18982 [Drosophila ananassae]
 ref|XP_002060911.1| GK25031 [Drosophila willistoni]
 gb|EDV44974.1| GF18982 [Drosophila ananassae]
 gb|EDW71897.1| GK25031 [Drosophila willistoni]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MP DIQLARRIRGERA
Sbjct  121  MPNDIQLARRIRGERA  136



>gb|AFI61667.1| histone 3 [Ruditapes philippinarum]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIR+LPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRELPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003057560.1| histone H3 [Micromonas pusilla CCMP1545]
 gb|EEH57511.1| histone H3 [Micromonas pusilla CCMP1545]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSHAILALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001505987.1| PREDICTED: histone H3-like [Ornithorhynchus anatinus]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPR QLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRNQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_010830602.1| PREDICTED: histone H3.1 [Bison bison bison]
Length=246

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  20   CNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV  199
              L +Q     V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTV
Sbjct  98   AGLELQQFFGFVVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTV  157

Query  200  ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFED  379
            ALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFED
Sbjct  158  ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFED  217

Query  380  TNLCAIHAKRVTIMPKDIQLARRIRGERA  466
            TNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  218  TNLCAIHAKRVTIMPKDIQLARRIRGERA  246



>ref|XP_003502227.1| PREDICTED: histone H3.1 [Cricetulus griseus]
 gb|EGV94295.1| Histone H3.1 [Cricetulus griseus]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EA L GLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEADLGGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAI29431.1| Zgc:113984 protein [Danio rerio]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRHRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_009623382.1| PREDICTED: histone H3.2-like [Nicotiana tomentosiformis]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARK APATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKLAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LL+RKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLMRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACO08255.1| Histone H3.3 [Oncorhynchus mykiss]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQE++EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQESSEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_782990.1| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKT+LRFQSSA+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTELRFQSSAIMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CEF62250.1| Histone H3 [Strongyloides ratti]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG+KKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGIKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRK PFQRLVRE+AQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKFPFQRLVREVAQDFKTDLRFQSSAVMALQEATEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|NP_001091119.1| histone cluster 1, H3g protein [Xenopus laevis]
 emb|CAA51455.1| histone H3 [Xenopus laevis]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLC IHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACO12509.1| Histone H3 [Lepeophtheirus salmonis]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002602751.1| hypothetical protein BRAFLDRAFT_97692 [Branchiostoma floridae]
 gb|EEN58763.1| hypothetical protein BRAFLDRAFT_97692 [Branchiostoma floridae]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKS PATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSTPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002045486.1| GM19351 [Drosophila sechellia]
 gb|EDW49762.1| GM19351 [Drosophila sechellia]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLC IHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCTIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_610495.1| PREDICTED: histone H3 [Bos taurus]
 ref|XP_002685546.1| PREDICTED: histone H3 [Bos taurus]
 tpg|DAA32518.1| TPA: histone cluster 2, H3c2-like [Bos taurus]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            M RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MTRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>dbj|BAA93627.1| histone H3 [Drosophila erecta]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQT RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTTRKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>sp|Q64400.3|H32_CRILO RecName: Full=Histone H3.2 [Cricetulus longicaudatus]
 emb|CAA56580.1| histone H3.2 [Cricetulus longicaudatus]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTV LREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVTLREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003612851.1| Histone H3 [Medicago truncatula]
Length=223

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/135 (99%), Positives = 135/135 (100%), Gaps = 0/135 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGER  463
            MPKDIQLARRIRGER
Sbjct  121  MPKDIQLARRIRGER  135



>ref|XP_006851804.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda]
 gb|ERN13271.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD+QLARRIRGERA
Sbjct  121  MPKDMQLARRIRGERA  136



>ref|XP_003109235.1| hypothetical protein CRE_08233 [Caenorhabditis remanei]
 ref|XP_003109240.1| hypothetical protein CRE_08027 [Caenorhabditis remanei]
 gb|EFO90600.1| hypothetical protein CRE_08233 [Caenorhabditis remanei]
 gb|EFO90605.1| hypothetical protein CRE_08027 [Caenorhabditis remanei]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3LEL|E Chain E, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3LEL|K Chain K, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3LEL|O Chain O, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 emb|CAD89679.1| Xenopus laevis-like histone H3 [Expression vector pET3-H3]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLV LFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_006222460.1| PREDICTED: histone H3-like [Rattus norvegicus]
 ref|XP_006254041.1| PREDICTED: histone H3-like [Rattus norvegicus]
Length=174

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  39   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  98

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  99   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  158

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  159  MPKDIQLARRIRGERA  174



>ref|XP_011384484.1| PREDICTED: histone H3 [Pteropus vampyrus]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKD QLARRIRGERA
Sbjct  121  MPKDTQLARRIRGERA  136



>ref|XP_002045602.1| GM25125 [Drosophila sechellia]
 gb|EDW53725.1| GM25125 [Drosophila sechellia]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LL RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLTRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_001657153.1| AAEL003685-PA, partial [Aedes aegypti]
 gb|EAT45035.1| AAEL003685-PA, partial [Aedes aegypti]
 gb|KFQ75389.1| Histone H3, partial [Phoenicopterus ruber ruber]
Length=135

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGER  463
            MPKDIQLARRIRGER
Sbjct  121  MPKDIQLARRIRGER  135



>emb|CDW60007.1| Histone H3 [Trichuris trichiura]
 emb|CDW57970.1| Histone H3 [Trichuris trichiura]
 emb|CDW55907.1| Histone H3 [Trichuris trichiura]
 gb|KFD47457.1| hypothetical protein M513_11682 [Trichuris suis]
 gb|KFD60222.1| hypothetical protein M514_11682 [Trichuris suis]
 gb|KHJ40504.1| core histone H2A/H2B/H3/H4 [Trichuris suis]
 gb|KHJ40505.1| core histone H2A/H2B/H3/H4 [Trichuris suis]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002586362.1| hypothetical protein BRAFLDRAFT_108838 [Branchiostoma floridae]
 gb|EEN42373.1| hypothetical protein BRAFLDRAFT_108838 [Branchiostoma floridae]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLR QSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRLQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002045096.1| GM19740 [Drosophila sechellia]
 gb|EDW52844.1| GM19740 [Drosophila sechellia]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGL EDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLLEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|EGT42707.1| hypothetical protein CAEBREN_09337 [Caenorhabditis brenneri]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKS PATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSTPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_008513087.1| PREDICTED: LOW QUALITY PROTEIN: histone H3 [Equus przewalskii]
Length=187

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  47   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ  226
            S + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQ
Sbjct  48   SXLGMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ  107

Query  227  KSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAK  406
            KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  108  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  167

Query  407  RVTIMPKDIQLARRIRGERA  466
            RVTIMPKDIQLARRIRGERA
Sbjct  168  RVTIMPKDIQLARRIRGERA  187



>prf||1202289A histone H3
Length=135

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/135 (99%), Positives = 135/135 (100%), Gaps = 0/135 (0%)
 Frame = +2

Query  62   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL  241
            ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR+YQKSTEL
Sbjct  1    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTEL  60

Query  242  LIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTIM  421
            LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct  61   LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM  120

Query  422  PKDIQLARRIRGERA  466
            PKDIQLARRIRGERA
Sbjct  121  PKDIQLARRIRGERA  135



>ref|XP_001867717.1| histone H3 [Culex quinquefasciatus]
 gb|EDS45503.1| histone H3 [Culex quinquefasciatus]
Length=161

 Score =   232 bits (592),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  26   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  85

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AVAALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  86   LLIRKLPFQRLVREIAQDFKTDLRFQSAAVAALQEASEAYLVGLFEDTNLCAIHAKRVTI  145

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  146  MPKDIQLARRIRGERA  161



>ref|XP_003746420.1| PREDICTED: histone H3-like [Metaseiulus occidentalis]
Length=266

 Score =   236 bits (601),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  44   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKY  223
            L+ + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+Y
Sbjct  126  LTSLAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY  185

Query  224  QKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHA  403
            QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHA
Sbjct  186  QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA  245

Query  404  KRVTIMPKDIQLARRIRGERA  466
            KRVTIMPKDIQLARRIRGERA
Sbjct  246  KRVTIMPKDIQLARRIRGERA  266



>emb|CDQ58715.1| unnamed protein product [Oncorhynchus mykiss]
Length=136

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQ  +EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQATSEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>tpg|DAA55311.1| TPA: histone H3.2 [Zea mays]
Length=245

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  110  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  169

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  170  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI  229

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  230  MPKDIQLARRIRGERA  245



>ref|NP_002098.1| histone H3.3 [Homo sapiens]
 ref|NP_005315.1| histone H3.3 [Homo sapiens]
 ref|NP_032236.1| histone H3.3 [Mus musculus]
 ref|NP_032237.1| histone H3.3 [Mus musculus]
 ref|NP_446437.1| histone H3.3 [Rattus norvegicus]
 ref|NP_511095.1| histone H3.3B, isoform A [Drosophila melanogaster]
 ref|NP_523479.1| histone H3.3A, isoform A [Drosophila melanogaster]
 ref|NP_727314.1| histone H3.3B, isoform B [Drosophila melanogaster]
 ref|NP_788892.1| histone H3.3B, isoform C [Drosophila melanogaster]
 ref|NP_956297.1| H3 histone, family 3C [Danio rerio]
 ref|NP_957395.1| H3 histone, family 3D [Danio rerio]
 ref|NP_989026.1| histone H3.3 [Xenopus (Silurana) tropicalis]
 ref|NP_990627.1| histone H3.3 [Gallus gallus]
 ref|NP_999095.1| histone H3.3 [Sus scrofa]
 ref|NP_001005101.1| H3 histone, family 3A [Xenopus (Silurana) tropicalis]
 ref|NP_001014411.1| histone H3.3 [Bos taurus]
 ref|NP_001017599.1| histone H3.3 [Danio rerio]
 ref|NP_001080065.1| H3 histone, family 3B (H3.3B) [Xenopus laevis]
 ref|NP_001086074.1| histone cluster 2, H3d [Xenopus laevis]
 ref|NP_001085048.1| H3 histone, family 3B (H3.3B) [Xenopus laevis]
 ref|NP_001079375.1| histone H3.3 [Xenopus laevis]
 ref|NP_001091756.1| h3 histone family 3a [Bombyx mori]
 ref|NP_001091902.1| H3 histone, family 3A [Xenopus laevis]
 ref|NP_001092038.1| histone cluster 1, H3a [Pan troglodytes]
 ref|NP_001162389.1| histone H3.1 [Papio anubis]
 ref|NP_001164583.1| histone H3.3 [Oryctolagus cuniculus]
 ref|NP_001184227.1| H3 histone, family 3A member [Taeniopygia guttata]
 ref|NP_001184233.1| H3 histone, family 3A member [Taeniopygia guttata]
 ref|NP_001191424.1| histone 3 [Aplysia californica]
 ref|NP_001229500.1| histone H3.3 [Bos taurus]
 ref|NP_001259374.1| histone H3.3B, isoform E [Drosophila melanogaster]
 ref|NP_001260082.1| histone H3.3A, isoform C [Drosophila melanogaster]
 ref|NP_723056.2| histone H3.3A, isoform D [Drosophila melanogaster]
 ref|NP_001267377.1| histone H3.3 [Pan troglodytes]
 ref|NP_001026653.2| histone H3.2 [Gallus gallus]
 ref|NP_001279370.1| histone H3.3 [Callorhinchus milii]
 ref|XP_321242.1| AGAP001813-PA [Anopheles gambiae str. PEST]
 ref|XP_537232.1| PREDICTED: histone H3.3 isoform 1 [Canis lupus familiaris]
 ref|XP_624499.1| PREDICTED: histone H3.3-like isoform 2 [Apis mellifera]
 ref|XP_858804.1| PREDICTED: histone H3.3 isoform 4 [Canis lupus familiaris]
 ref|XP_001091581.1| PREDICTED: histone H3.3-like isoform 1 [Macaca mulatta]
 ref|XP_001091695.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta]
 ref|XP_001091816.1| PREDICTED: histone H3.3-like isoform 3 [Macaca mulatta]
 ref|XP_001092054.1| PREDICTED: histone H3.3-like isoform 5 [Macaca mulatta]
 ref|XP_001083683.1| PREDICTED: histone H3.3-like [Macaca mulatta]
 ref|XP_001099829.1| PREDICTED: histone H3.3-like isoform 1 [Macaca mulatta]
 ref|XP_001100109.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta]
 ref|XP_001355964.1| GA19158 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001368225.1| PREDICTED: histone H3.3-like [Monodelphis domestica]
 ref|XP_001495110.1| PREDICTED: histone H3.3-like isoform 1 [Equus caballus]
 ref|XP_001608166.1| PREDICTED: histone H3.3 [Nasonia vitripennis]
 ref|XP_001608174.1| PREDICTED: histone H3.3 [Nasonia vitripennis]
 ref|XP_001657554.1| AAEL006158-PA [Aedes aegypti]
 ref|XP_001867328.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001897416.1| Histone H3.3 [Brugia malayi]
 ref|XP_001899461.1| Histone H3.3 [Brugia malayi]
 ref|XP_001949472.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum]
 ref|XP_001962995.1| GF15720 [Drosophila ananassae]
 ref|XP_001966717.1| GF19171 [Drosophila ananassae]
 ref|XP_001968765.1| GG25048 [Drosophila erecta]
 ref|XP_001977366.1| GG19000 [Drosophila erecta]
 ref|XP_001989021.1| GH11489 [Drosophila grimshawi]
 ref|XP_001992391.1| GH24723 [Drosophila grimshawi]
 ref|XP_002001685.1| GI16984 [Drosophila mojavensis]
 ref|XP_002010097.1| GI14879 [Drosophila mojavensis]
 ref|XP_002021511.1| GL26550 [Drosophila persimilis]
 ref|XP_002025032.1| GL26831 [Drosophila persimilis]
 ref|XP_002037914.1| GM18523 [Drosophila sechellia]
 ref|XP_002043987.1| GM13676 [Drosophila sechellia]
 ref|XP_002051859.1| GJ17231 [Drosophila virilis]
 ref|XP_002058949.1| GJ15308 [Drosophila virilis]
 ref|XP_002064500.1| GK23881 [Drosophila willistoni]
 ref|XP_002071382.1| GK25162 [Drosophila willistoni]
 ref|XP_002088675.1| His3.3A [Drosophila yakuba]
 ref|XP_002101068.1| GE17412 [Drosophila yakuba]
 ref|XP_002078203.1| GD23319 [Drosophila simulans]
 ref|XP_002134231.1| GA22698 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002399568.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis]
 ref|XP_002430660.1| histone H3.3 [Pediculus humanus corporis]
 ref|XP_002589240.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae]
 ref|XP_002595623.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae]
 ref|XP_002732447.1| PREDICTED: histone H3.3-like [Saccoglossus kowalevskii]
 ref|XP_002732967.1| PREDICTED: histone H3.3-like [Saccoglossus kowalevskii]
 ref|XP_002717527.1| PREDICTED: histone H3.3 [Oryctolagus cuniculus]
 ref|XP_002664801.1| PREDICTED: histone H3.3 [Danio rerio]
 ref|XP_002728089.1| PREDICTED: histone H3.3 [Rattus norvegicus]
 ref|XP_002745967.1| PREDICTED: histone H3.3 [Callithrix jacchus]
 ref|XP_002748789.1| PREDICTED: histone H3.3 [Callithrix jacchus]
 ref|XP_002760051.1| PREDICTED: histone H3.3 [Callithrix jacchus]
 ref|XP_002760634.1| PREDICTED: histone H3.3 [Callithrix jacchus]
 ref|XP_002800646.1| PREDICTED: histone H3.3-like [Macaca mulatta]
 ref|XP_002800647.1| PREDICTED: histone H3.3-like [Macaca mulatta]
 ref|XP_002801958.1| PREDICTED: histone H3.3-like [Macaca mulatta]
 ref|XP_002801959.1| PREDICTED: histone H3.3-like [Macaca mulatta]
 ref|XP_002802116.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta]
 ref|XP_002809433.1| PREDICTED: histone H3.3 [Pongo abelii]
 ref|XP_002940033.1| PREDICTED: histone H3.3 isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_002919897.1| PREDICTED: histone H3.3 [Ailuropoda melanoleuca]
 ref|XP_002926741.1| PREDICTED: histone H3.3 [Ailuropoda melanoleuca]
 ref|XP_003131242.1| PREDICTED: histone H3.3 [Sus scrofa]
 ref|XP_003140744.1| H3 histone, family 3A [Loa loa]
 ref|XP_003149523.1| histone H3 [Loa loa]
 ref|XP_003211494.1| PREDICTED: histone H3.3 [Meleagris gallopavo]
 ref|XP_003216117.1| PREDICTED: histone H3.3 [Anolis carolinensis]
 ref|XP_003217253.1| PREDICTED: histone H3.3 [Anolis carolinensis]
 ref|XP_003222905.1| PREDICTED: histone H3.3 [Anolis carolinensis]
 ref|XP_003249043.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum]
 ref|XP_003263420.1| PREDICTED: histone H3.3-like isoform 1 [Nomascus leucogenys]
 ref|XP_003275139.1| PREDICTED: histone H3.3 isoform 1 [Nomascus leucogenys]
 ref|XP_003275140.1| PREDICTED: histone H3.3 isoform 2 [Nomascus leucogenys]
 ref|XP_003275143.1| PREDICTED: histone H3.3 isoform 5 [Nomascus leucogenys]
 ref|XP_003275144.1| PREDICTED: histone H3.3 isoform 6 [Nomascus leucogenys]
 ref|XP_003275145.1| PREDICTED: histone H3.3 isoform 7 [Nomascus leucogenys]
 ref|XP_003279138.1| PREDICTED: histone H3.3 isoform 3 [Nomascus leucogenys]
 ref|XP_003308826.1| PREDICTED: histone H3.3 [Pan troglodytes]
 ref|XP_003386893.1| PREDICTED: histone H3.3 isoform X1 [Amphimedon queenslandica]
 ref|XP_003400767.1| PREDICTED: histone H3.3-like [Bombus terrestris]
 ref|XP_003400771.1| PREDICTED: histone H3.3 isoform 1 [Bombus terrestris]
 ref|XP_003400772.1| PREDICTED: histone H3.3 isoform 2 [Bombus terrestris]
 ref|XP_003400773.1| PREDICTED: histone H3.3 isoform 3 [Bombus terrestris]
 ref|XP_003400774.1| PREDICTED: histone H3.3 isoform 4 [Bombus terrestris]
 ref|XP_003400775.1| PREDICTED: histone H3.3 isoform 5 [Bombus terrestris]
 ref|XP_003400776.1| PREDICTED: histone H3.3 isoform 6 [Bombus terrestris]
 ref|XP_003410978.1| PREDICTED: histone H3.3 [Loxodonta africana]
 ref|XP_003417304.1| PREDICTED: histone H3.3 [Loxodonta africana]
 ref|XP_003435952.1| AGAP001813-PB [Anopheles gambiae str. PEST]
 ref|XP_003438823.1| PREDICTED: histone H3.3-like [Oreochromis niloticus]
 ref|XP_003449844.1| PREDICTED: histone H3.3-like isoform X1 [Oreochromis niloticus]
 ref|XP_003461470.1| PREDICTED: histone H3.3 isoform X1 [Cavia porcellus]
 ref|XP_003462414.1| PREDICTED: histone H3.3 [Cavia porcellus]
 ref|XP_003485151.1| PREDICTED: histone H3.3-like [Bombus impatiens]
 ref|XP_003485156.1| PREDICTED: histone H3.3-like isoform 1 [Bombus impatiens]
 ref|XP_003485157.1| PREDICTED: histone H3.3-like isoform 2 [Bombus impatiens]
 ref|XP_003643522.1| PREDICTED: histone H3.3-like isoform X1 [Gallus gallus]
 ref|XP_003694444.1| PREDICTED: histone H3.3-like isoform 1 [Apis florea]
 ref|XP_003694445.1| PREDICTED: histone H3.3-like isoform 2 [Apis florea]
 ref|XP_003694446.1| PREDICTED: histone H3.3-like isoform 1 [Apis florea]
 ref|XP_003694447.1| PREDICTED: histone H3.3-like isoform 2 [Apis florea]
 ref|XP_003694448.1| PREDICTED: histone H3.3-like isoform 3 [Apis florea]
 ref|XP_003708096.1| PREDICTED: histone H3.3-like [Megachile rotundata]
 ref|XP_003708097.1| PREDICTED: histone H3.3-like [Megachile rotundata]
 ref|XP_003739008.1| PREDICTED: histone H3.3-like [Metaseiulus occidentalis]
 ref|XP_003748371.1| PREDICTED: histone H3.3-like [Metaseiulus occidentalis]
 ref|XP_003752732.1| PREDICTED: histone H3.3 [Rattus norvegicus]
 ref|XP_003767801.1| PREDICTED: histone H3.3-like [Sarcophilus harrisii]
 ref|XP_003786173.1| PREDICTED: histone H3.3-like [Otolemur garnettii]
 ref|XP_003791041.1| PREDICTED: histone H3.3-like [Otolemur garnettii]
 ref|XP_003813324.1| PREDICTED: histone H3.3 [Pan paniscus]
 ref|XP_003814967.1| PREDICTED: histone H3.3 [Pan paniscus]
 ref|XP_003893086.1| PREDICTED: histone H3.3 [Papio anubis]
 ref|XP_003893531.1| PREDICTED: histone H3.3 [Papio anubis]
 ref|XP_003913493.1| PREDICTED: histone H3.3 [Papio anubis]
 ref|XP_003930341.1| PREDICTED: histone H3.3 [Saimiri boliviensis boliviensis]
 ref|XP_003931776.1| PREDICTED: histone H3.3 [Saimiri boliviensis boliviensis]
 ref|XP_003961353.1| PREDICTED: histone H3.3-like [Takifugu rubripes]
 ref|XP_003970774.1| PREDICTED: histone H3.3-like [Takifugu rubripes]
 ref|XP_003977419.1| PREDICTED: histone H3.3-like [Takifugu rubripes]
 ref|XP_004013172.1| PREDICTED: histone H3.3 [Ovis aries]
 ref|XP_004013682.1| PREDICTED: histone H3.3 [Ovis aries]
 ref|XP_004028534.1| PREDICTED: histone H3.3 isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004028535.1| PREDICTED: histone H3.3 isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004028536.1| PREDICTED: histone H3.3 isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004028537.1| PREDICTED: histone H3.3 isoform 4 [Gorilla gorilla gorilla]
 ref|XP_004028538.1| PREDICTED: histone H3.3 isoform 5 [Gorilla gorilla gorilla]
 ref|XP_004028539.1| PREDICTED: histone H3.3 isoform 6 [Gorilla gorilla gorilla]
 ref|XP_004028540.1| PREDICTED: histone H3.3 isoform 7 [Gorilla gorilla gorilla]
 ref|XP_004028541.1| PREDICTED: histone H3.3 isoform 8 [Gorilla gorilla gorilla]
 ref|XP_004041067.1| PREDICTED: histone H3.3 [Gorilla gorilla gorilla]
 ref|XP_004080398.1| PREDICTED: histone H3.3 [Oryzias latipes]
 ref|XP_004084106.1| PREDICTED: histone H3.3 [Oryzias latipes]
 ref|XP_004088086.1| PREDICTED: histone H3.3 [Nomascus leucogenys]
 ref|XP_004088836.1| PREDICTED: histone H3.3-like isoform 2 [Nomascus leucogenys]
 ref|XP_004088837.1| PREDICTED: histone H3.3-like isoform 3 [Nomascus leucogenys]
 ref|XP_004271029.1| PREDICTED: histone H3.3 [Orcinus orca]
 ref|XP_004275531.1| PREDICTED: histone H3.3 isoform 1 [Orcinus orca]
 ref|XP_004275532.1| PREDICTED: histone H3.3 isoform 2 [Orcinus orca]
 ref|XP_004310445.1| PREDICTED: histone H3.3 [Tursiops truncatus]
 ref|XP_004312140.1| PREDICTED: histone H3.3-like [Tursiops truncatus]
 ref|XP_004318519.1| PREDICTED: histone H3.3-like [Tursiops truncatus]
 ref|XP_004374202.1| PREDICTED: histone H3.3 [Trichechus manatus latirostris]
 ref|XP_004375943.1| PREDICTED: histone H3.3 [Trichechus manatus latirostris]
 ref|XP_004394384.1| PREDICTED: histone H3.3 [Odobenus rosmarus divergens]
 ref|XP_004432825.1| PREDICTED: histone H3.3 isoform 1 [Ceratotherium simum simum]
 ref|XP_004432826.1| PREDICTED: histone H3.3 isoform 2 [Ceratotherium simum simum]
 ref|XP_004439612.1| PREDICTED: histone H3.3 [Ceratotherium simum simum]
 ref|XP_004450908.1| PREDICTED: histone H3.3 [Dasypus novemcinctus]
 ref|XP_004476609.1| PREDICTED: histone H3.3-like isoform 1 [Dasypus novemcinctus]
 ref|XP_004476610.1| PREDICTED: histone H3.3-like isoform 2 [Dasypus novemcinctus]
 ref|XP_004557547.1| PREDICTED: histone H3.3-like [Maylandia zebra]
 ref|XP_004562520.1| PREDICTED: histone H3.3-like [Maylandia zebra]
 ref|XP_004567486.1| PREDICTED: histone H3.3-like [Maylandia zebra]
 ref|XP_004578655.1| PREDICTED: histone H3.3 [Ochotona princeps]
 ref|XP_004592960.1| PREDICTED: histone H3.3 [Ochotona princeps]
 ref|XP_004605482.1| PREDICTED: histone H3.3 [Sorex araneus]
 ref|XP_004700004.1| PREDICTED: histone H3.3 [Echinops telfairi]
 ref|XP_004641232.1| PREDICTED: histone H3.3-like isoform X1 [Octodon degus]
 ref|XP_004641233.1| PREDICTED: histone H3.3-like isoform X2 [Octodon degus]
 ref|XP_004646239.1| PREDICTED: histone H3.3-like [Octodon degus]
 ref|XP_004691090.1| PREDICTED: histone H3.3 [Condylura cristata]
 ref|XP_004693560.1| PREDICTED: histone H3.3 [Condylura cristata]
 ref|XP_004748948.1| PREDICTED: histone H3.3 [Mustela putorius furo]
 ref|XP_004761972.1| PREDICTED: histone H3.3 [Mustela putorius furo]
 ref|XP_004805444.1| PREDICTED: histone H3.3 [Mustela putorius furo]
 ref|XP_004889977.1| PREDICTED: histone H3.3-like [Heterocephalus glaber]
 ref|XP_004918516.1| PREDICTED: histone H3.3 isoform X2 [Xenopus (Silurana) tropicalis]
 ref|XP_004918517.1| PREDICTED: histone H3.3 isoform X3 [Xenopus (Silurana) tropicalis]
 ref|XP_004896925.1| PREDICTED: histone H3.3 isoform X1 [Heterocephalus glaber]
 ref|XP_004896926.1| PREDICTED: histone H3.3 isoform X2 [Heterocephalus glaber]
 ref|XP_004896927.1| PREDICTED: histone H3.3 isoform X3 [Heterocephalus glaber]
 ref|XP_004860762.1| PREDICTED: histone H3.3 isoform X1 [Heterocephalus glaber]
 ref|XP_004860763.1| PREDICTED: histone H3.3 isoform X2 [Heterocephalus glaber]
 ref|XP_004860764.1| PREDICTED: histone H3.3 isoform X3 [Heterocephalus glaber]
 ref|XP_004860765.1| PREDICTED: histone H3.3 isoform X4 [Heterocephalus glaber]
 ref|XP_004999666.1| PREDICTED: histone H3.3 isoform X2 [Cavia porcellus]
 ref|XP_004999667.1| PREDICTED: histone H3.3 isoform X3 [Cavia porcellus]
 ref|XP_005010211.1| PREDICTED: histone H3.3 [Anas platyrhynchos]
 ref|XP_005069967.1| PREDICTED: histone H3.3 [Mesocricetus auratus]
 ref|XP_005078192.1| PREDICTED: histone H3.3 [Mesocricetus auratus]
 ref|XP_005056049.1| PREDICTED: histone H3.3 [Ficedula albicollis]
 ref|XP_005141451.1| PREDICTED: histone H3.3 [Melopsittacus undulatus]
 ref|XP_005243673.1| PREDICTED: histone H3.3 [Falco peregrinus]
 ref|XP_005289629.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_005289630.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_005297556.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_005349017.1| PREDICTED: histone H3.3-like [Microtus ochrogaster]
 ref|XP_005350806.1| PREDICTED: histone H3.3-like [Microtus ochrogaster]
 ref|XP_005332630.1| PREDICTED: histone H3.3 [Ictidomys tridecemlineatus]
 ref|XP_005404549.1| PREDICTED: histone H3.3-like [Chinchilla lanigera]
 ref|XP_005407537.1| PREDICTED: histone H3.3-like isoform X1 [Chinchilla lanigera]
 ref|XP_005448024.1| PREDICTED: histone H3.3-like [Oreochromis niloticus]
 ref|XP_005454631.1| PREDICTED: histone H3.3-like isoform X2 [Oreochromis niloticus]
 ref|XP_005523348.1| PREDICTED: histone H3.3-like isoform X1 [Pseudopodoces humilis]
 ref|XP_005526825.1| PREDICTED: histone H3.3-like [Pseudopodoces humilis]
 ref|XP_005541064.1| PREDICTED: histone H3.3-like [Macaca fascicularis]
 ref|XP_005585038.1| PREDICTED: histone H3.3 [Macaca fascicularis]
 ref|XP_005608028.1| PREDICTED: histone H3.3-like [Equus caballus]
 ref|XP_005721939.1| PREDICTED: histone H3.3-like isoform X1 [Pundamilia nyererei]
 ref|XP_005721940.1| PREDICTED: histone H3.3-like isoform X2 [Pundamilia nyererei]
 ref|XP_005740175.1| PREDICTED: histone H3.3-like [Pundamilia nyererei]
 ref|XP_005690587.1| PREDICTED: histone H3.3-like [Capra hircus]
 ref|XP_005751764.1| PREDICTED: histone H3.3-like [Pundamilia nyererei]
 ref|XP_005755275.1| PREDICTED: histone H3.3-like [Pundamilia nyererei]
 ref|XP_005803299.1| PREDICTED: histone H3.3-like [Xiphophorus maculatus]
 ref|XP_005804582.1| PREDICTED: histone H3.3-like isoform X1 [Xiphophorus maculatus]
 ref|XP_005804583.1| PREDICTED: histone H3.3-like isoform X2 [Xiphophorus maculatus]
 ref|XP_005804584.1| PREDICTED: histone H3.3-like [Xiphophorus maculatus]
 ref|XP_005809674.1| PREDICTED: histone H3.3-like [Xiphophorus maculatus]
 ref|XP_005815160.1| PREDICTED: histone H3.3-like [Xiphophorus maculatus]
 ref|XP_005923872.1| PREDICTED: histone H3.3-like isoform X1 [Haplochromis burtoni]
 ref|XP_005923873.1| PREDICTED: histone H3.3-like isoform X2 [Haplochromis burtoni]
 ref|XP_005926645.1| PREDICTED: histone H3.3-like [Haplochromis burtoni]
 ref|XP_005926646.1| PREDICTED: histone H3.3-like [Haplochromis burtoni]
 ref|XP_005939565.1| PREDICTED: histone H3.3-like [Haplochromis burtoni]
 ref|XP_005947848.1| PREDICTED: histone H3.3-like isoform X1 [Haplochromis burtoni]
 ref|XP_005947849.1| PREDICTED: histone H3.3-like isoform X2 [Haplochromis burtoni]
 ref|XP_005904534.1| PREDICTED: histone H3.3-like [Bos mutus]
 ref|XP_005906357.1| PREDICTED: histone H3.3-like [Bos mutus]
 ref|XP_005959145.1| PREDICTED: histone H3.3-like [Pantholops hodgsonii]
 ref|XP_005987867.1| PREDICTED: histone H3.3-like [Latimeria chalumnae]
 ref|XP_006012509.1| PREDICTED: histone H3.3-like [Latimeria chalumnae]
 ref|XP_006013918.1| PREDICTED: histone H3.3-like isoform X1 [Latimeria chalumnae]
 ref|XP_006013919.1| PREDICTED: histone H3.3-like isoform X2 [Latimeria chalumnae]
 ref|XP_006013920.1| PREDICTED: histone H3.3-like isoform X3 [Latimeria chalumnae]
 ref|XP_006016625.1| PREDICTED: histone H3.3-like [Alligator sinensis]
 ref|XP_006018341.1| PREDICTED: histone H3.3-like [Alligator sinensis]
 ref|XP_006037004.1| PREDICTED: histone H3.3-like [Alligator sinensis]
 ref|XP_005190680.1| PREDICTED: histone H3.3 [Musca domestica]
 ref|XP_006118112.1| PREDICTED: histone H3.3-like [Pelodiscus sinensis]
 ref|XP_006136503.1| PREDICTED: histone H3.3-like [Pelodiscus sinensis]
 ref|XP_006176524.1| PREDICTED: histone H3.3-like [Camelus ferus]
 ref|XP_006188183.1| PREDICTED: histone H3.3-like [Camelus ferus]
 ref|XP_006198891.1| PREDICTED: histone H3.3-like [Vicugna pacos]
 ref|XP_006199457.1| PREDICTED: histone H3.3-like [Vicugna pacos]
 ref|XP_006220073.1| PREDICTED: histone H3.3-like [Vicugna pacos]
 ref|XP_006145860.1| PREDICTED: histone H3.3-like isoform X1 [Tupaia chinensis]
 ref|XP_006145861.1| PREDICTED: histone H3.3-like isoform X2 [Tupaia chinensis]
 ref|XP_006157313.1| PREDICTED: histone H3.3-like [Tupaia chinensis]
 ref|XP_006265010.1| PREDICTED: histone H3.3-like [Alligator mississippiensis]
 ref|XP_006268823.1| PREDICTED: histone H3.3-like [Alligator mississippiensis]
 ref|XP_006269304.1| PREDICTED: histone H3.3-like [Alligator mississippiensis]
 ref|XP_006532311.1| PREDICTED: histone H3.3 isoform X1 [Mus musculus]
 ref|XP_006563134.1| PREDICTED: histone H3.3-like isoform X1 [Apis mellifera]
 ref|XP_006563135.1| PREDICTED: histone H3.3-like isoform X2 [Apis mellifera]
 ref|XP_006616689.1| PREDICTED: histone H3.3-like isoform X1 [Apis dorsata]
 ref|XP_006616690.1| PREDICTED: histone H3.3-like isoform X2 [Apis dorsata]
 ref|XP_006616691.1| PREDICTED: histone H3.3-like [Apis dorsata]
 ref|XP_006627520.1| PREDICTED: histone H3.3-like [Lepisosteus oculatus]
 ref|XP_006635166.1| PREDICTED: histone H3.3-like [Lepisosteus oculatus]
 ref|XP_006637126.1| PREDICTED: histone H3.3-like [Lepisosteus oculatus]
 ref|XP_006797026.1| PREDICTED: histone H3.3-like [Neolamprologus brichardi]
 ref|XP_006801113.1| PREDICTED: histone H3.3-like [Neolamprologus brichardi]
 ref|XP_006808672.1| PREDICTED: histone H3.3-like [Neolamprologus brichardi]
 ref|XP_006748487.1| PREDICTED: histone H3.3-like [Leptonychotes weddellii]
 ref|XP_006750109.1| PREDICTED: histone H3.3-like isoform X1 [Leptonychotes weddellii]
 ref|XP_006886266.1| PREDICTED: histone H3.3-like [Elephantulus edwardii]
 ref|XP_006897815.1| PREDICTED: histone H3.3-like [Elephantulus edwardii]
 ref|XP_006869633.1| PREDICTED: histone H3.3-like [Chrysochloris asiatica]
 ref|XP_006912277.1| PREDICTED: histone H3.3-like [Pteropus alecto]
 ref|XP_006974248.1| PREDICTED: histone H3.3-like [Peromyscus maniculatus bairdii]
 ref|XP_006993705.1| PREDICTED: histone H3.3-like [Peromyscus maniculatus bairdii]
 ref|XP_007071767.1| PREDICTED: histone H3.3-like isoform X1 [Chelonia mydas]
 ref|XP_007072612.1| PREDICTED: histone H3.3-like [Chelonia mydas]
 ref|XP_007067371.1| PREDICTED: histone H3.3-like [Chelonia mydas]
 ref|XP_007099821.1| PREDICTED: histone H3.3-like [Physeter catodon]
 ref|XP_007128127.1| PREDICTED: histone H3.3-like [Physeter catodon]
 ref|XP_006045331.1| PREDICTED: histone H3.3-like [Bubalus bubalis]
 ref|XP_006046136.1| PREDICTED: histone H3.3-like isoform X1 [Bubalus bubalis]
 ref|XP_006046137.1| PREDICTED: histone H3.3-like isoform X2 [Bubalus bubalis]
 ref|XP_007167261.1| PREDICTED: histone H3.3-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007185762.1| PREDICTED: histone H3.3-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007240472.1| PREDICTED: histone H3.3-like isoform X1 [Astyanax mexicanus]
 ref|XP_007240473.1| PREDICTED: histone H3.3-like isoform X2 [Astyanax mexicanus]
 ref|XP_007240687.1| PREDICTED: histone H3.3-like isoform X1 [Astyanax mexicanus]
 ref|XP_007240688.1| PREDICTED: histone H3.3-like isoform X2 [Astyanax mexicanus]
 ref|XP_007256886.1| PREDICTED: histone H3.3-like [Astyanax mexicanus]
 ref|XP_007261066.1| PREDICTED: histone H3.3-like [Astyanax mexicanus]
 ref|XP_007427042.1| PREDICTED: histone H3.3-like [Python bivittatus]
 ref|XP_007436454.1| PREDICTED: histone H3.3-like isoform X1 [Python bivittatus]
 ref|XP_007436455.1| PREDICTED: histone H3.3-like isoform X2 [Python bivittatus]
 ref|XP_007454397.1| PREDICTED: histone H3.3-like isoform X1 [Lipotes vexillifer]
 ref|XP_007454398.1| PREDICTED: histone H3.3-like isoform X2 [Lipotes vexillifer]
 ref|XP_007454524.1| PREDICTED: histone H3.3-like [Lipotes vexillifer]
 ref|XP_007561070.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007556523.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007576700.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007576704.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007577897.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007577898.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007577900.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007577901.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007577902.1| PREDICTED: histone H3.3 [Poecilia formosa]
 ref|XP_007534516.1| PREDICTED: histone H3.3 [Erinaceus europaeus]
 ref|XP_007536787.1| PREDICTED: histone H3.3 [Erinaceus europaeus]
 ref|XP_007670587.1| PREDICTED: histone H3.3 [Ornithorhynchus anatinus]
 ref|XP_007645983.1| PREDICTED: histone H3.3 isoform X1 [Cricetulus griseus]
 ref|XP_007626413.1| PREDICTED: histone H3.3 isoform X2 [Cricetulus griseus]
 ref|XP_007886957.1| PREDICTED: histone H3.3 [Callorhinchus milii]
 ref|XP_007896479.1| PREDICTED: histone H3.3 [Callorhinchus milii]
 ref|XP_007884068.1| PREDICTED: histone H3.3 [Callorhinchus milii]
 ref|XP_007935166.1| PREDICTED: histone H3.3 [Orycteropus afer afer]
 ref|XP_008009919.1| PREDICTED: histone H3.3 [Chlorocebus sabaeus]
 ref|XP_008047273.1| PREDICTED: histone H3.3 [Tarsius syrichta]
 ref|XP_008047274.1| PREDICTED: histone H3.3 [Tarsius syrichta]
 ref|XP_008048990.1| PREDICTED: histone H3.3 [Tarsius syrichta]
 ref|XP_008186887.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum]
 ref|XP_008188188.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum]
 ref|XP_008189717.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum]
 ref|XP_008153272.1| PREDICTED: histone H3.3 [Eptesicus fuscus]
 ref|XP_008173273.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_008173274.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_008173275.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_008173276.1| PREDICTED: histone H3.3 [Chrysemys picta bellii]
 ref|XP_008197392.1| PREDICTED: histone H3.3 [Tribolium castaneum]
 ref|XP_008203040.1| PREDICTED: histone H3.3 [Nasonia vitripennis]
 ref|XP_008266274.1| PREDICTED: histone H3.3 isoform X1 [Oryctolagus cuniculus]
 ref|XP_008280859.1| PREDICTED: histone H3.3 [Stegastes partitus]
 ref|XP_008282544.1| PREDICTED: histone H3.3 [Stegastes partitus]
 ref|XP_008301911.1| PREDICTED: histone H3.3 [Stegastes partitus]
 ref|XP_008312429.1| PREDICTED: histone H3.3 [Cynoglossus semilaevis]
 ref|XP_008312935.1| PREDICTED: histone H3.3 [Cynoglossus semilaevis]
 ref|XP_008330716.1| PREDICTED: histone H3.3 [Cynoglossus semilaevis]
 ref|XP_008424338.1| PREDICTED: histone H3.3 [Poecilia reticulata]
 ref|XP_008424339.1| PREDICTED: histone H3.3 [Poecilia reticulata]
 ref|XP_008426585.1| PREDICTED: histone H3.3 [Poecilia reticulata]
 ref|XP_008434558.1| PREDICTED: histone H3.3 [Poecilia reticulata]
 ref|XP_008436003.1| PREDICTED: histone H3.3 [Poecilia reticulata]
 ref|XP_008436004.1| PREDICTED: histone H3.3 [Poecilia reticulata]
 ref|XP_008481972.1| PREDICTED: histone H3.3 [Diaphorina citri]
 ref|XP_008471067.1| PREDICTED: histone H3.3 [Diaphorina citri]
 ref|XP_008535873.1| PREDICTED: histone H3.3 [Equus przewalskii]
 ref|XP_008543017.1| PREDICTED: histone H3.3 [Equus przewalskii]
 ref|XP_008552508.1| PREDICTED: histone H3.3 [Microplitis demolitor]
 ref|XP_008552520.1| PREDICTED: histone H3.3 [Microplitis demolitor]
 ref|XP_008564309.1| PREDICTED: histone H3.3 [Galeopterus variegatus]
 ref|XP_008579016.1| PREDICTED: histone H3.3 [Galeopterus variegatus]
 ref|XP_008579017.1| PREDICTED: histone H3.3 [Galeopterus variegatus]
 ref|XP_008693497.1| PREDICTED: histone H3.3 [Ursus maritimus]
 ref|XP_008691998.1| PREDICTED: histone H3.3 [Ursus maritimus]
 ref|XP_008829603.1| PREDICTED: histone H3.3 [Nannospalax galili]
 ref|XP_008829604.1| PREDICTED: histone H3.3 [Nannospalax galili]
 ref|XP_009004243.1| PREDICTED: histone H3.3 [Callithrix jacchus]
 ref|XP_008964082.1| PREDICTED: histone H3.3 [Pan paniscus]
 ref|XP_009014580.1| hypothetical protein HELRODRAFT_185455 [Helobdella robusta]
 ref|XP_009064576.1| hypothetical protein LOTGIDRAFT_150994 [Lottia gigantea]
 ref|XP_009092019.1| PREDICTED: histone H3.3 isoform X1 [Serinus canaria]
 ref|XP_009194231.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3-like [Papio anubis]
 ref|XP_009290278.1| PREDICTED: histone H3.3 [Danio rerio]
 ref|XP_009474888.1| PREDICTED: histone H3.3 [Nipponia nippon]
 ref|XP_009566744.1| PREDICTED: histone H3.3 [Cuculus canorus]
 ref|XP_009636129.1| PREDICTED: histone H3.3 [Egretta garzetta]
 ref|XP_009861241.1| PREDICTED: histone H3.3 [Ciona intestinalis]
 ref|XP_010000944.1| PREDICTED: histone H3.3 [Chaetura pelagica]
 ref|XP_010217642.1| PREDICTED: histone H3.3 [Tinamus guttatus]
 ref|XP_010380324.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010360696.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010371199.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010376533.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010379416.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010385878.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010352126.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010356368.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana]
 ref|XP_010565428.1| PREDICTED: histone H3.3 [Haliaeetus leucocephalus]
 ref|XP_010565429.1| PREDICTED: histone H3.3 [Haliaeetus leucocephalus]
 ref|XP_010576024.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576025.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576026.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576027.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576028.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576029.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576030.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576032.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010576033.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010577635.1| PREDICTED: histone H3.3 [Haliaeetus leucocephalus]
 ref|XP_010616712.1| PREDICTED: histone H3.3 [Fukomys damarensis]
 ref|XP_010616714.1| PREDICTED: histone H3.3 [Fukomys damarensis]
 ref|XP_010616715.1| PREDICTED: histone H3.3 [Fukomys damarensis]
 ref|XP_010595256.1| PREDICTED: histone H3.3 [Loxodonta africana]
 ref|XP_010734542.1| PREDICTED: histone H3.3 [Larimichthys crocea]
 ref|XP_010739542.1| PREDICTED: histone H3.3 isoform X1 [Larimichthys crocea]
 ref|XP_010739543.1| PREDICTED: histone H3.3 isoform X2 [Larimichthys crocea]
 ref|XP_010739544.1| PREDICTED: histone H3.3 [Larimichthys crocea]
 ref|XP_010768027.1| PREDICTED: histone H3.3 [Notothenia coriiceps]
 ref|XP_010770452.1| PREDICTED: histone H3.3 [Notothenia coriiceps]
 ref|XP_010776070.1| PREDICTED: histone H3.3 [Notothenia coriiceps]
 ref|XP_010869098.1| PREDICTED: histone H3.3 [Esox lucius]
 ref|XP_010851172.1| PREDICTED: histone H3.3 [Bison bison bison]
 ref|XP_010887152.1| PREDICTED: histone H3.3 [Esox lucius]
 ref|XP_010890196.1| PREDICTED: histone H3.3 [Esox lucius]
 ref|XP_010896955.1| PREDICTED: histone H3.3 [Esox lucius]
 ref|XP_010896956.1| PREDICTED: histone H3.3 [Esox lucius]
 ref|XP_010972141.1| PREDICTED: histone H3.3 [Camelus bactrianus]
 ref|XP_010949055.1| PREDICTED: histone H3.3 [Camelus bactrianus]
 ref|XP_010990793.1| PREDICTED: histone H3.3 [Camelus dromedarius]
 ref|XP_010996709.1| PREDICTED: histone H3.3 [Camelus dromedarius]
 ref|XP_011069182.1| PREDICTED: histone H3.3 [Acromyrmex echinatior]
 ref|XP_011069183.1| PREDICTED: histone H3.3 [Acromyrmex echinatior]
 ref|XP_011069184.1| PREDICTED: histone H3.3 [Acromyrmex echinatior]
 ref|XP_011069185.1| PREDICTED: histone H3.3 [Acromyrmex echinatior]
 ref|XP_011141556.1| PREDICTED: histone H3.3 [Harpegnathos saltator]
 ref|XP_011141557.1| PREDICTED: histone H3.3 [Harpegnathos saltator]
 ref|XP_011141558.1| PREDICTED: histone H3.3 [Harpegnathos saltator]
 ref|XP_011158466.1| PREDICTED: histone H3.3 [Solenopsis invicta]
 ref|XP_011158467.1| PREDICTED: histone H3.3 [Solenopsis invicta]
 ref|XP_011158469.1| PREDICTED: histone H3.3 [Solenopsis invicta]
 ref|XP_011158470.1| PREDICTED: histone H3.3 [Solenopsis invicta]
 ref|XP_011158471.1| PREDICTED: histone H3.3 [Solenopsis invicta]
 ref|XP_011183434.1| PREDICTED: histone H3.3 [Bactrocera cucurbitae]
 ref|XP_011206404.1| PREDICTED: histone H3.3 [Bactrocera dorsalis]
 ref|XP_011265432.1| PREDICTED: histone H3.3 [Camponotus floridanus]
 ref|XP_003997209.3| PREDICTED: histone H3.3 [Felis catus]
 ref|XP_011295436.1| PREDICTED: histone H3.3 [Musca domestica]
 ref|XP_011298455.1| PREDICTED: histone H3.3 [Fopius arisanus]
 ref|XP_011298462.1| PREDICTED: histone H3.3 isoform X2 [Fopius arisanus]
 ref|XP_011346345.1| PREDICTED: histone H3.3 [Cerapachys biroi]
 ref|XP_011346346.1| PREDICTED: histone H3.3 [Cerapachys biroi]
 ref|XP_011346347.1| PREDICTED: histone H3.3 [Cerapachys biroi]
 ref|XP_011359139.1| PREDICTED: histone H3.3 [Pteropus vampyrus]
 ref|XP_011360255.1| PREDICTED: histone H3.3 [Pteropus vampyrus]
 ref|XP_011432232.1| PREDICTED: histone H3.3 [Crassostrea gigas]
 ref|XP_011441838.1| PREDICTED: histone H3.3 [Crassostrea gigas]
 ref|XP_011441839.1| PREDICTED: histone H3.3 [Crassostrea gigas]
 ref|XP_011441840.1| PREDICTED: histone H3.3 [Crassostrea gigas]
 ref|XP_011420805.1| PREDICTED: histone H3.3 [Crassostrea gigas]
 ref|XP_011480935.1| PREDICTED: histone H3.3 [Oryzias latipes]
 ref|XP_011480936.1| PREDICTED: histone H3.3 [Oryzias latipes]
 ref|XP_011503189.1| PREDICTED: histone H3.3 [Ceratosolen solmsi marchali]
 ref|XP_011503190.1| PREDICTED: histone H3.3 [Ceratosolen solmsi marchali]
 sp|P84245.2|H33_RAT RecName: Full=Histone H3.3 [Rattus norvegicus]
 sp|P84243.2|H33_HUMAN RecName: Full=Histone H3.3 [Homo sapiens]
 sp|P84244.2|H33_MOUSE RecName: Full=Histone H3.3 [Mus musculus]
 sp|P84246.2|H33_RABIT RecName: Full=Histone H3.3 [Oryctolagus cuniculus]
 sp|P84247.2|H33_CHICK RecName: Full=Histone H3.3; AltName: Full=H3.3A/B; AltName: Full=Histone 
H3 class II [Gallus gallus]
 sp|P84248.2|H33_SPISO RecName: Full=Histone H3.3 [Spisula solidissima]
 sp|P84249.2|H33_DROME RecName: Full=Histone H3.3; AltName: Full=H3.3Q; AltName: Full=H3.A/B 
[Drosophila melanogaster]
 sp|P84250.2|H33_DROHY RecName: Full=Histone H3.3; AltName: Full=H3.A/B [Drosophila 
hydei]
 sp|Q71LE2.3|H33_PIG RecName: Full=Histone H3.3 [Sus scrofa]
 sp|Q5E9F8.3|H33_BOVIN RecName: Full=Histone H3.3 [Bos taurus]
 sp|Q6P823.3|H33_XENTR RecName: Full=Histone H3.3 [Xenopus (Silurana) tropicalis]
 sp|Q6PI20.3|H33_DANRE RecName: Full=Histone H3.3 [Danio rerio]
 sp|Q6PI79.3|H33_XENLA RecName: Full=Histone H3.3 [Xenopus laevis]
 pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-h4 Heterodimer 
In Complex With Its Chaperone Daxx
 gb|AAG17271.1|AF218029_1 unknown [Homo sapiens]
 gb|AAL76273.1|AF469469_1 histone H3.3A [Sus scrofa]
 emb|CAA36179.1| unnamed protein product [Oryctolagus cuniculus]
 emb|CAA37819.1| Histone H3.3Q [Drosophila melanogaster]
 emb|CAA31940.1| unnamed protein product [Mus musculus]
 emb|CAA68458.1| unnamed protein product [Gallus gallus]
 gb|AAA29965.1| histone H3 [Spisula solidissima]
 gb|AAA48794.1| histone 3.3 [Gallus gallus]
 gb|AAA52653.1| H3.3 histone [Homo sapiens]
 gb|AAA52654.1| H3.3 histone [Homo sapiens]
 emb|CAA52035.1| histon H3 [Rattus norvegicus]
 emb|CAA88778.1| histone H3.3 [Homo sapiens]
 emb|CAA57078.1| histone H3.3 [Drosophila hydei]
 emb|CAA57081.1| histone H3.3 [Drosophila hydei]
 emb|CAA57080.1| histone H3.3 [Drosophila melanogaster]
 emb|CAA57077.1| histone H3.3 [Drosophila melanogaster]
 emb|CAA57712.1| histone H3.3A variant [Drosophila melanogaster]
 emb|CAB06625.1| histone H3.3A [Mus musculus]
 gb|AAF46452.1| histone H3.3B, isoform A [Drosophila melanogaster]
 gb|AAF52213.1| histone H3.3A, isoform A [Drosophila melanogaster]
 gb|AAH01124.1| H3 histone, family 3B (H3.3B) [Homo sapiens]
 gb|AAH02268.1| H3 histone, family 3A [Mus musculus]
 dbj|BAB22464.1| unnamed protein product [Mus musculus]
 gb|AAH06497.1| H3 histone, family 3B (H3.3B) [Homo sapiens]
 gb|AAH12687.1| H3 histone, family 3A [Mus musculus]
 gb|AAH12813.1| H3 histone, family 3B (H3.3B) [Homo sapiens]
 gb|AAK61362.1| histone 3A [Anopheles gambiae]
 gb|AAH17558.1| H3 histone, family 3B (H3.3B) [Homo sapiens]
 gb|AAL48679.1| RE14004p [Drosophila melanogaster]
 gb|AAH29405.1| H3 histone, family 3A [Homo sapiens]
 gb|AAM48354.1| LD17717p [Drosophila melanogaster]
 gb|AAM50283.1| RE21618p [Drosophila melanogaster]
 gb|AAN09245.1| histone H3.3B, isoform B [Drosophila melanogaster]
 gb|AAH37730.1| H3 histone, family 3B [Mus musculus]
 gb|AAH38989.1| H3 histone, family 3A [Homo sapiens]
 dbj|BAC29895.1| unnamed protein product [Mus musculus]
 dbj|BAC40130.1| unnamed protein product [Mus musculus]
 gb|AAH41218.1| MGC52708 protein [Xenopus laevis]
 gb|AAH42290.1| H3f3b-prov protein [Xenopus laevis]
 gb|AAH42309.1| H3f3a-prov protein [Xenopus laevis]
 gb|AAO41645.1| histone H3.3B, isoform C [Drosophila melanogaster]
 gb|AAH49017.1| Zgc:56418 [Danio rerio]
 gb|EAA01174.2| AGAP001813-PA [Anopheles gambiae str. PEST]
 emb|CAD97621.1| hypothetical protein [Homo sapiens]
 gb|AAH57444.1| H3 histone, family 3C [Danio rerio]
 gb|AAR09797.1| similar to Drosophila melanogaster His3.3A, partial [Drosophila 
yakuba]
 gb|AAH61408.1| H3 histone, family 3B (H3.3B) [Xenopus (Silurana) tropicalis]
 gb|AAH63159.1| H3 histone, family 3B [Rattus norvegicus]
 emb|CAG02570.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAG02722.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAG06431.1| unnamed protein product [Tetraodon nigroviridis]
 gb|AAH70966.1| MGC78769 protein [Xenopus laevis]
 emb|CAF25046.1| histone H3.3 [Oikopleura dioica]
 gb|AAH71406.1| H3 histone, family 3A [Danio rerio]
 gb|AAH74158.1| MGC81913 protein [Xenopus laevis]
 gb|AAH77035.1| MGC89877 protein [Xenopus (Silurana) tropicalis]
 gb|AAH78759.1| H3 histone, family 3B [Rattus norvegicus]
 gb|AAU09479.1| GekBS038P [Gekko japonicus]
 gb|AAH81560.1| H3 histone, family 3B (H3.3B) [Homo sapiens]
 gb|AAH83353.1| H3 histone, family 3A [Mus musculus]
 gb|EAL33023.1| GA19158 [Drosophila pseudoobscura pseudoobscura]
 gb|AAH86580.1| H3f3b protein [Rattus norvegicus]
 gb|AAH87725.1| H3f3b protein [Rattus norvegicus]
 gb|AAH88835.1| H3 histone, family 3A [Mus musculus]
 gb|AAX08979.1| H3 histone, family 3A [Bos taurus]
 gb|AAX19363.1| replacement histone H3.3 [Ruditapes philippinarum]
 gb|AAH92043.1| H3 histone, family 3B [Mus musculus]
 gb|AAH92854.1| Zgc:110292 [Danio rerio]
 gb|AAH95447.1| H3 histone, family 3A [Homo sapiens]
 gb|AAI03072.1| H3F3A protein [Bos taurus]
 dbj|BAE40831.1| unnamed protein product [Mus musculus]
 dbj|BAE31831.1| unnamed protein product [Mus musculus]
 dbj|BAE35953.1| unnamed protein product [Mus musculus]
 dbj|BAE40995.1| unnamed protein product [Mus musculus]
 dbj|BAE31877.1| unnamed protein product [Mus musculus]
 dbj|BAE31939.1| unnamed protein product [Mus musculus]
 dbj|BAE29685.1| unnamed protein product [Mus musculus]
 dbj|BAE32069.1| unnamed protein product [Mus musculus]
 dbj|BAE36524.1| unnamed protein product [Mus musculus]
 dbj|BAE29966.1| unnamed protein product [Mus musculus]
 dbj|BAE36694.1| unnamed protein product [Mus musculus]
 dbj|BAE22687.1| unnamed protein product [Mus musculus]
 dbj|BAE37253.1| unnamed protein product [Mus musculus]
 dbj|BAE30261.1| unnamed protein product [Mus musculus]
 dbj|BAE30314.1| unnamed protein product [Mus musculus]
 dbj|BAE30566.1| unnamed protein product [Mus musculus]
 dbj|BAE30586.1| unnamed protein product [Mus musculus]
 dbj|BAE30589.1| unnamed protein product [Mus musculus]
 dbj|BAE35232.1| unnamed protein product [Mus musculus]
 dbj|BAE39850.1| unnamed protein product [Mus musculus]
 dbj|BAE39892.1| unnamed protein product [Mus musculus]
 dbj|BAE35427.1| unnamed protein product [Mus musculus]
 dbj|BAE30757.1| unnamed protein product [Mus musculus]
 dbj|BAE40157.1| unnamed protein product [Mus musculus]
 dbj|BAE31102.1| unnamed protein product [Mus musculus]
 dbj|BAE31231.1| unnamed protein product [Mus musculus]
 dbj|BAE31233.1| unnamed protein product [Mus musculus]
 dbj|BAE29584.1| unnamed protein product [Mus musculus]
 dbj|BAE29585.1| unnamed protein product [Mus musculus]
 dbj|BAE40542.1| unnamed protein product [Mus musculus]
 dbj|BAE31366.1| unnamed protein product [Mus musculus]
 dbj|BAE31590.1| unnamed protein product [Mus musculus]
 dbj|BAE31666.1| unnamed protein product [Mus musculus]
 gb|AAI06303.1| MGC52708 protein [Xenopus laevis]
 gb|AAI06178.1| H3 histone, family 3A [Mus musculus]
 gb|AAI08702.1| H3 histone, family 3B (H3.3B) [Homo sapiens]
 gb|ABD36130.1| h3 histone family 3a [Bombyx mori]
 gb|ABD98756.1| putative H3 histone, family 3A [Graphocephala atropunctata]
 gb|ABF57428.1| H3 histone, family 3B [Bos taurus]
 gb|EAT42283.1| AAEL006158-PA [Aedes aegypti]
 gb|ABG43104.1| histone H3 [Pectinaria gouldii]
 emb|CAL49400.1| H3 histone [Xenopus (Silurana) tropicalis]
 gb|AAI23121.1| MGC52708 protein [Xenopus laevis]
 emb|CAL38070.1| hypothetical protein [synthetic construct]
 gb|EAW69770.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens]
 gb|EAW69771.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens]
 gb|EAW69772.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens]
 gb|EAW69773.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens]
 gb|EAW89317.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens]
 gb|EAW89318.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens]
 gb|EAW89319.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens]
 gb|ABM55584.1| putative histone H3 [Maconellicoccus hirsutus]
 gb|ABM55592.1| putative H3 histone, family 3B [Maconellicoccus hirsutus]
 gb|ABM83541.1| H3 histone, family 3A [synthetic construct]
 gb|ABM86781.1| H3 histone, family 3A [synthetic construct]
 emb|CAK32534.1| histone H3.3 [Oikopleura dioica]
 gb|AAI34735.1| H3 histone, family 3A [Bos taurus]
 dbj|BAF62355.1| H3 histone, family 3A [Pan troglodytes verus]
 gb|EDL13145.1| mCG19829 [Mus musculus]
 gb|EDL34545.1| mCG6618 [Mus musculus]
 gb|EDL94833.1| rCG20294, isoform CRA_a [Rattus norvegicus]
 gb|EDM06637.1| H3 histone, family 3B, isoform CRA_a [Rattus norvegicus]
 gb|ABR22618.1| histone 3 [Aplysia californica]
 gb|ABR27830.1| H3 histone family 3B [Triatoma infestans]
 gb|AAI52135.1| Zgc:64222 protein [Danio rerio]
 gb|AAI54270.1| Zgc:56418 protein [Danio rerio]
 gb|ABX89280.1| histone cluster 1, H3a (predicted) [Papio anubis]
 gb|AAI57317.1| MGC89877 protein [Xenopus (Silurana) tropicalis]
 gb|AAI57315.1| h3f3b protein [Xenopus (Silurana) tropicalis]
 gb|AAI58616.1| H3f3b protein [Rattus norvegicus]
 gb|AAI59440.1| H3f3b protein [Rattus norvegicus]
 gb|ABZ92486.1| H3 histone, family 3B (H3.3B) [synthetic construct]
 gb|EDS44786.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|AAI65500.1| H3f3c protein [Danio rerio]
 dbj|BAG34846.1| unnamed protein product [Homo sapiens]
 gb|EDV32216.1| GF15720 [Drosophila ananassae]
 gb|EDV33762.1| GF19171 [Drosophila ananassae]
 gb|EDV46293.1| GG19000 [Drosophila erecta]
 gb|EDV57824.1| GG25048 [Drosophila erecta]
 gb|EDV92098.1| GH24723 [Drosophila grimshawi]
 gb|EDW03888.1| GH11489 [Drosophila grimshawi]
 gb|EDW07414.1| GI14879 [Drosophila mojavensis]
 gb|EDW11127.1| GI16984 [Drosophila mojavensis]
 gb|EDW25354.1| GL26550 [Drosophila persimilis]
 gb|EDW30520.1| GL26831 [Drosophila persimilis]
 gb|EDW51275.1| GM13676 [Drosophila sechellia]
 gb|EDW54332.1| GM18523 [Drosophila sechellia]
 gb|EDW58018.1| GJ15308 [Drosophila virilis]
 gb|EDW64014.1| GJ17231 [Drosophila virilis]
 gb|EDW75486.1| GK23881 [Drosophila willistoni]
 gb|EDW82368.1| GK25162 [Drosophila willistoni]
 gb|EDW88387.1| His3.3A [Drosophila yakuba]
 gb|EDX02176.1| GE17412 [Drosophila yakuba]
 gb|EDX03788.1| GD23319 [Drosophila simulans]
 gb|ACH44318.1| putative H3 histone family 3A [Taeniopygia guttata]
 gb|ACH44319.1| putative H3 histone family 3A [Taeniopygia guttata]
 gb|ACH46260.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata]
 gb|ACH46261.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata]
 gb|ACH46263.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46264.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46265.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata]
 gb|ACH46266.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46267.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata]
 gb|ACH46268.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46269.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46270.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46338.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata]
 gb|ACH46375.1| putative H3 histone family 3A [Taeniopygia guttata]
 gb|ACH70745.1| H3 histone family 3A [Salmo salar]
 gb|EDY72858.1| GA22698 [Drosophila pseudoobscura pseudoobscura]
 dbj|BAG73253.1| Histone H3.3 [synthetic construct]
 gb|ACI33069.1| Histone H3.3 [Salmo salar]
 gb|ACI33957.1| Histone H3.3 [Salmo salar]
 gb|ACI34226.1| Histone H3.3 [Salmo salar]
 gb|ACI67089.1| Histone H3.3 [Salmo salar]
 gb|ACI67783.1| Histone H3.3 [Salmo salar]
 gb|ACI68375.1| Histone H3.3 [Salmo salar]
 gb|ACI69310.1| Histone H3.3 [Salmo salar]
 gb|ACI70069.1| Histone H3.3 [Salmo salar]
 gb|EEB17922.1| histone H3.3 [Pediculus humanus corporis]
 gb|EEC02656.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis]
 gb|ACL87760.1| His3.3A-PA, partial [synthetic construct]
 gb|ACL92191.1| His3.3A-PA [synthetic construct]
 gb|ACL92440.1| His3.3A-PA [synthetic construct]
 gb|ACM08300.1| Histone H3.3 [Salmo salar]
 gb|ACM08661.1| Histone H3.3 [Salmo salar]
 gb|ACM08967.1| Histone H3.3 [Salmo salar]
 gb|ACM09352.1| Histone H3.3 [Salmo salar]
 gb|ACM09780.1| Histone H3.3 [Salmo salar]
 gb|ACN10203.1| Histone H3.3 [Salmo salar]
 gb|ACN10246.1| Histone H3.3 [Salmo salar]
 gb|ACN12557.1| Histone H3.3 [Salmo salar]
 gb|ACN12601.1| Histone H3.3 [Salmo salar]
 gb|ACO07595.1| Histone H3.3 [Oncorhynchus mykiss]
 gb|ACO09276.1| Histone H3.3 [Osmerus mordax]
 gb|ACO09281.1| Histone H3.3 [Osmerus mordax]
 gb|ACO12781.1| Histone H3.3 [Lepeophtheirus salmonis]
 gb|ACO12834.1| Histone H3.3 [Lepeophtheirus salmonis]
 gb|ACO14940.1| Histone H3.3 [Caligus clemensi]
 gb|ACO15238.1| Histone H3.3 [Caligus clemensi]
 gb|ACO15474.1| Histone H3.3 [Caligus clemensi]
 gb|EEN45251.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae]
 gb|EEN51635.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae]
 gb|ACQ58573.1| Histone H3.3 [Anoplopoma fimbria]
 emb|CBH09251.1| putative Histone H3 [Heliconius melpomene]
 dbj|BAI46602.1| H3 histone, family 3A [synthetic construct]
 gb|EFA07829.1| hypothetical protein TcasGA2_TC005398 [Tribolium castaneum]
 gb|EFB25626.1| hypothetical protein PANDA_008580 [Ailuropoda melanoleuca]
 gb|EFB29651.1| hypothetical protein PANDA_016437 [Ailuropoda melanoleuca]
 emb|CAP53904.1| histone H3.3 [Xenoturbella bocki]
 emb|CAP57915.1| histone H3.3 [Xenoturbella bocki]
 gb|ADD38620.1| Histone H3.3 [Lepeophtheirus salmonis]
 gb|ADD38769.1| Histone H3.3 [Lepeophtheirus salmonis]
 dbj|BAI83414.1| histone H3 [Parasteatoda tepidariorum]
 tpg|DAA18137.1| TPA: histone H3.3B-like [Bos taurus]
 tpg|DAA21369.1| TPA: histone H3.3 [Bos taurus]
 gb|ADM15975.1| Histone H3.3 [Salmo salar]
 gb|ADM16206.1| Histone H3.3 [Salmo salar]
 gb|EFN62078.1| Histone H3.3 [Camponotus floridanus]
 gb|EFN83154.1| Histone H3.3 [Harpegnathos saltator]
 gb|EFO14545.1| histone H3 [Loa loa]
 gb|EFO23321.1| H3 histone, family 3A [Loa loa]
 gb|ADO27848.1| histone h3.3 [Ictalurus furcatus]
 gb|ADO28924.1| histone h3.3 [Ictalurus punctatus]
 emb|CBY30878.1| unnamed protein product [Oikopleura dioica]
 emb|CBY10218.1| unnamed protein product [Oikopleura dioica]
 emb|CBY25129.1| unnamed protein product [Oikopleura dioica]
 emb|CBN81162.1| Histone H3 [Dicentrarchus labrax]
 emb|CBN81301.1| Uncharacterized protein [Dicentrarchus labrax]
 gb|EFX74442.1| hypothetical protein DAPPUDRAFT_231307 [Daphnia pulex]
 tpg|DAA34575.1| TPA_exp: H3 histone family 3A [Amblyomma variegatum]
 gb|EGI68969.1| Histone H3.3 [Acromyrmex echinatior]
 gb|EGI68970.1| Histone H3.3 [Acromyrmex echinatior]
 gb|AEE62718.1| unknown [Dendroctonus ponderosae]
 gb|EGK97461.1| AGAP001813-PB [Anopheles gambiae str. PEST]
 emb|CBM82511.1| histone H3.3 protein [Balanoglossus clavigerus]
 gb|AEM37650.1| histone H3, partial [Epinephelus bruneus]
 dbj|BAK63626.1| histone H3.3 [Pan troglodytes]
 gb|EHB06352.1| Histone H3.3 [Heterocephalus glaber]
 gb|EHB10765.1| Histone H3.3 [Heterocephalus glaber]
 gb|EHH15496.1| hypothetical protein EGK_01597 [Macaca mulatta]
 gb|EHH25207.1| hypothetical protein EGK_08989 [Macaca mulatta]
 gb|EHH50500.1| hypothetical protein EGM_01343 [Macaca fascicularis]
 gb|EHH61688.1| hypothetical protein EGM_19729 [Macaca fascicularis]
 gb|EHJ77454.1| hypothetical protein KGM_11308 [Danaus plexippus]
 dbj|BAM18163.1| histone H3.3B [Papilio xuthus]
 dbj|BAM19145.1| histone H3.3B [Papilio polytes]
 gb|AFM89658.1| histone H33 [Callorhinchus milii]
 gb|EJW82753.1| histone H3 [Wuchereria bancrofti]
 gb|EJW87260.1| histone H3 [Wuchereria bancrofti]
 gb|EKC17910.1| Histone H3.3 [Crassostrea gigas]
 gb|ELK12359.1| Histone H3.3 [Pteropus alecto]
 gb|AGB92618.1| histone H3.3A, isoform C [Drosophila melanogaster]
 gb|AAN10526.2| histone H3.3A, isoform D [Drosophila melanogaster]
 gb|AGB95217.1| histone H3.3B, isoform E [Drosophila melanogaster]
 gb|ELR48666.1| hypothetical protein M91_05641 [Bos mutus]
 gb|ELR49990.1| Histone H3.3 [Bos mutus]
 gb|AGC92675.1| Histone H3.3-like protein [Heliconius erato]
 gb|ELT93764.1| hypothetical protein CAPTEDRAFT_152257 [Capitella teleta]
 gb|ELW68308.1| Histone H3.3 [Tupaia chinensis]
 emb|CCQ18650.1| histone H3 [Sycon ciliatum]
 gb|AGG41269.1| histone H3.3 [Cerebratulus lacteus]
 gb|EMP28698.1| Histone H3.3 [Chelonia mydas]
 gb|AGH92507.1| histone H3.3 [Salmo salar]
 gb|ENN76942.1| hypothetical protein YQE_06588, partial [Dendroctonus ponderosae]
 gb|EOB08186.1| Histone H3.3, partial [Anas platyrhynchos]
 dbj|BAN20326.1| histone H3.3 [Riptortus pedestris]
 gb|AGT29358.1| histone H3 [Artemia parthenogenetica]
 gb|EQB77250.1| histone H3.3-like protein [Camelus ferus]
 gb|EQB78545.1| histone H3.3-like protein [Camelus ferus]
 gb|ERE72950.1| Histone H3 containing protein [Cricetulus griseus]
 gb|ERG81454.1| histone [Ascaris suum]
 gb|ERL89712.1| hypothetical protein D910_07074 [Dendroctonus ponderosae]
 gb|ESO07202.1| hypothetical protein HELRODRAFT_185455 [Helobdella robusta]
 gb|ESO84775.1| hypothetical protein LOTGIDRAFT_150994 [Lottia gigantea]
 emb|CDJ97587.1| Histone core domain containing protein [Haemonchus contortus]
 gb|ETN62190.1| histone H3.3 [Anopheles darlingi]
 gb|ETN74986.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|ETN79664.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|EYB84770.1| hypothetical protein Y032_0310g2098 [Ancylostoma ceylanicum]
 gb|EYB89660.1| hypothetical protein Y032_0229g2919 [Ancylostoma ceylanicum]
 gb|EZA46174.1| histone H3.3-1 [Microplitis demolitor]
 gb|EZA46175.1| histone H3.3-2 [Microplitis demolitor]
 gb|EZA49573.1| Histone H3.3 [Cerapachys biroi]
 gb|EZA49574.1| Histone H3.3 [Cerapachys biroi]
 emb|CDQ91388.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ86418.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ77348.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ77349.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ77265.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ72046.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ70414.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ70415.1| unnamed protein product [Oncorhynchus mykiss]
 gb|KDR19059.1| Histone H3.3 [Zootermopsis nevadensis]
 gb|AIC48912.1| H3F3B, partial [synthetic construct]
 dbj|BAP18978.1| histone H3, partial [Cynops pyrrhogaster]
 gb|AII16469.1| histone H3.3, partial [Paracyclopina nana]
 emb|CDQ00717.1| Protein Bm4100 [Brugia malayi]
 gb|KFM81878.1| Histone H3.3, partial [Stegodyphus mimosarum]
 gb|KFO35619.1| Histone H3.3 [Fukomys damarensis]
 gb|KFO70471.1| Histone H3.3 [Cuculus canorus]
 gb|KFP15075.1| Histone H3.3 [Egretta garzetta]
 gb|KFQ71006.1| Histone H3.3 [Phaethon lepturus]
 gb|KFQ92670.1| Histone H3.3 [Nipponia nippon]
 gb|KFU93384.1| Histone H3.3 [Chaetura pelagica]
 gb|AIS25384.1| histone H3.3 [Mytilus edulis]
 gb|AIS25386.1| histone H3.3 [Mytilus edulis]
 gb|AIS25389.1| histone H3.3 [Mytilus galloprovincialis]
 gb|AIS25390.1| histone H3.3 [Mytilus galloprovincialis]
 gb|AIS25391.1| histone H3.3 [Mytilus edulis]
 gb|AIS25393.1| histone H3.3 [Mytilus edulis]
 gb|KGL80522.1| Histone H3.3 [Tinamus guttatus]
 gb|KHJ99858.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHN88012.1| Histone H3.3 [Toxocara canis]
 gb|KHN88013.1| Histone H3.3 [Toxocara canis]
 gb|KHN88014.1| Histone H3.3 [Toxocara canis]
 gb|KIH54469.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH59959.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=136

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_010634570.1| PREDICTED: histone H3.1-like [Fukomys damarensis]
Length=174

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  39   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  98

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  99   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  158

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  159  MPKDIQLARRIRGERA  174



>ref|XP_005702922.1| histone H3 [Galdieria sulphuraria]
 gb|EME26402.1| histone H3 [Galdieria sulphuraria]
Length=136

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPVTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQ+SAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQTSAVTALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGER  463
            MPKDIQLARRIRGER
Sbjct  121  MPKDIQLARRIRGER  135



>gb|AFK11045.1| histone H3.3 [Callorhinchus milii]
Length=136

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSVAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_527253.2| PREDICTED: histone H3.1-like [Pan troglodytes]
 ref|XP_008959258.1| PREDICTED: histone H3.1-like [Pan paniscus]
Length=153

 Score =   232 bits (591),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  18   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  77

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  78   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  137

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  138  MPKDIQLARRIRGERA  153



>dbj|BAD02413.1| histone 3 [Drosophila pseudoobscura]
Length=136

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARK APATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKGAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002635330.1| Hypothetical protein CBG01499 [Caenorhabditis briggsae]
 ref|XP_002635334.1| Hypothetical protein CBG01505 [Caenorhabditis briggsae]
 emb|CAP22751.1| Protein CBG01505 [Caenorhabditis briggsae]
 emb|CAP22755.1| Protein CBG01499 [Caenorhabditis briggsae]
Length=136

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAQGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE+AEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>dbj|BAD90754.1| histone 3 [Conocephalum conicum]
 dbj|BAD90757.1| histone 3 [Conocephalum conicum]
Length=136

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGER  463
            MPKDIQLARRIRGER
Sbjct  121  MPKDIQLARRIRGER  135



>gb|AAB27669.2| H3 histone [Styela plicata]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSS+V ALQEA+E YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSSVMALQEASERYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQL RRIRGERA
Sbjct  121  MPKDIQLGRRIRGERA  136



>emb|CBI23573.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   231 bits (590),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  12   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  71

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  72   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  131

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  132  MPKDIQLARRIRGERA  147



>ref|XP_008615723.1| histone H3 [Saprolegnia diclina VS20]
 gb|EQC30985.1| histone H3 [Saprolegnia diclina VS20]
 gb|KDO26684.1| histone H3 [Saprolegnia parasitica CBS 223.65]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQ SAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQGSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGER+
Sbjct  121  MPKDIQLARRIRGERS  136



>ref|XP_001623766.1| predicted protein [Nematostella vectensis]
 ref|XP_002113772.1| replacement histone H3.3 [Trichoplax adhaerens]
 ref|XP_002154470.1| PREDICTED: histone H3.3-like [Hydra vulgaris]
 sp|Q8WSF1.3|H33_TRIPS RecName: Full=Histone H3.3 [Trichinella pseudospiralis]
 gb|AAL67159.1|AF323993_1 histone H3.3 [Trichinella pseudospiralis]
 gb|ABL14206.1| histone H3.3-like protein protein [Trichinella spiralis]
 gb|EDO31666.1| predicted protein [Nematostella vectensis]
 gb|EDV24246.1| replacement histone H3.3 [Trichoplax adhaerens]
 gb|AGH70131.1| histone H3 [Placozoa sp. H4]
 emb|CEF64449.1| Histone H3.3 [Strongyloides ratti]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002743348.1| PREDICTED: histone H3.3-like [Callithrix jacchus]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRF S+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFHSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AFY26276.1| histone H3, partial [Plectorhinchus mediterraneus]
Length=135

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  62   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL  241
            ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct  1    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL  60

Query  242  LIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTIM  421
            LIRKLPFQRLVREIAQDFKTDLRFQSSA  ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct  61   LIRKLPFQRLVREIAQDFKTDLRFQSSAAMALQEASEAYLVGLFEDTNLCAIHAKRVTIM  120

Query  422  PKDIQLARRIRGERA  466
            PKDIQLARRIRGERA
Sbjct  121  PKDIQLARRIRGERA  135



>gb|EYU30980.1| hypothetical protein MIMGU_mgv1a014700mg [Erythranthe guttata]
Length=181

 Score =   233 bits (593),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  41   ELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK  220
            E     MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRK
Sbjct  40   EFKSSKMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRK  99

Query  221  YQKSTELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIH  400
            YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIH
Sbjct  100  YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIH  159

Query  401  AKRVTIMPKDIQLARRIRGERA  466
            AKRVTIMPKDIQLARRIRGERA
Sbjct  160  AKRVTIMPKDIQLARRIRGERA  181



>ref|XP_002999294.1| histone, putative [Phytophthora infestans T30-4]
 ref|XP_002906612.1| histone H3 [Phytophthora infestans T30-4]
 ref|XP_008614757.1| histone H3 [Saprolegnia diclina VS20]
 ref|XP_008620149.1| histone H3 [Saprolegnia diclina VS20]
 ref|XP_008863622.1| histone H3 [Aphanomyces invadans]
 ref|XP_008864894.1| histone [Aphanomyces invadans]
 ref|XP_008868863.1| histone [Aphanomyces invadans]
 ref|XP_008892384.1| histone H3 [Phytophthora parasitica INRA-310]
 ref|XP_008903638.1| histone [Phytophthora parasitica INRA-310]
 ref|XP_009515673.1| hypothetical protein PHYSODRAFT_476994 [Phytophthora sojae]
 ref|XP_009515674.1| hypothetical protein PHYSODRAFT_322070 [Phytophthora sojae]
 ref|XP_009518876.1| hypothetical protein PHYSODRAFT_284752 [Phytophthora sojae]
 ref|XP_009825936.1| histone H3 [Aphanomyces astaci]
 ref|XP_009827126.1| histone [Aphanomyces astaci]
 ref|XP_009834846.1| histone [Aphanomyces astaci]
 gb|EEY66013.1| histone H3 [Phytophthora infestans T30-4]
 gb|EEY69440.1| histone, putative [Phytophthora infestans T30-4]
 gb|EGZ23588.1| hypothetical protein PHYSODRAFT_284752 [Phytophthora sojae]
 gb|EGZ28398.1| hypothetical protein PHYSODRAFT_476994 [Phytophthora sojae]
 gb|EGZ28399.1| hypothetical protein PHYSODRAFT_322070 [Phytophthora sojae]
 gb|EQC26400.1| histone H3 [Saprolegnia diclina VS20]
 gb|EQC31750.1| histone H3 [Saprolegnia diclina VS20]
 gb|ETI49040.1| histone [Phytophthora parasitica P1569]
 gb|ETI49433.1| histone H3 [Phytophthora parasitica P1569]
 gb|ETK88908.1| histone [Phytophthora parasitica]
 gb|ETK89311.1| histone [Phytophthora parasitica]
 gb|ETL42306.1| histone H3 [Phytophthora parasitica]
 gb|ETL42765.1| histone [Phytophthora parasitica]
 gb|ETL95480.1| histone H3 [Phytophthora parasitica]
 gb|ETL95914.1| histone [Phytophthora parasitica]
 gb|ETM48679.1| histone [Phytophthora parasitica]
 gb|ETM49078.1| histone H3 [Phytophthora parasitica]
 gb|ETN11156.1| histone [Phytophthora parasitica INRA-310]
 gb|ETN23188.1| histone H3 [Phytophthora parasitica INRA-310]
 gb|ETO77778.1| histone [Phytophthora parasitica P1976]
 gb|ETO78168.1| histone [Phytophthora parasitica P1976]
 gb|ETP18807.1| histone [Phytophthora parasitica CJ01A1]
 gb|ETP19206.1| histone H3 [Phytophthora parasitica CJ01A1]
 gb|ETP46728.1| histone [Phytophthora parasitica P10297]
 gb|ETP47135.1| histone [Phytophthora parasitica P10297]
 gb|ETV75715.1| histone [Aphanomyces astaci]
 gb|ETV83696.1| histone [Aphanomyces astaci]
 gb|ETV84244.1| histone H3 [Aphanomyces astaci]
 gb|ETW02258.1| histone [Aphanomyces invadans]
 gb|ETW06819.1| histone [Aphanomyces invadans]
 gb|ETW07529.1| histone H3 [Aphanomyces invadans]
 gb|KDO27242.1| histone H3 [Saprolegnia parasitica CBS 223.65]
 gb|KDO27386.1| histone H3 [Saprolegnia parasitica CBS 223.65]
 gb|KDO28336.1| histone H3 [Saprolegnia parasitica CBS 223.65]
 gb|KDO34168.1| histone H3 [Saprolegnia parasitica CBS 223.65]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQ SAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQGSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGER+
Sbjct  121  MPKDIQLARRIRGERS  136



>ref|XP_005643646.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005643655.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005643677.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005643713.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005646405.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005646414.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005648178.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19102.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19111.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19133.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19169.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE21861.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE21870.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE23634.1| histone H3 [Coccomyxa subellipsoidea C-169]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNL AIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLAAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_003979768.1| PREDICTED: histone H3.2-like, partial [Takifugu rubripes]
Length=221

 Score =   234 bits (597),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  86   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  145

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  146  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  205

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  206  MPKDIQLARRIRGERA  221



>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone 
Variant H3.3
 pdb|3AV2|E Chain E, The Human Nucleosome Structure Containing The Histone 
Variant H3.3
Length=139

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  64   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  123

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  124  MPKDIQLARRIRGERA  139



>ref|XP_002045405.1| GM13629 [Drosophila sechellia]
 gb|EDW43605.1| GM13629 [Drosophila sechellia]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MA TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MAHTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002985522.1| hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii]
 ref|XP_002987048.1| hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii]
 ref|XP_007018714.1| Histone superfamily protein [Theobroma cacao]
 gb|EFJ11891.1| hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii]
 gb|EFJ13396.1| hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii]
 gb|EOY15939.1| Histone superfamily protein [Theobroma cacao]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQD+KTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_007971657.1| PREDICTED: histone H3.1-like [Chlorocebus sabaeus]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPR+QLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRRQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_004019074.1| PREDICTED: histone H3.1-like [Ovis aries]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV+KPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVRKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002645157.1| C. briggsae CBR-HIS-71 protein [Caenorhabditis briggsae]
 emb|CAP34715.1| Protein CBR-HIS-71 [Caenorhabditis briggsae]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>dbj|BAE31789.1| unnamed protein product [Mus musculus]
 dbj|BAE30411.1| unnamed protein product [Mus musculus]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+E YLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEEYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|ACO07612.1| Histone H3.3 [Oncorhynchus mykiss]
Length=136

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCA+HAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAVHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AAA48795.1| histone H3 [Gallus gallus]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIA DFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAXDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CAP53901.1| histone H3 [Xenoturbella bocki]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+Y+KSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYRKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|AFY26266.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26268.1| histone H3, partial [Plectorhinchus mediterraneus]
Length=135

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  62   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL  241
            ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct  1    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL  60

Query  242  LIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTIM  421
            LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct  61   LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKRVTIM  120

Query  422  PKDIQLARRIRGERA  466
            PKDIQLARRIRGERA
Sbjct  121  PKDIQLARRIRGERA  135



>ref|XP_010186633.1| PREDICTED: histone H3-like isoform X1 [Mesitornis unicolor]
Length=240

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  105  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  164

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  165  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  224

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  225  MPKDIQLARRIRGERA  240



>ref|XP_003999137.2| PREDICTED: LOW QUALITY PROTEIN: histone H3.3 [Felis catus]
Length=162

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|EHH18025.1| Histone H3/a [Macaca mulatta]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDF TDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFNTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>gb|KJB17320.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
Length=153

 Score =   231 bits (590),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct  18   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  77

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  78   LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  137

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  138  MPKDIQLARRIRGERA  153



>ref|XP_007471286.1| PREDICTED: histone H3.1-like [Lipotes vexillifer]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVR+IAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVRDIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>emb|CAD38827.1| histone h3.1 [Oikopleura dioica]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDT+LCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTHLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002045660.1| GM18832 [Drosophila sechellia]
 gb|EDW54721.1| GM18832 [Drosophila sechellia]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQK TE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKCTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_307081.3| Anopheles gambiae str. PEST AGAP012709-PA [Anopheles gambiae 
str. PEST]
 pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex
 pdb|2NQB|A Chain A, Drosophila Nucleosome Structure
 pdb|2NQB|E Chain E, Drosophila Nucleosome Structure
 pdb|2PYO|A Chain A, Drosophila Nucleosome Core
 pdb|2PYO|E Chain E, Drosophila Nucleosome Core
 pdb|3C9K|C Chain C, Model Of Histone Octamer Tubular Crystals
 pdb|3C9K|G Chain G, Model Of Histone Octamer Tubular Crystals
 gb|EAA02896.3| AGAP012709-PA [Anopheles gambiae str. PEST]
 gb|AFY26269.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26270.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26272.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26273.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26275.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26277.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26278.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26279.1| histone H3, partial [Plectorhinchus mediterraneus]
 prf||0806228A histone H3 [Gallus gallus]
 prf||0710252A histone H3
Length=135

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  62   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL  241
            ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct  1    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL  60

Query  242  LIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTIM  421
            LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct  61   LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM  120

Query  422  PKDIQLARRIRGERA  466
            PKDIQLARRIRGERA
Sbjct  121  PKDIQLARRIRGERA  135



>ref|XP_010916709.1| PREDICTED: histone H3.3-like [Elaeis guineensis]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREI+QD+KTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREISQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_005350046.1| PREDICTED: histone H3.1-like [Microtus ochrogaster]
Length=140

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  50   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQK  229
            I+ MARTKQTARKSTGGKAPRKQLATK ARKSAPATGGVKKPHR+ PGTVALREIR+YQK
Sbjct  2    ILSMARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYHPGTVALREIRRYQK  61

Query  230  STELLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKR  409
            STELLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA E+YLVGLFEDTNLCAIHAKR
Sbjct  62   STELLIRKLPFQRLVREIAQDFKTDLRFQSSAMMALQEACESYLVGLFEDTNLCAIHAKR  121

Query  410  VTIMPKDIQLARRIRGERA  466
            VTIMPKD+QLARRIRGERA
Sbjct  122  VTIMPKDVQLARRIRGERA  140



>ref|NP_509344.1| Protein HIS-71 [Caenorhabditis elegans]
 sp|Q10453.2|H331_CAEEL RecName: Full=Histone H3.3 type 1 [Caenorhabditis elegans]
 gb|EGT45934.1| hypothetical protein CAEBREN_28893 [Caenorhabditis brenneri]
 emb|CCD66641.1| HIS-71 [Caenorhabditis elegans]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>ref|XP_002045506.1| GM11653 [Drosophila sechellia]
 gb|EDW51008.1| GM11653 [Drosophila sechellia]
Length=136

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSA ATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSASATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k122q Mutation
 pdb|3AZH|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k122q Mutation
Length=139

 Score =   231 bits (588),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  64   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  123

Query  419  MPKDIQLARRIRGERA  466
            MP+DIQLARRIRGERA
Sbjct  124  MPQDIQLARRIRGERA  139



>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k115q Mutation
 pdb|3AZG|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k115q Mutation
Length=139

 Score =   231 bits (588),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHA+RVTI
Sbjct  64   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAQRVTI  123

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  124  MPKDIQLARRIRGERA  139



>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k79q Mutation
 pdb|3AZF|E Chain E, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k79q Mutation
Length=139

 Score =   231 bits (588),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  59   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  238
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  239  LLIRKLPFQRLVREIAQDFKTDLRFqssavaalqeaaeaylvGLFEDTNLCAIHAKRVTI  418
            LLIRKLPFQRLVREIAQDF+TDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  64   LLIRKLPFQRLVREIAQDFQTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI  123

Query  419  MPKDIQLARRIRGERA  466
            MPKDIQLARRIRGERA
Sbjct  124  MPKDIQLARRIRGERA  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840