BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF017L17

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591334.1|  PREDICTED: probable phytol kinase 3, chlorop...    179   8e-52   Nicotiana tomentosiformis
ref|XP_009790459.1|  PREDICTED: probable phytol kinase 3, chlorop...    179   1e-51   Nicotiana sylvestris
ref|XP_004246260.1|  PREDICTED: probable phytol kinase 3, chlorop...    175   2e-50   Solanum lycopersicum
gb|ADZ24711.1|  phytol kinase                                           175   3e-50   Solanum pennellii
ref|XP_006354090.1|  PREDICTED: probable phytol kinase 3, chlorop...    175   4e-50   Solanum tuberosum [potatoes]
emb|CDP09225.1|  unnamed protein product                                171   3e-49   Coffea canephora [robusta coffee]
ref|XP_011098894.1|  PREDICTED: probable phytol kinase 3, chlorop...    169   9e-48   Sesamum indicum [beniseed]
ref|XP_002516647.1|  Phytol kinase 1, chloroplast precursor, puta...    167   3e-47   Ricinus communis
gb|EYU45412.1|  hypothetical protein MIMGU_mgv1a010789mg                167   3e-47   Erythranthe guttata [common monkey flower]
gb|KJB83903.1|  hypothetical protein B456_013G270100                    159   5e-45   Gossypium raimondii
gb|KHG05203.1|  putative phytol kinase 3, chloroplastic                 162   5e-45   Gossypium arboreum [tree cotton]
gb|KDP45737.1|  hypothetical protein JCGZ_17344                         160   1e-44   Jatropha curcas
gb|KJB83901.1|  hypothetical protein B456_013G270100                    159   2e-44   Gossypium raimondii
gb|KJB83902.1|  hypothetical protein B456_013G270100                    159   4e-44   Gossypium raimondii
ref|XP_010028018.1|  PREDICTED: probable phytol kinase 3, chlorop...    153   2e-43   
ref|XP_002299996.2|  hypothetical protein POPTR_0001s28680g             155   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007016938.1|  Phosphatidate cytidylyltransferase family pr...    155   3e-43   
ref|XP_002313238.2|  hypothetical protein POPTR_0009s07860g             157   3e-43   
ref|XP_011025082.1|  PREDICTED: probable phytol kinase 3, chlorop...    156   7e-43   Populus euphratica
ref|XP_007016939.1|  Phosphatidate cytidylyltransferase family pr...    156   8e-43   
ref|XP_010069238.1|  PREDICTED: probable phytol kinase 3, chlorop...    153   2e-42   Eucalyptus grandis [rose gum]
ref|XP_007205802.1|  hypothetical protein PRUPE_ppa010668mg             153   2e-42   
gb|KCW54677.1|  hypothetical protein EUGRSUZ_I00620                     152   3e-42   Eucalyptus grandis [rose gum]
ref|XP_009369583.1|  PREDICTED: probable phytol kinase 2, chlorop...    155   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_010028019.1|  PREDICTED: probable phytol kinase 3, chlorop...    152   5e-42   
ref|XP_006280848.1|  hypothetical protein CARUB_v10026834mg             152   2e-41   Capsella rubella
ref|XP_010520194.1|  PREDICTED: probable phytol kinase 2, chlorop...    152   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_008457339.1|  PREDICTED: probable phytol kinase 2, chlorop...    152   4e-41   Cucumis melo [Oriental melon]
ref|XP_008384758.1|  PREDICTED: probable phytol kinase 2, chlorop...    152   5e-41   
ref|XP_010089521.1|  putative phytol kinase 3                           154   8e-41   
ref|XP_004294311.1|  PREDICTED: probable phytol kinase 2, chlorop...    151   1e-40   Fragaria vesca subsp. vesca
ref|XP_010443595.1|  PREDICTED: probable phytol kinase 2, chlorop...    150   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010453909.1|  PREDICTED: probable phytol kinase 2, chlorop...    150   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_011003752.1|  PREDICTED: probable phytol kinase 2, chlorop...    150   2e-40   Populus euphratica
ref|XP_008221407.1|  PREDICTED: probable phytol kinase 3, chlorop...    150   2e-40   Prunus mume [ume]
ref|XP_006401067.1|  hypothetical protein EUTSA_v10014180mg             149   3e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006387375.1|  hypothetical protein POPTR_1135s00200g             145   4e-40   
ref|XP_007016937.1|  Phosphatidate cytidylyltransferase family pr...    149   7e-40   
emb|CDY66208.1|  BnaCnng49970D                                          148   8e-40   Brassica napus [oilseed rape]
gb|KEH34361.1|  phytol kinase                                           148   1e-39   Medicago truncatula
ref|XP_004500293.1|  PREDICTED: probable phytol kinase 3, chlorop...    147   1e-39   Cicer arietinum [garbanzo]
ref|XP_007146804.1|  hypothetical protein PHAVU_006G071000g             147   1e-39   Phaseolus vulgaris [French bean]
gb|KCW54682.1|  hypothetical protein EUGRSUZ_I00621                     144   2e-39   Eucalyptus grandis [rose gum]
ref|XP_004145246.1|  PREDICTED: probable phytol kinase 2, chlorop...    147   2e-39   
ref|XP_010483456.1|  PREDICTED: probable phytol kinase 2, chlorop...    147   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009132278.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...    145   4e-39   
ref|XP_009120370.1|  PREDICTED: probable phytol kinase 2, chlorop...    146   5e-39   Brassica rapa
emb|CDY67806.1|  BnaA10g29300D                                          146   6e-39   Brassica napus [oilseed rape]
dbj|BAD43853.1|  unknown protein                                        145   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132038.1|  PREDICTED: probable phytol kinase 2, chlorop...    145   2e-38   Brassica rapa
ref|NP_200664.1|  farnesol kinase                                       145   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65097.1|  unknown                                                 145   2e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70799.1|  BnaAnng35070D                                          145   2e-38   Brassica napus [oilseed rape]
gb|AFK48670.1|  unknown                                                 145   2e-38   Lotus japonicus
ref|XP_010264775.1|  PREDICTED: probable phytol kinase 2, chlorop...    142   6e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004500292.1|  PREDICTED: probable phytol kinase 3, chlorop...    143   7e-38   Cicer arietinum [garbanzo]
ref|XP_011003760.1|  PREDICTED: probable phytol kinase 2, chlorop...    141   9e-38   Populus euphratica
ref|XP_002313239.2|  hypothetical protein POPTR_0009s07860g             140   2e-37   
ref|XP_010503534.1|  PREDICTED: probable phytol kinase 2, chlorop...    140   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010689412.1|  PREDICTED: probable phytol kinase 2, chlorop...    140   6e-37   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA97326.1|  unnamed protein product                                144   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb|EPS57827.1|  hypothetical protein M569_16990                         139   7e-37   Genlisea aurea
ref|XP_010426391.1|  PREDICTED: probable phytol kinase 2, chlorop...    139   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010520844.1|  PREDICTED: probable phytol kinase 2, chlorop...    139   9e-37   
gb|ACU24460.1|  unknown                                                 140   1e-36   Glycine max [soybeans]
gb|KFK27385.1|  hypothetical protein AALP_AA8G375800                    139   2e-36   Arabis alpina [alpine rockcress]
gb|KHN02090.1|  Putative phytol kinase 3, chloroplastic                 140   2e-36   Glycine soja [wild soybean]
gb|KJB20420.1|  hypothetical protein B456_003G147500                    137   2e-36   Gossypium raimondii
emb|CBI15917.3|  unnamed protein product                                138   2e-36   Vitis vinifera
ref|XP_002278580.2|  PREDICTED: probable phytol kinase 2, chlorop...    139   3e-36   Vitis vinifera
ref|XP_010028020.1|  PREDICTED: probable phytol kinase 3, chlorop...    137   4e-36   
gb|KDO66966.1|  hypothetical protein CISIN_1g022935mg                   137   4e-36   Citrus sinensis [apfelsine]
gb|KHG27084.1|  putative phytol kinase 3, chloroplastic                 136   5e-36   Gossypium arboreum [tree cotton]
ref|XP_006425113.1|  hypothetical protein CICLE_v10028969mg             137   6e-36   
gb|KDO66964.1|  hypothetical protein CISIN_1g022935mg                   137   6e-36   Citrus sinensis [apfelsine]
ref|XP_002278563.2|  PREDICTED: probable phytol kinase 2, chlorop...    136   6e-36   
ref|XP_006425114.1|  hypothetical protein CICLE_v10028969mg             137   7e-36   Citrus clementina [clementine]
ref|XP_010910062.1|  PREDICTED: probable phytol kinase 2, chlorop...    137   1e-35   Elaeis guineensis
ref|XP_006488562.1|  PREDICTED: probable phytol kinase 3, chlorop...    137   2e-35   Citrus sinensis [apfelsine]
gb|KDO66965.1|  hypothetical protein CISIN_1g022935mg                   136   2e-35   Citrus sinensis [apfelsine]
emb|CBI15916.3|  unnamed protein product                                136   3e-35   Vitis vinifera
ref|XP_008811675.1|  PREDICTED: probable phytol kinase 2, chlorop...    135   5e-35   Phoenix dactylifera
ref|XP_010412644.1|  PREDICTED: probable phytol kinase 2, chlorop...    134   5e-35   Camelina sativa [gold-of-pleasure]
emb|CDY65783.1|  BnaA03g56270D                                          136   5e-35   Brassica napus [oilseed rape]
ref|NP_001242263.1|  probable phytol kinase 3, chloroplastic            135   1e-34   
ref|XP_003564535.1|  PREDICTED: probable phytol kinase 2, chlorop...    132   9e-34   Brachypodium distachyon [annual false brome]
ref|XP_006292344.1|  hypothetical protein CARUB_v10018556mg             128   3e-33   
ref|XP_006847435.1|  hypothetical protein AMTR_s00153p00083300          129   4e-33   
ref|NP_001130181.1|  uncharacterized protein LOC100191275               130   5e-33   Zea mays [maize]
gb|ADE76360.1|  unknown                                                 130   2e-32   Picea sitchensis
gb|KCW54679.1|  hypothetical protein EUGRSUZ_I00620                     124   2e-32   Eucalyptus grandis [rose gum]
emb|CDM84848.1|  unnamed protein product                                129   2e-32   Triticum aestivum [Canadian hard winter wheat]
gb|KCW54680.1|  hypothetical protein EUGRSUZ_I00620                     123   5e-32   Eucalyptus grandis [rose gum]
gb|KCW54678.1|  hypothetical protein EUGRSUZ_I00620                     124   7e-32   Eucalyptus grandis [rose gum]
ref|XP_004970454.1|  PREDICTED: probable phytol kinase 2, chlorop...    127   1e-31   Setaria italica
ref|XP_002864581.1|  hypothetical protein ARALYDRAFT_332145             128   2e-31   
ref|NP_001044703.2|  Os01g0832000                                       124   4e-31   
ref|XP_002458716.1|  hypothetical protein SORBIDRAFT_03g038850          125   7e-31   
ref|XP_009420002.1|  PREDICTED: probable phytol kinase 2, chlorop...    124   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644954.1|  PREDICTED: probable phytol kinase 2, chlorop...    122   1e-30   
sp|Q5N9J9.3|PHYK2_ORYSJ  RecName: Full=Probable phytol kinase 2, ...    124   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008349551.1|  PREDICTED: probable phytol kinase 2, chlorop...    119   1e-29   
ref|XP_004978591.1|  PREDICTED: probable phytol kinase 2, chlorop...    115   1e-27   Setaria italica
gb|KEH28892.1|  phytol kinase                                           113   4e-27   Medicago truncatula
ref|XP_004977648.1|  PREDICTED: probable phytol kinase 2, chlorop...    112   2e-26   Setaria italica
ref|XP_004977649.1|  PREDICTED: probable phytol kinase 2, chlorop...    112   2e-26   
ref|XP_009603395.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...    110   4e-26   
ref|NP_001065534.2|  Os11g0105800                                       111   5e-26   
gb|ACG40052.1|  phytol kinase 2                                         110   6e-26   Zea mays [maize]
ref|XP_008676758.1|  PREDICTED: uncharacterized protein LOC100272...    110   6e-26   Zea mays [maize]
ref|XP_008356261.1|  PREDICTED: probable phytol kinase 3, chlorop...    110   7e-26   
gb|EAY81967.1|  hypothetical protein OsI_37144                          110   9e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_003579056.1|  PREDICTED: probable phytol kinase 2, chlorop...    110   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_002450098.1|  hypothetical protein SORBIDRAFT_05g000470          109   2e-25   Sorghum bicolor [broomcorn]
gb|KEH28894.1|  phytol kinase                                           108   3e-25   Medicago truncatula
gb|ABA95607.1|  phosphatidate cytidylyltransferase family protein...    107   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442649.1|  hypothetical protein SORBIDRAFT_08g000500          107   2e-24   Sorghum bicolor [broomcorn]
ref|NP_001065932.1|  Os12g0105500                                       107   2e-24   
ref|XP_006662647.1|  PREDICTED: probable phytol kinase 2, chlorop...    105   6e-24   
emb|CDY65781.1|  BnaA03g56250D                                          102   1e-22   Brassica napus [oilseed rape]
gb|AFW64552.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  97.4    6e-22   
ref|XP_002966017.1|  hypothetical protein SELMODRAFT_230719           97.1    6e-21   
ref|XP_010650879.1|  PREDICTED: probable phytol kinase 2, chlorop...  96.7    7e-21   Vitis vinifera
ref|XP_001780576.1|  predicted protein                                90.1    1e-18   
ref|XP_001764046.1|  predicted protein                                87.0    2e-17   
ref|XP_005643081.1|  hypothetical protein COCSUDRAFT_49246            85.5    9e-17   Coccomyxa subellipsoidea C-169
gb|KCW57521.1|  hypothetical protein EUGRSUZ_H00292                   84.0    1e-16   Eucalyptus grandis [rose gum]
ref|XP_001766222.1|  predicted protein                                81.3    2e-15   
ref|XP_002315347.2|  hypothetical protein POPTR_0010s23890g           82.4    2e-15   
ref|WP_010480729.1|  phosphatidate cytidylyltransferase               80.9    3e-15   Acaryochloris sp. CCMEE 5410
gb|KCW54683.1|  hypothetical protein EUGRSUZ_I00622                   80.1    3e-15   Eucalyptus grandis [rose gum]
ref|XP_007144301.1|  hypothetical protein PHAVU_007G144700g           80.9    3e-15   Phaseolus vulgaris [French bean]
ref|XP_008456566.1|  PREDICTED: probable phytol kinase 1, chlorop...  80.9    4e-15   Cucumis melo [Oriental melon]
ref|WP_012164598.1|  phosphatidate cytidylyltransferase               79.3    1e-14   Acaryochloris marina
ref|XP_006436584.1|  hypothetical protein CICLE_v10032240mg           79.3    1e-14   Citrus clementina [clementine]
ref|NP_001239775.1|  probable phytol kinase 1, chloroplastic          79.3    1e-14   Glycine max [soybeans]
ref|XP_004138682.1|  PREDICTED: probable phytol kinase 1, chlorop...  79.0    2e-14   
gb|KGN63038.1|  hypothetical protein Csa_2G385070                     78.6    2e-14   Cucumis sativus [cucumbers]
ref|XP_011024295.1|  PREDICTED: probable phytol kinase 1, chlorop...  78.2    3e-14   Populus euphratica
ref|XP_003556292.1|  PREDICTED: probable phytol kinase 1, chlorop...  77.8    4e-14   Glycine max [soybeans]
ref|XP_011094481.1|  PREDICTED: probable phytol kinase 1, chlorop...  77.4    6e-14   Sesamum indicum [beniseed]
ref|XP_004307151.1|  PREDICTED: phytol kinase 1, chloroplastic        76.6    1e-13   Fragaria vesca subsp. vesca
ref|XP_011398499.1|  putative phytol kinase 1, chloroplastic          74.3    4e-13   Auxenochlorella protothecoides
gb|KEH43364.1|  phytol kinase                                         75.1    5e-13   Medicago truncatula
ref|XP_004234914.1|  PREDICTED: probable phytol kinase 1, chlorop...  74.7    7e-13   
ref|XP_004496158.1|  PREDICTED: probable phytol kinase 1, chlorop...  74.3    8e-13   Cicer arietinum [garbanzo]
ref|XP_010552940.1|  PREDICTED: phytol kinase 1, chloroplastic        74.3    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_008375637.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.9    1e-12   
ref|XP_010067215.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.9    1e-12   Eucalyptus grandis [rose gum]
ref|XP_008218941.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.2    1e-12   Prunus mume [ume]
ref|XP_009361416.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.6    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_002970593.1|  hypothetical protein SELMODRAFT_411298           71.2    2e-12   
ref|XP_010906566.1|  PREDICTED: probable phytol kinase, chloropla...  72.8    2e-12   Elaeis guineensis
ref|XP_003580789.1|  PREDICTED: probable phytol kinase, chloropla...  73.2    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_008218940.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.2    2e-12   Prunus mume [ume]
ref|XP_009591844.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.9    2e-12   Nicotiana tomentosiformis
ref|XP_009783010.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.2    2e-12   Nicotiana sylvestris
ref|XP_010906565.1|  PREDICTED: probable phytol kinase, chloropla...  73.2    3e-12   Elaeis guineensis
ref|XP_010067173.1|  PREDICTED: probable phytol kinase 1, chlorop...  73.2    3e-12   Eucalyptus grandis [rose gum]
gb|EEE61880.1|  hypothetical protein OsJ_16572                        72.8    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007218720.1|  hypothetical protein PRUPE_ppa009034mg           72.8    3e-12   Prunus persica
ref|XP_006364440.1|  PREDICTED: probable phytol kinase 1, chlorop...  72.4    4e-12   Solanum tuberosum [potatoes]
ref|XP_010423571.1|  PREDICTED: phytol kinase 1, chloroplastic-like   72.4    5e-12   Camelina sativa [gold-of-pleasure]
sp|Q7XR51.1|PHYK1_ORYSJ  RecName: Full=Probable phytol kinase 1, ...  72.4    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|WP_013560255.1|  phosphatidate cytidylyltransferase               71.6    5e-12   Anaerolinea thermophila
ref|XP_006364441.1|  PREDICTED: probable phytol kinase 1, chlorop...  72.4    5e-12   
ref|XP_010490961.1|  PREDICTED: phytol kinase 1, chloroplastic        72.4    5e-12   Camelina sativa [gold-of-pleasure]
gb|KDP45055.1|  hypothetical protein JCGZ_01555                       72.4    5e-12   Jatropha curcas
gb|ACP43458.1|  phytol kinase                                         72.4    5e-12   Lactuca sativa [cultivated lettuce]
ref|XP_002447301.1|  hypothetical protein SORBIDRAFT_06g032370        71.6    7e-12   Sorghum bicolor [broomcorn]
ref|NP_001105847.1|  probable phytol kinase, chloroplastic precursor  71.6    7e-12   Zea mays [maize]
ref|XP_001694607.1|  phytol kinase-related protein                    71.6    7e-12   Chlamydomonas reinhardtii
ref|XP_002532923.1|  Phytol kinase 1, chloroplast precursor, puta...  70.9    9e-12   
gb|AIE88275.1|  hypothetical protein OG_BBa0063K01.6                  71.6    9e-12   Oryza glaberrima
ref|XP_002871097.1|  hypothetical protein ARALYDRAFT_325092           70.9    1e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_006398907.1|  hypothetical protein EUTSA_v10014196mg           70.5    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010452347.1|  PREDICTED: phytol kinase 1, chloroplastic-like   70.5    2e-11   Camelina sativa [gold-of-pleasure]
ref|NP_196069.1|  phytol kinase 1                                     70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61593.1|  unknown                                               70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288296.1|  hypothetical protein CARUB_v10001540mg           70.1    2e-11   Capsella rubella
gb|AAO42044.1|  unknown protein                                       70.1    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795886.1|  PREDICTED: probable phytol kinase, chloropla...  70.1    3e-11   Phoenix dactylifera
ref|XP_009396489.1|  PREDICTED: probable phytol kinase, chloropla...  70.5    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO99832.1|  unnamed protein product                              70.5    3e-11   Coffea canephora [robusta coffee]
ref|XP_008795888.1|  PREDICTED: probable phytol kinase, chloropla...  69.3    4e-11   
ref|XP_009130827.1|  PREDICTED: phytol kinase 1, chloroplastic-like   69.3    5e-11   Brassica rapa
ref|XP_008805007.1|  PREDICTED: probable phytol kinase 2, chlorop...  67.8    7e-11   
ref|XP_006588439.1|  PREDICTED: probable phytol kinase 1, chlorop...  68.2    7e-11   Glycine max [soybeans]
gb|ABA42672.1|  phytol kinase                                         68.2    9e-11   Zea mays [maize]
gb|KJB20421.1|  hypothetical protein B456_003G147500                  67.0    1e-10   Gossypium raimondii
ref|XP_001418836.1|  predicted protein                                67.8    1e-10   Ostreococcus lucimarinus CCE9901
gb|AFW84692.1|  hypothetical protein ZEAMMB73_467064                  67.0    1e-10   
gb|KJB60479.1|  hypothetical protein B456_009G307400                  67.4    1e-10   Gossypium raimondii
emb|CDY69673.1|  BnaCnng64700D                                        68.2    1e-10   Brassica napus [oilseed rape]
ref|XP_009774666.1|  PREDICTED: probable phytol kinase 3, chlorop...  65.1    2e-10   Nicotiana sylvestris
ref|XP_010278283.1|  PREDICTED: probable phytol kinase, chloropla...  68.2    2e-10   Nelumbo nucifera [Indian lotus]
gb|KJB60478.1|  hypothetical protein B456_009G307400                  67.8    2e-10   Gossypium raimondii
ref|XP_004344106.1|  phytol kinase 2, putative                        66.6    2e-10   Acanthamoeba castellanii str. Neff
gb|EPS60714.1|  phytol kinase                                         66.6    3e-10   Genlisea aurea
emb|CBI40186.3|  unnamed protein product                              67.0    3e-10   Vitis vinifera
gb|KHG03995.1|  putative phytol kinase 1, chloroplastic               67.4    4e-10   Gossypium arboreum [tree cotton]
ref|XP_002269950.1|  PREDICTED: probable phytol kinase 1, chlorop...  67.0    4e-10   Vitis vinifera
ref|XP_006838740.1|  hypothetical protein AMTR_s00002p00254420        65.5    7e-10   
gb|KHN00934.1|  Putative phytol kinase 1, chloroplastic               65.1    8e-10   Glycine soja [wild soybean]
emb|CDY44860.1|  BnaC09g50600D                                        65.9    8e-10   Brassica napus [oilseed rape]
ref|XP_007010114.1|  Vitamin E pathway gene 5 isoform 1               66.2    8e-10   
ref|XP_007010115.1|  Vitamin E pathway gene 5 isoform 2               66.2    8e-10   
ref|XP_004960241.1|  PREDICTED: probable phytol kinase 2, chlorop...  65.9    9e-10   Setaria italica
ref|XP_002955247.1|  hypothetical protein VOLCADRAFT_45651            64.3    1e-09   Volvox carteri f. nagariensis
ref|XP_011098893.1|  PREDICTED: probable phytol kinase 3, chlorop...  64.7    1e-09   Sesamum indicum [beniseed]
gb|KFK24895.1|  hypothetical protein AALP_AA8G038700                  65.5    1e-09   Arabis alpina [alpine rockcress]
ref|XP_010665627.1|  PREDICTED: probable phytol kinase 1, chlorop...  65.5    1e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009122590.1|  PREDICTED: phytol kinase 1, chloroplastic-like   65.5    1e-09   Brassica rapa
ref|XP_010906567.1|  PREDICTED: probable phytol kinase 1, chlorop...  64.7    1e-09   
ref|XP_005770298.1|  hypothetical protein EMIHUDRAFT_436338           63.9    2e-09   Emiliania huxleyi CCMP1516
ref|XP_005773265.1|  hypothetical protein EMIHUDRAFT_369009           63.5    3e-09   Emiliania huxleyi CCMP1516
ref|WP_040625197.1|  phosphatidate cytidylyltransferase               62.8    5e-09   
emb|CDP04896.1|  unnamed protein product                              61.6    5e-09   Coffea canephora [robusta coffee]
ref|WP_026735418.1|  phosphatidate cytidylyltransferase               62.4    6e-09   Fischerella sp. PCC 9605
ref|XP_003057921.1|  predicted protein                                62.8    6e-09   Micromonas pusilla CCMP1545
ref|XP_004996012.1|  hypothetical protein PTSG_03426                  62.4    7e-09   Salpingoeca rosetta
gb|EYU45411.1|  hypothetical protein MIMGU_mgv1a012281mg              62.8    7e-09   Erythranthe guttata [common monkey flower]
ref|XP_002500009.1|  predicted protein                                62.0    1e-08   Micromonas commoda
ref|XP_009804931.1|  PREDICTED: probable phytol kinase 2, chlorop...  60.1    1e-08   Nicotiana sylvestris
ref|WP_016859908.1|  phosphatidate cytidylyltransferase               61.2    2e-08   Fischerella muscicola
gb|EWM22868.1|  phosphatidate cytidylyltransferase                    61.2    3e-08   Nannochloropsis gaditana
ref|WP_026723041.1|  phosphatidate cytidylyltransferase               60.1    5e-08   Fischerella sp. PCC 9431
ref|XP_007514499.1|  predicted protein                                60.8    7e-08   Bathycoccus prasinos
ref|XP_008795887.1|  PREDICTED: probable phytol kinase, chloropla...  60.1    8e-08   Phoenix dactylifera
ref|WP_008082386.1|  phosphatidate cytidylyltransferase               60.1    9e-08   Aciduliprofundum boonei
ref|WP_008085193.1|  phosphatidate cytidylyltransferase               59.7    1e-07   Aciduliprofundum boonei
sp|Q2N2K3.1|PHYK_WHEAT  RecName: Full=Probable phytol kinase, chl...  60.1    1e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005854647.1|  hypothetical protein NGA_2086500                 60.1    1e-07   Nannochloropsis gaditana CCMP526
gb|EWM28810.1|  Phosphatidate cytidylyltransferase                    60.1    1e-07   Nannochloropsis gaditana
ref|XP_005781745.1|  hypothetical protein EMIHUDRAFT_99736            59.7    1e-07   Emiliania huxleyi CCMP1516
ref|XP_005777419.1|  hypothetical protein EMIHUDRAFT_469241           59.7    2e-07   Emiliania huxleyi CCMP1516
ref|WP_015283132.1|  dolichol kinase                                  58.9    2e-07   Aciduliprofundum sp. MAR08-339
ref|XP_009396497.1|  PREDICTED: probable phytol kinase, chloropla...  59.3    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005645987.1|  hypothetical protein COCSUDRAFT_53992            57.8    3e-07   Coccomyxa subellipsoidea C-169
ref|XP_005850569.1|  hypothetical protein CHLNCDRAFT_140477           58.2    4e-07   Chlorella variabilis
gb|AFW84693.1|  hypothetical protein ZEAMMB73_467064                  55.5    9e-07   
gb|EMT05709.1|  Putative phytol kinase 2, chloroplastic               57.0    1e-06   
ref|WP_017309557.1|  phosphatidate cytidylyltransferase               56.2    1e-06   Fischerella sp. PCC 9339
tpg|DAA35442.1|  TPA: hypothetical protein ZEAMMB73_657762            55.1    1e-06   
emb|CDP05574.1|  unnamed protein product                              55.1    1e-06   Coffea canephora [robusta coffee]
ref|WP_016874337.1|  phosphatidate cytidylyltransferase               56.2    1e-06   Chlorogloeopsis fritschii
ref|XP_002970346.1|  hypothetical protein SELMODRAFT_411288           53.9    2e-06   
sp|Q2N2K2.1|PHYK2_SOYBN  RecName: Full=Probable phytol kinase 2, ...  55.5    4e-06   Glycine max [soybeans]
ref|XP_010042655.1|  PREDICTED: probable phytol kinase 3, chlorop...  53.1    4e-06   
ref|XP_005818786.1|  hypothetical protein GUITHDRAFT_149059           54.7    8e-06   Guillardia theta CCMP2712
gb|KCW57523.1|  hypothetical protein EUGRSUZ_H00292                   52.4    8e-06   Eucalyptus grandis [rose gum]
ref|WP_041041323.1|  phosphatidate cytidylyltransferase               53.9    9e-06   Tolypothrix campylonemoides
ref|XP_004977650.1|  PREDICTED: probable phytol kinase 2, chlorop...  53.5    1e-05   
emb|CBJ48773.1|  Probable phytol kinase, chloroplast precursor, c...  54.3    1e-05   Ectocarpus siliculosus
ref|XP_002968111.1|  hypothetical protein SELMODRAFT_440293           53.1    1e-05   
ref|WP_016865492.1|  phosphatidate cytidylyltransferase               53.1    2e-05   Fischerella muscicola
gb|EFA81634.1|  hypothetical protein PPL_05626                        52.4    2e-05   Heterostelium album PN500
ref|XP_005706670.1|  phosphatidate cytidylyltransferase/ phytol k...  53.1    2e-05   Galdieria sulphuraria
emb|CBK19603.2|  unnamed protein product                              51.6    3e-05   Blastocystis hominis
ref|WP_017318032.1|  phosphatidate cytidylyltransferase               52.0    4e-05   Mastigocladopsis repens
ref|XP_011400679.1|  putative phytol kinase 3, chloroplastic          52.0    5e-05   Auxenochlorella protothecoides
ref|XP_003080172.1|  Predicted ER membrane protein (ISS)              52.0    6e-05   Ostreococcus tauri
ref|WP_010933646.1|  phosphatidate cytidylyltransferase               51.6    6e-05   Chlorobaculum tepidum
ref|WP_009455416.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  51.6    6e-05   Fischerella thermalis
ref|WP_011357002.1|  phosphatidate cytidylyltransferase               51.6    6e-05   Pelodictyon luteolum
tpg|DAA35444.1|  TPA: hypothetical protein ZEAMMB73_657762            50.4    7e-05   
ref|XP_010042654.1|  PREDICTED: uncharacterized protein LOC104431...  51.6    7e-05   Eucalyptus grandis [rose gum]
emb|CDY11294.1|  BnaA03g01300D                                        50.8    8e-05   Brassica napus [oilseed rape]
ref|XP_005538511.1|  hypothetical protein, conserved                  51.6    1e-04   Cyanidioschyzon merolae strain 10D
ref|XP_003289382.1|  hypothetical protein DICPUDRAFT_88483            50.4    1e-04   Dictyostelium purpureum
ref|NP_001140612.1|  uncharacterized protein LOC100272684             49.7    2e-04   Zea mays [maize]
ref|XP_002946158.1|  hypothetical protein VOLCADRAFT_55632            50.1    2e-04   Volvox carteri f. nagariensis
gb|AFW64553.1|  hypothetical protein ZEAMMB73_110888                  49.3    3e-04   
gb|AFW64554.1|  hypothetical protein ZEAMMB73_110888                  49.7    4e-04   
ref|XP_010556037.1|  PREDICTED: probable phytol kinase 2, chlorop...  47.0    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_004960242.1|  PREDICTED: probable phytol kinase 2, chlorop...  49.3    4e-04   
tpg|DAA35440.1|  TPA: hypothetical protein ZEAMMB73_657762            47.8    6e-04   
ref|WP_041467762.1|  phosphatidate cytidylyltransferase               48.5    8e-04   Chlorobium phaeobacteroides
gb|KIE09019.1|  phosphatidate cytidylyltransferase                    48.1    9e-04   Tolypothrix bouteillei VB521301
gb|ABL66347.1|  phosphatidate cytidylyltransferase                    48.1    0.001   
ref|WP_012501506.1|  phosphatidate cytidylyltransferase               48.1    0.001   



>ref|XP_009591334.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
tomentosiformis]
Length=294

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            ++ S+     MF  NPV GDL+A+ LSGGIA S LR WEE AKRG FDQ  NRKLVH+S+
Sbjct  44   RLHSEVRPKAMFLENPVTGDLIATALSGGIALSMLRLWEETAKRGVFDQKTNRKLVHISI  103

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWPMFSSGRQGA++AALIPGLNI K+LLLGLG+ KDD TVKSMSRFGD+RELLK
Sbjct  104  GLVFMLCWPMFSSGRQGAILAALIPGLNIIKMLLLGLGLWKDDATVKSMSRFGDHRELLK  163

Query  510  GPLYYAITITLACAV  554
            GPLYYA TITLACAV
Sbjct  164  GPLYYAFTITLACAV  178



>ref|XP_009790459.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
sylvestris]
Length=298

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            ++ S+     MF  NPV+GDL+A+ LSGGIA S LR WEE AKRG FDQ  NRKLVH+S+
Sbjct  48   RLHSEVRPKAMFLENPVMGDLIATALSGGIALSMLRLWEETAKRGVFDQKTNRKLVHISI  107

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWPMFSSGRQGA++A+LIPGLNI K+LLLGLG+ KDD TVKSMSRFGD+RELLK
Sbjct  108  GLVFMLCWPMFSSGRQGAILASLIPGLNIIKMLLLGLGLWKDDATVKSMSRFGDHRELLK  167

Query  510  GPLYYAITITLACAV  554
            GPLYYA TITLACAV
Sbjct  168  GPLYYAFTITLACAV  182



>ref|XP_004246260.1| PREDICTED: probable phytol kinase 3, chloroplastic [Solanum lycopersicum]
Length=293

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFML  347
            V   MFS N ++GDL+A+ LSGGIA S LRFWEE AKRG FDQ  NRKLVH+S+G+VFML
Sbjct  49   VHFAMFSENLLIGDLIATTLSGGIALSILRFWEETAKRGVFDQKTNRKLVHISIGLVFML  108

Query  348  CWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYA  527
            CWPMFSSG+QGA++AA IPGLNI K+ LLGLGI KDD TVKSMSRFGD+RELLKGPLYYA
Sbjct  109  CWPMFSSGQQGAILAAFIPGLNIIKMFLLGLGIWKDDATVKSMSRFGDHRELLKGPLYYA  168

Query  528  ITITLACAV  554
            ++IT ACA+
Sbjct  169  LSITCACAI  177



>gb|ADZ24711.1| phytol kinase [Solanum pennellii]
Length=293

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFML  347
            V   MFS N ++GDL+A+ LSGGIA S LRFWEE AKRG FDQ  NRKLVH+S+G+VFML
Sbjct  49   VHFAMFSENLLIGDLIATALSGGIALSILRFWEETAKRGVFDQKTNRKLVHISIGLVFML  108

Query  348  CWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYA  527
            CWPMFSSG+QGA++AA IPGLNI K+ LLGLGI KDD TVKSMSRFGD+RELLKGPLYYA
Sbjct  109  CWPMFSSGQQGAILAAFIPGLNIIKMFLLGLGIWKDDATVKSMSRFGDHRELLKGPLYYA  168

Query  528  ITITLACAV  554
            ++IT ACA+
Sbjct  169  LSITCACAI  177



>ref|XP_006354090.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Solanum 
tuberosum]
Length=293

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFML  347
            V   MFS NP++GDL+A+  SGGIA S LR WEE AKRG FDQ  NRKLVH+S+G+VFML
Sbjct  49   VHFAMFSENPLIGDLIATAFSGGIALSMLRLWEETAKRGVFDQKTNRKLVHISIGLVFML  108

Query  348  CWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYA  527
            CWPMFSSG+QGA++AA IPGLNI K+LLLGLGI KDD TVKSMSRFGD+RELLKGPLYYA
Sbjct  109  CWPMFSSGQQGAILAAFIPGLNIIKMLLLGLGIWKDDATVKSMSRFGDHRELLKGPLYYA  168

Query  528  ITITLACAV  554
             +IT ACA+
Sbjct  169  FSITYACAI  177



>emb|CDP09225.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MFS NPVVGD+VA+ L+GGIA S LRFW EIAK G  DQ LNRKLVHVS+G+VFMLCWPM
Sbjct  1    MFSENPVVGDVVAAALTGGIALSMLRFWGEIAKMGVLDQKLNRKLVHVSIGLVFMLCWPM  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GA++AALIPG+NI K+LLLGLG+ +D+ TVKSMSRFGD+RELLKGPLYYA TIT
Sbjct  61   FSSGNRGAVLAALIPGVNIIKVLLLGLGVYEDEATVKSMSRFGDHRELLKGPLYYATTIT  120

Query  540  LACAV  554
            LACA+
Sbjct  121  LACAL  125



>ref|XP_011098894.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=292

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MFSG  VV D +A+ LSGGIA S L+ WE+ AKRG FDQ LNRKLVHV++G+ FMLCWPM
Sbjct  52   MFSGTTVVSDAIATGLSGGIALSLLKIWEQTAKRGVFDQKLNRKLVHVTVGLAFMLCWPM  111

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGA++AALIPG+NI K+LLLGLGI KDD TVKSMSRFGDYRELLKGPLYYA TIT
Sbjct  112  FSSGRQGAILAALIPGINIIKMLLLGLGIWKDDATVKSMSRFGDYRELLKGPLYYASTIT  171

Query  540  LACAV  554
            LA A+
Sbjct  172  LASAI  176



>ref|XP_002516647.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45742.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=304

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  165  AVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFM  344
            AV  TM   NP+V DL A+ LSG IA S LR W+E A RG FDQ LNRKLVH+S+G+VFM
Sbjct  59   AVRATMLHQNPIVSDLCATGLSGAIALSVLRLWKETAIRGIFDQKLNRKLVHISIGLVFM  118

Query  345  LCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
            LCWP+FSSG QGA++AAL PG+NIF++LLLGLGI KD+ TVKSMSRFGD+RELLKGPLYY
Sbjct  119  LCWPLFSSGHQGAILAALTPGVNIFRMLLLGLGIWKDEATVKSMSRFGDHRELLKGPLYY  178

Query  525  AITITLACAV  554
            A+TITLACA+
Sbjct  179  ALTITLACAI  188



>gb|EYU45412.1| hypothetical protein MIMGU_mgv1a010789mg [Erythranthe guttata]
Length=301

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MFS N  VGDLVA+ LSGGIA S L+ WEE AKRG FDQ LNRK+VHV++G+ FMLCWPM
Sbjct  61   MFSNNTAVGDLVATGLSGGIALSLLKIWEETAKRGVFDQKLNRKIVHVTVGLAFMLCWPM  120

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGA+VAALIPG+NI K+LLLGLGI KD+ TVKSMSRFG+++ELLKGPLYYA TIT
Sbjct  121  FSSGRQGAIVAALIPGINIVKMLLLGLGIWKDEATVKSMSRFGNHKELLKGPLYYAATIT  180

Query  540  LACAV  554
            LA A+
Sbjct  181  LAGAI  185



>gb|KJB83903.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=212

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  NPV  D  A+V+SG IA S LR W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAVISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            +SSG +GA++AA+ PG+NI +++L+G G+ KD+ TVK+MSR+GDYRELLKGP+YYA TIT
Sbjct  126  YSSGYRGAILAAITPGVNIIRMILIGSGLWKDEATVKAMSRYGDYRELLKGPVYYATTIT  185

Query  540  LACA  551
            LACA
Sbjct  186  LACA  189



>gb|KHG05203.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=306

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  NPV  D  A+++SG IA S LR W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAIISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            +SSG +GA++AA+ PG+NI +++L+G G+ KD+ TVKSMSR+GDYRELLKGPLYYA TIT
Sbjct  126  YSSGYRGAILAAITPGVNIMRMILIGSGLWKDEATVKSMSRYGDYRELLKGPLYYATTIT  185

Query  540  LACA  551
            LACA
Sbjct  186  LACA  189



>gb|KDP45737.1| hypothetical protein JCGZ_17344 [Jatropha curcas]
Length=297

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  171  GLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLC  350
             ++M   NPVV DL A+ L+G IA S LR W+E AKR  FDQ LNRKLVH+S+G+VFMLC
Sbjct  54   AVSMLHQNPVVSDLCATGLAGAIALSLLRVWQETAKRRLFDQKLNRKLVHISIGLVFMLC  113

Query  351  WPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAI  530
            WP+FSSG +GA++AAL PG+NIF++L+LGLGI KD+ TVKSMSRFGD+RELLKGPLYYA+
Sbjct  114  WPLFSSGHRGAILAALTPGINIFRMLILGLGIWKDEATVKSMSRFGDHRELLKGPLYYAL  173

Query  531  TITLACAV  554
            TITL CA+
Sbjct  174  TITLTCAI  181



>gb|KJB83901.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=248

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  NPV  D  A+V+SG IA S LR W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAVISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            +SSG +GA++AA+ PG+NI +++L+G G+ KD+ TVK+MSR+GDYRELLKGP+YYA TIT
Sbjct  126  YSSGYRGAILAAITPGVNIIRMILIGSGLWKDEATVKAMSRYGDYRELLKGPVYYATTIT  185

Query  540  LACA  551
            LACA
Sbjct  186  LACA  189



>gb|KJB83902.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=306

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  NPV  D  A+V+SG IA S LR W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAVISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            +SSG +GA++AA+ PG+NI +++L+G G+ KD+ TVK+MSR+GDYRELLKGP+YYA TIT
Sbjct  126  YSSGYRGAILAAITPGVNIIRMILIGSGLWKDEATVKAMSRYGDYRELLKGPVYYATTIT  185

Query  540  LACA  551
            LACA
Sbjct  186  LACA  189



>ref|XP_010028018.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=148

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG+A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGVALTVLRSFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+AALI G+NI ++LLLG GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT
Sbjct  61   FSSGHRGALLAALILGVNIIRMLLLGSGIWKDEATVKSMTRFGDRRELLEGPLFYVLTIT  120

Query  540  LACA  551
             ACA
Sbjct  121  FACA  124



>ref|XP_002299996.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
 gb|EEE84801.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
Length=241

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV DL+A+ LSG IA S LR +EE AKR  FDQ LNRKL+H+S+G+VFMLCWPM
Sbjct  1    MLHQNPVVSDLIATGLSGTIALSFLRSFEETAKRHIFDQKLNRKLMHISIGLVFMLCWPM  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+AA IPGLNI ++LL+G G+ KD+ TVKSMSRFGD RELLKGPLYYA+TIT
Sbjct  61   FSSGLRGALLAACIPGLNIIRMLLIGSGMWKDEATVKSMSRFGDRRELLKGPLYYALTIT  120

Query  540  LACAV  554
            +ACA+
Sbjct  121  VACAI  125



>ref|XP_007016938.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34557.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=250

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  NPV+ D+ A+V+SG +A S LR W+E AKR   DQ LNRKLVH+S+G+VFMLCWP+
Sbjct  67   IFPQNPVLSDVCATVISGFVALSVLRVWQETAKRRLCDQKLNRKLVHISIGLVFMLCWPL  126

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GA++AA+ PG+NI ++LL+G G+ KD+ TVKSMSR+GDYRELLKGPLYYA TIT
Sbjct  127  FSSGYRGAILAAITPGVNIIRMLLIGSGLWKDEATVKSMSRYGDYRELLKGPLYYATTIT  186

Query  540  LACAV  554
            LACA+
Sbjct  187  LACAL  191



>ref|XP_002313238.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87193.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=313

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            ++   + M   NPVV DL+A+ LSG IA S LRF+ E  KR  FDQ LNRKLVH+S+G+V
Sbjct  66   TKIAAVAMLHQNPVVSDLIATGLSGTIALSILRFFAETTKRHVFDQKLNRKLVHISIGLV  125

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            FMLCWP+FSSGR+GAL AA  PG+NI ++LL+G G+ KD+ TVKSMSRFGD RELLKGPL
Sbjct  126  FMLCWPIFSSGRRGALFAAFTPGVNIIQILLIGSGMWKDEATVKSMSRFGDRRELLKGPL  185

Query  519  YYAITITLACAV  554
            YYA+TIT ACA+
Sbjct  186  YYALTITGACAI  197



>ref|XP_011025082.1| PREDICTED: probable phytol kinase 3, chloroplastic [Populus euphratica]
Length=294

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  174  LTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCW  353
            + M   NPVV DL+A+ LSG IA S LR +EE AKR  FDQ LNRKL+H+S+G+VFMLCW
Sbjct  52   VAMLHQNPVVSDLIATGLSGIIALSFLRSFEETAKRRIFDQKLNRKLLHISIGLVFMLCW  111

Query  354  PMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
            PMFSSG QGAL+AA IPGLNI ++LL+G G+ KD+  VKSMSRFGD RELLKGPLYYA+T
Sbjct  112  PMFSSGHQGALLAACIPGLNIIRMLLIGSGMWKDEAMVKSMSRFGDRRELLKGPLYYALT  171

Query  534  ITLACAV  554
            IT+ACA+
Sbjct  172  ITVACAI  178



>ref|XP_007016939.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY34558.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=307

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  NPV+ D+ A+V+SG +A S LR W+E AKR   DQ LNRKLVH+S+G+VFMLCWP+
Sbjct  67   IFPQNPVLSDVCATVISGFVALSVLRVWQETAKRRLCDQKLNRKLVHISIGLVFMLCWPL  126

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GA++AA+ PG+NI ++LL+G G+ KD+ TVKSMSR+GDYRELLKGPLYYA TIT
Sbjct  127  FSSGYRGAILAAITPGVNIIRMLLIGSGLWKDEATVKSMSRYGDYRELLKGPLYYATTIT  186

Query  540  LACAV  554
            LACA+
Sbjct  187  LACAL  191



>ref|XP_010069238.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57520.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=241

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPV+ D +A+ ++GGIA S LR +EE AKRG FDQ LNRKLVHVS+G++FMLCWP+
Sbjct  1    MLHENPVLSDALAAAVTGGIALSSLRLFEETAKRGLFDQKLNRKLVHVSIGIIFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG + AL+AA +PGLNI ++LL+G GI KD+  VKSMSRFGD+RELLKGPLYYA TIT
Sbjct  61   FSSGHRSALLAATVPGLNIIRVLLVGSGIWKDEAIVKSMSRFGDHRELLKGPLYYASTIT  120

Query  540  LACA  551
             ACA
Sbjct  121  FACA  124



>ref|XP_007205802.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
 gb|EMJ07001.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
Length=241

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D+ A+ ++GG+A   L  WEE AKRG+FDQ LNRK VHVS+G+VFMLCWP+
Sbjct  1    MLPQNPVVADICATFIAGGVALFFLLLWEETAKRGFFDQKLNRKFVHVSIGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG QGA +A+L PG+NIF++LLLGLGI KD+ TVKS+SR GDYRELLKGPLYYA TIT
Sbjct  61   FSSGLQGAFLASLTPGINIFRMLLLGLGIWKDEATVKSISRSGDYRELLKGPLYYATTIT  120

Query  540  LACAV  554
            LAC +
Sbjct  121  LACII  125



>gb|KCW54677.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=227

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+AALIPG+NI ++LLLG GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT
Sbjct  61   FSSGHRGALLAALIPGVNIIRMLLLGSGIWKDEATVKSMTRFGDRRELLEGPLFYVLTIT  120

Query  540  LACA  551
             ACA
Sbjct  121  FACA  124



>ref|XP_009369583.1| PREDICTED: probable phytol kinase 2, chloroplastic [Pyrus x bretschneideri]
Length=326

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TM   NPVV D  A+ ++GG+A   L  W+E AKRG FDQ LNRKLVHVS+G+VFMLCWP
Sbjct  85   TMLPENPVVADTCAAFIAGGVALFFLLLWQETAKRGIFDQKLNRKLVHVSIGLVFMLCWP  144

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSG QGA  A+L PGLNIF++LLLGLGI KD+ TVKSMSR+GD+RELLKGPLYYA TI
Sbjct  145  LFSSGLQGAFFASLTPGLNIFRMLLLGLGIWKDEATVKSMSRYGDHRELLKGPLYYATTI  204

Query  537  TLACAV  554
            TLAC V
Sbjct  205  TLACLV  210



>ref|XP_010028019.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW54676.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=241

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+AALIPG+NI ++LLLG GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT
Sbjct  61   FSSGHRGALLAALIPGVNIIRMLLLGSGIWKDEATVKSMTRFGDRRELLEGPLFYVLTIT  120

Query  540  LACA  551
             ACA
Sbjct  121  FACA  124



>ref|XP_006280848.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
 gb|EOA13746.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
Length=307

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  156  RSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGM  335
            RS ++   MF GN V+ DL A  ++G +AFSCL FW EI KRG FDQ L RKLVH+++G+
Sbjct  59   RSSSLAAVMFPGNSVLSDLSACGITGIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGL  118

Query  336  VFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGP  515
            VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLKGP
Sbjct  119  VFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGP  178

Query  516  LYYAITITLAC  548
            LYYA++IT+AC
Sbjct  179  LYYALSITVAC  189



>ref|XP_010520194.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=309

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +3

Query  3    AVIPTPFSLVNPKSDFLTYFSPPLLASSVCHCHASStlrnttitrrirrKVRSQAVGL-T  179
            +++P+PF  V+  S  L  F  P++ S   H     T R        R   RS    L  
Sbjct  11   SLLPSPF--VDSSSLSLPRFPSPIVPSLPLHFATRCTFRARFPLTTSRISRRSLTPSLAV  68

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  NPV+ D+ AS ++  IAF+CLRFW E  KRG FDQ L RKLVHVS+G VFMLCWP+
Sbjct  69   MFPDNPVLSDVCASGITTVIAFACLRFWGEFGKRGIFDQKLVRKLVHVSVGPVFMLCWPL  128

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GA++A+L+PG NI + LLLGLG+  D+GT+KSMSR+GD RELLKGPLYYA+ IT
Sbjct  129  FSSGLRGAVLASLVPGGNIIRTLLLGLGVYHDEGTIKSMSRYGDRRELLKGPLYYALAIT  188

Query  540  LACA  551
            L+CA
Sbjct  189  LSCA  192



>ref|XP_008457339.1| PREDICTED: probable phytol kinase 2, chloroplastic [Cucumis melo]
Length=322

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 117/173 (68%), Gaps = 8/173 (5%)
 Frame = +3

Query  51   LTYFSPPLLASSVCHCHASStlrnttitrrirrKVRSQ-------AVGLTMFSGNPVVGD  209
            L++ SPP L S   H H S        +R    + RS+          + +F  NPVV D
Sbjct  33   LSFPSPPQLFSLHSHPHFSFLSTPIFPSRTFSLRFRSKIRRKHCSVAAVMLFPENPVVSD  92

Query  210  LVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALV  389
            + A+ LS G+A S L+ W E AKRG  DQ LNRKLVH+S+G+ FMLCWPMFSSG QGA+ 
Sbjct  93   ICATALSSGVALSLLQLWVETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFSSGYQGAIF  151

Query  390  AAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
            A+LIPG N+ ++L+LG GILKD+ T+KSMSR+GDYRELLKGPLYY  TITL C
Sbjct  152  ASLIPGANVIRMLVLGFGILKDEATLKSMSRYGDYRELLKGPLYYVATITLVC  204



>ref|XP_008384758.1| PREDICTED: probable phytol kinase 2, chloroplastic [Malus domestica]
Length=325

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = +3

Query  150  KVRSQAVGLT-----MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKL  314
            K RS+   LT     M   NPVV D  A+ ++GG+A   L  W+E AKRG FDQ LNRK 
Sbjct  70   KPRSRRRQLTSTPAXMLPENPVVADTCAAFIAGGVALFFLLLWQETAKRGIFDQKLNRKF  129

Query  315  VHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDY  494
            VHVS+G+VFMLCWP+FSSG QGA  A+L PGLNIF++LLLGLGI KD+ TVKSMSR+GD+
Sbjct  130  VHVSIGLVFMLCWPLFSSGLQGAFFASLTPGLNIFRMLLLGLGIWKDEATVKSMSRYGDH  189

Query  495  RELLKGPLYYAITITLACAV  554
            RELLKGPLYYA TITLAC V
Sbjct  190  RELLKGPLYYATTITLACLV  209



>ref|XP_010089521.1| putative phytol kinase 3 [Morus notabilis]
 gb|EXB37960.1| putative phytol kinase 3 [Morus notabilis]
Length=454

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MFS N VV D+ A+  +  +A S LR W E AKRG FDQ LNRKLVH+S+G+VFMLCWP+
Sbjct  85   MFSQNAVVSDIFAAAFTACVALSLLRVWGETAKRGLFDQKLNRKLVHISVGLVFMLCWPL  144

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FS G +GA +AA +PG+NI ++LLLGLGI KD+ TVKSMSRFGDYRELLKGPLYYA TIT
Sbjct  145  FSPGSRGAFLAASVPGVNIIRMLLLGLGIWKDEATVKSMSRFGDYRELLKGPLYYATTIT  204

Query  540  LACAV  554
            LAC +
Sbjct  205  LACII  209



>ref|XP_004294311.1| PREDICTED: probable phytol kinase 2, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 131/191 (69%), Gaps = 7/191 (4%)
 Frame = +3

Query  3    AVIPTPFSLVNP--KSDFLTYFSPPLLA-----SSVCHCHASStlrnttitrrirrKVRS  161
            A +PTP SL+     S  LTYF+  LL      +S+     ++TLR      R+ R+ R 
Sbjct  10   ARLPTPCSLLPQFGHSPPLTYFTSTLLCLRLTPASIPDSLPAATLRYPITDLRVPRRRRV  69

Query  162  QAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVF  341
             +    M   N V  D+ A+ +SGG+A   L  WE+ AKRG FDQ LNRKLVH+S+G+VF
Sbjct  70   TSAPAAMLPENAVAADICATAISGGVATFFLLLWEQTAKRGVFDQKLNRKLVHISIGLVF  129

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            MLCWP+FSSG QGAL+A+LIPGLNI ++LLLGLGI+KD+ TVKSMSR+ DYRELLKGPLY
Sbjct  130  MLCWPLFSSGYQGALLASLIPGLNIIRMLLLGLGIMKDEATVKSMSRYNDYRELLKGPLY  189

Query  522  YAITITLACAV  554
            YA  IT AC V
Sbjct  190  YATAITWACVV  200



>ref|XP_010443595.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=303

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            S A    MF  N V+ DL A  ++G +AFSCL FW EI KRG+FDQ L RKLVH+++G+V
Sbjct  56   SLAAAAVMFPENSVLSDLSACGITGIVAFSCLTFWGEIGKRGFFDQKLIRKLVHINIGLV  115

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            FMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLKGPL
Sbjct  116  FMLCWPLFSSGIQGALFASLVPGLNIIRVLLLGLGVYHDEGTIKSMSRHGDRRELLKGPL  175

Query  519  YYAITITLAC  548
            YYA++IT+AC
Sbjct  176  YYALSITVAC  185



>ref|XP_010453909.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=307

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            S A    MF  N V+ DL A  ++G IAFSCL FW EI KRG+FDQ L RKLVH+++G+V
Sbjct  60   SFAAAAVMFPENSVLSDLSACGITGIIAFSCLTFWGEIGKRGFFDQKLIRKLVHINIGLV  119

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            FMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLKGPL
Sbjct  120  FMLCWPLFSSGIQGALFASLVPGLNIIRVLLLGLGVYHDEGTIKSMSRHGDRRELLKGPL  179

Query  519  YYAITITLAC  548
            YYA++IT+AC
Sbjct  180  YYALSITVAC  189



>ref|XP_011003752.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Populus euphratica]
Length=310

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +3

Query  162  QAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVF  341
            +   + M   NPVV DL+A+ LS  IA S LRF+ E  KR  FDQ LNRKLVH+S+G+VF
Sbjct  64   KIAAVAMLHQNPVVSDLIATGLSATIALSILRFFAETTKRHVFDQKLNRKLVHISIGLVF  123

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            ML WP+FSSG +GAL+AAL PG+NI ++LL+G G  KD+ TVKSMSRFGD RELLKGPLY
Sbjct  124  MLWWPIFSSGHRGALLAALTPGVNIIRMLLIGSGTWKDEATVKSMSRFGDRRELLKGPLY  183

Query  522  YAITITLACAV  554
            YA+TIT ACA+
Sbjct  184  YALTITGACAI  194



>ref|XP_008221407.1| PREDICTED: probable phytol kinase 3, chloroplastic [Prunus mume]
Length=325

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPVV D+ A+ ++GG+A   L  WEE AKRG FDQ LNRK VHVS+G+VFMLCWP+FSSG
Sbjct  89   NPVVADICATFIAGGVALFFLLLWEETAKRGVFDQKLNRKCVHVSIGLVFMLCWPLFSSG  148

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             +GA +A+L PG+NIF++LLLGLGI KD+ TVKS+SR+GDYRELLKGPLYYA TITLAC 
Sbjct  149  LRGAFLASLTPGINIFRMLLLGLGIWKDEATVKSISRYGDYRELLKGPLYYATTITLACI  208

Query  552  V  554
            +
Sbjct  209  I  209



>ref|XP_006401067.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
 gb|ESQ42520.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
Length=308

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M  GN V+ DL A+ +S  +AFSCL FW EI KRG FDQ L RKLVH+++G+VFMLCWP+
Sbjct  67   MLPGNSVLSDLCATGISSVVAFSCLSFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  126

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG QGAL A+L+PGLNI ++LLLGLG+ KD+GT+KSMSR GD RELLKGPLYYA++IT
Sbjct  127  FSSGLQGALFASLVPGLNIIRMLLLGLGVYKDEGTIKSMSRHGDRRELLKGPLYYALSIT  186

Query  540  LAC  548
             AC
Sbjct  187  SAC  189



>ref|XP_006387375.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
 gb|ERP46289.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
Length=174

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  MFSG-NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            M++G NPVV DL ++V+S  + F+ L+ W+E AK G  DQ LNRKLVH+S+G+VFMLCWP
Sbjct  1    MWTGSNPVVSDLCSAVVSAVVIFAFLQLWKETAKHG-LDQKLNRKLVHISIGLVFMLCWP  59

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSGR+GAL AA  PG+NI ++LL+G G+ KD+ TVKSMSRFGD RELLKGPLYYA+TI
Sbjct  60   IFSSGRRGALFAAFTPGVNIIQMLLIGSGMWKDEATVKSMSRFGDRRELLKGPLYYALTI  119

Query  537  TLACAV  554
            T ACA+
Sbjct  120  TGACAI  125



>ref|XP_007016937.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34556.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=352

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 109/135 (81%), Gaps = 3/135 (2%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            ++ SQ   LT  + NPVV DL+A+ +  G+ F+ L  W+E AKRG  DQ LNRKLVH+S+
Sbjct  105  QLSSQFWKLT--NKNPVVSDLLAAAVCCGVIFAFLLLWQETAKRG-LDQKLNRKLVHISI  161

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G G+ KD+ TVKSMSR+GDYRELLK
Sbjct  162  GLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGSGLWKDEATVKSMSRYGDYRELLK  221

Query  510  GPLYYAITITLACAV  554
            GPLYYA TITLACA+
Sbjct  222  GPLYYATTITLACAL  236



>emb|CDY66208.1| BnaCnng49970D [Brassica napus]
Length=302

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  N V+ D+ AS ++  +A SCL FW EI KRG+FDQ L RKLVH+++G+VFMLCWP+
Sbjct  61   MFPDNSVLSDVCASGITSVVAVSCLGFWGEIGKRGFFDQKLIRKLVHINIGLVFMLCWPL  120

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGAL+A+L+PGLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGPLYYA++IT
Sbjct  121  FSSGRQGALLASLVPGLNIVRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPLYYALSIT  180

Query  540  LAC  548
             AC
Sbjct  181  SAC  183



>gb|KEH34361.1| phytol kinase [Medicago truncatula]
Length=301

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TMF  +P V D VA+ +SG +AFSCL  ++E AKRG FDQ LNRKLVH+++G+VFMLCWP
Sbjct  60   TMFHHDPFVSDFVATGISGVVAFSCLGLFKETAKRGLFDQKLNRKLVHITIGLVFMLCWP  119

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +F +GR     AA IPG+NI ++ ++G GILKD+ TVKSMSRFGDYRELL+GPLYYA TI
Sbjct  120  LFGNGRWAPFYAAFIPGVNILRMFVIGSGILKDEATVKSMSRFGDYRELLRGPLYYAATI  179

Query  537  TLACAV  554
            TLA  +
Sbjct  180  TLASMI  185



>ref|XP_004500293.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TMF  +P V D++A+ +SG +AFS LR W+E AKR  FDQ LNRKLVH+++G++F+LCWP
Sbjct  62   TMFHHDPFVSDILATAVSGVVAFSALRLWQETAKRRLFDQKLNRKLVHITIGLLFILCWP  121

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS+ + G+  AA IP +N+ ++L++GLGI KDD TVKSMSRFGD+RELLKGPLYYA TI
Sbjct  122  LFSTDKWGSYFAAFIPAVNVLRMLVIGLGIWKDDATVKSMSRFGDHRELLKGPLYYAATI  181

Query  537  TLACAV  554
            T A  +
Sbjct  182  TFASII  187



>ref|XP_007146804.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
 gb|ESW18798.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
Length=311

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TM   +P+V D+ A+ +S  +A S LR W+E AKRG FDQ LNRKLVH+S+G++FMLCWP
Sbjct  70   TMLHHDPLVSDIYATAISATVALSLLRLWQETAKRGIFDQKLNRKLVHLSIGLMFMLCWP  129

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS+G   A  AALIPG+NI ++++ GLG++KD+ TVKSMSRFGD+RELLKGPLYYA TI
Sbjct  130  LFSTGNMAAFFAALIPGVNIIRMIVTGLGLVKDEATVKSMSRFGDHRELLKGPLYYATTI  189

Query  537  TLACAV  554
            TLA  +
Sbjct  190  TLASII  195



>gb|KCW54682.1| hypothetical protein EUGRSUZ_I00621 [Eucalyptus grandis]
Length=191

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 11/135 (8%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG+A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGVALTVLRSFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  F-----------SSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELL  506
            F           SSG +GAL+AALI G+NI ++LLLG GI KD+ TVKSM+RFGD RELL
Sbjct  61   FSLARRLLLINCSSGHRGALLAALILGVNIIRMLLLGSGIWKDEATVKSMTRFGDRRELL  120

Query  507  KGPLYYAITITLACA  551
            +GPL+Y +TIT ACA
Sbjct  121  EGPLFYVLTITFACA  135



>ref|XP_004145246.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004153718.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172407.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65833.1| hypothetical protein Csa_1G533400 [Cucumis sativus]
Length=322

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 119/173 (69%), Gaps = 8/173 (5%)
 Frame = +3

Query  51   LTYFSPPLLASSVCHCH----ASStlrnttitrrirrKVRSQ---AVGLTMFSGNPVVGD  209
            L++ SPP L S   H H    ++    + T + R   K+R +      +  F  NPVV D
Sbjct  33   LSFPSPPQLFSLHSHPHFPFLSTPIFPSPTFSLRFPSKIRRKHCPVSAVMFFPENPVVSD  92

Query  210  LVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALV  389
            + A+ LS G+A S L+ W E AKRG  DQ LNRKLVH+S+G+ FMLCWPMFSSG QGA++
Sbjct  93   ICATALSSGVALSLLQLWAETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFSSGYQGAIL  151

Query  390  AAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
            A+LIPG N+ ++LLLG GILKD+ T+KSMSR+GDYRELLKGPLYY  TIT  C
Sbjct  152  ASLIPGANVMRMLLLGFGILKDEATLKSMSRYGDYRELLKGPLYYVATITFVC  204



>ref|XP_010483456.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=304

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  N V+ DL A  +SG IAFSCL FW EI KR +FDQ L RKLVH+++G+VFMLCWP+
Sbjct  64   MFPENSVLSDLSACGISGIIAFSCLTFWGEIGKRRFFDQKLIRKLVHINIGLVFMLCWPL  123

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLKGPLYYA++IT
Sbjct  124  FSSGIQGALFASLVPGLNIIRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGPLYYALSIT  183

Query  540  LAC  548
            +AC
Sbjct  184  VAC  186



>ref|XP_009132278.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic 
[Brassica rapa]
Length=269

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            ++  QAV   MF  N V+ D+ A+ +SG +AFS L FW EI KRG FDQ L RKLVH+++
Sbjct  21   RLTQQAV---MFPENSVLSDVCATGISGVVAFSXLGFWGEIGKRGIFDQKLIRKLVHINI  77

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VF LCWP+FSSG QGAL A+LI G+NI ++LLLGLG+ +D+GT+KSMSR GD RELLK
Sbjct  78   GLVFTLCWPLFSSGLQGALFASLIIGVNIIRMLLLGLGVYQDEGTIKSMSRHGDRRELLK  137

Query  510  GPLYYAITITLAC  548
            GPLYYAI +TLAC
Sbjct  138  GPLYYAIAVTLAC  150



>ref|XP_009120370.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=302

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  N V+ D+ AS ++  +A SCL FW EI KRG FDQ L RKLVH+++G+VFMLCWP+
Sbjct  61   MFPDNSVLSDVCASGITSVVAVSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  120

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGAL+A+L+PGLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGPLYYA++IT
Sbjct  121  FSSGRQGALLASLVPGLNIVRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPLYYALSIT  180

Query  540  LAC  548
             AC
Sbjct  181  SAC  183



>emb|CDY67806.1| BnaA10g29300D [Brassica napus]
Length=303

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  N V+ D+ AS ++  +A SCL FW EI KRG FDQ L RKLVH+++G+VFMLCWP+
Sbjct  62   MFPDNSVLSDVCASGITSVVAVSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  121

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGAL+A+L+PGLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGPLYYA++IT
Sbjct  122  FSSGRQGALLASLVPGLNIVRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPLYYALSIT  181

Query  540  LAC  548
             AC
Sbjct  182  SAC  184



>dbj|BAD43853.1| unknown protein [Arabidopsis thaliana]
Length=307

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FDQ L RKLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLK
Sbjct  117  GLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGVYHDEGTIKSMSRHGDRRELLK  176

Query  510  GPLYYAITITLAC  548
            GPLYY ++IT AC
Sbjct  177  GPLYYVLSITSAC  189



>ref|XP_009132038.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=309

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            + ++   MF  N V+ D+ A+ +SG +AFSCL FW EI KRG FDQ L RKLVH+++G+V
Sbjct  61   TSSLAAVMFPENSVLSDVCATGISGVVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLV  120

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            F+LCWP+FSSG QGAL A+LIPGLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGP 
Sbjct  121  FILCWPLFSSGLQGALFASLIPGLNIIRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPF  180

Query  519  YYAITITLAC  548
            YYA++IT AC
Sbjct  181  YYALSITSAC  190



>ref|NP_200664.1| farnesol kinase [Arabidopsis thaliana]
 sp|Q67ZM7.2|PHYK2_ARATH RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD43980.1| unknown protein [Arabidopsis thaliana]
 gb|AED97069.1| farnesol kinase [Arabidopsis thaliana]
Length=307

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FDQ L RKLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLK
Sbjct  117  GLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGVYHDEGTIKSMSRHGDRRELLK  176

Query  510  GPLYYAITITLAC  548
            GPLYY ++IT AC
Sbjct  177  GPLYYVLSITSAC  189



>gb|AAM65097.1| unknown [Arabidopsis thaliana]
Length=307

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FDQ L RKLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLK
Sbjct  117  GLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGVYHDEGTIKSMSRHGDRRELLK  176

Query  510  GPLYYAITITLAC  548
            GPLYY ++IT AC
Sbjct  177  GPLYYVLSITSAC  189



>emb|CDY70799.1| BnaAnng35070D [Brassica napus]
Length=309

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            + ++   MF  N V+ D+ A+ +SG +AFSCL FW EI KRG FDQ L RKLVH+++G+V
Sbjct  61   ASSLAAVMFPENSVLSDVCATGISGVVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLV  120

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            F+LCWP+FSSG QGA  A+LIPGLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGPL
Sbjct  121  FILCWPLFSSGLQGAFFASLIPGLNIIRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPL  180

Query  519  YYAITITLAC  548
            YYA++IT AC
Sbjct  181  YYALSITSAC  190



>gb|AFK48670.1| unknown [Lotus japonicus]
Length=315

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TM   +P VG++ A+ +SG +A S LR WEE A RG FDQ LNRKLVHVS+G+ F+ CWP
Sbjct  74   TMLHHDPFVGNIYATAISGVVALSFLRLWEETATRGLFDQKLNRKLVHVSIGLAFIFCWP  133

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            ++S  +  +L AALIPG+NI ++L +GLGILKD+GTVKSMSRFGDYRELLKGPLYYA TI
Sbjct  134  LYSDDKWASLFAALIPGVNILRMLFIGLGILKDEGTVKSMSRFGDYRELLKGPLYYAATI  193

Query  537  TLACAV  554
            TLA  +
Sbjct  194  TLAAVL  199



>ref|XP_010264775.1| PREDICTED: probable phytol kinase 2, chloroplastic, partial [Nelumbo 
nucifera]
Length=271

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPV  D   + L+ G+AFS LRFW EIAKRG  ++ +NRKLVH+S+G+VF+L WP+FSSG
Sbjct  35   NPVFNDFFIAALAAGVAFSLLRFWGEIAKRGLLEKTMNRKLVHISIGLVFLLFWPLFSSG  94

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             QGA +AAL+PG+NI ++LL+GLGI KD+ TVKSMSR GDYRELLKGPLYYA TITLA  
Sbjct  95   PQGAYLAALVPGVNIIRMLLIGLGIWKDEATVKSMSRSGDYRELLKGPLYYASTITLASV  154

Query  552  V  554
            V
Sbjct  155  V  155



>ref|XP_004500292.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TMF  +P V D++A+ +SG +AFS LR W+E AKR  FDQ LNRKLVH+++G++F+ CWP
Sbjct  62   TMFHHDPFVSDILATAVSGVVAFSALRLWQETAKRRLFDQKLNRKLVHITIGLLFIFCWP  121

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS+ + G+  AA IP +N+ +LL++GLGI KDD  VKSMSRFGD+RELLKGPLYYA T+
Sbjct  122  LFSTDKWGSYFAAFIPAVNVLRLLVIGLGIWKDDAEVKSMSRFGDHRELLKGPLYYAATL  181

Query  537  TLACAV  554
            T A  +
Sbjct  182  TFASII  187



>ref|XP_011003760.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
 ref|XP_011003768.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
Length=241

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  MFSG-NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            M++G NPVV DL ++V+S  + F+ L+ W+E AK G  DQ LNRKLVH+S+G+VFML WP
Sbjct  1    MWTGSNPVVSDLCSAVVSAVVIFAFLQLWKETAKHG-LDQKLNRKLVHISIGLVFMLWWP  59

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSG +GAL+AAL PG+NI ++LL+G G  KD+ TVKSMSRFGD RELLKGPLYYA+TI
Sbjct  60   IFSSGHRGALLAALTPGVNIIRMLLIGSGTWKDEATVKSMSRFGDRRELLKGPLYYALTI  119

Query  537  TLACAV  554
            T ACA+
Sbjct  120  TGACAI  125



>ref|XP_002313239.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87194.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=237

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 102/126 (81%), Gaps = 6/126 (5%)
 Frame = +3

Query  180  MFSGN-PVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            M++GN PVV DL ++V    + F+ L+ W+E AK G  DQ LNRKLVH+S+G+VFMLCWP
Sbjct  1    MWTGNNPVVSDLCSAV----VIFAFLQLWKETAKHG-LDQKLNRKLVHISIGLVFMLCWP  55

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSGR+GAL AA  PG+NI ++LL+G G+ KD+ TVKSMSRFGD RELLKGPLYYA+TI
Sbjct  56   IFSSGRRGALFAAFTPGVNIIQILLIGSGMWKDEATVKSMSRFGDRRELLKGPLYYALTI  115

Query  537  TLACAV  554
            T ACA+
Sbjct  116  TGACAI  121



>ref|XP_010503534.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=242

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRG-YFDQNLNRKLVHVSMGMVFMLCWP  356
            MF  N V+ D+ A  + G I FSCL FW EI KRG  FDQ L RK VH+++G+VF+LCWP
Sbjct  1    MFPKNTVLSDISACGIFGIITFSCLSFWGEIGKRGGIFDQKLIRKFVHINIGLVFLLCWP  60

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSG QGAL A+++ GLNI ++LLLGLG+  D+GT+KSMSR GD RELLKGPLYYA++I
Sbjct  61   LFSSGIQGALFASIVTGLNIIRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGPLYYALSI  120

Query  537  TLACAV  554
            TLAC V
Sbjct  121  TLACIV  126



>ref|XP_010689412.1| PREDICTED: probable phytol kinase 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   N V+ D+ A+++SG +A + L  WE  AK G FD  LNRKLVH S+G+VFMLCWP+
Sbjct  68   MLPENAVMSDICATLISGAVAGATLALWEVTAKYGVFDSKLNRKLVHTSIGIVFMLCWPL  127

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+A+LIPG+NI ++LL+G GI KD+ TVKSMSR+GDYRELLKGPLYY ++IT
Sbjct  128  FSSGYRGALLASLIPGVNIIRMLLIGSGIYKDEATVKSMSRYGDYRELLKGPLYYVLSIT  187

Query  540  LACAV  554
             AC V
Sbjct  188  FACIV  192



>dbj|BAA97326.1| unnamed protein product [Arabidopsis thaliana]
Length=517

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSM  329
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FDQ L RKLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  330  GMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
            G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLK
Sbjct  117  GLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGVYHDEGTIKSMSRHGDRRELLK  176

Query  510  GPLYYAITITLAC  548
            GPLYY ++IT AC
Sbjct  177  GPLYYVLSITSAC  189



>gb|EPS57827.1| hypothetical protein M569_16990, partial [Genlisea aurea]
Length=253

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MFS N +  DLVA+ LSG IA S L+FWE+ AK G  DQ LNRKLVH+++G  FMLCWPM
Sbjct  22   MFSDNTLTSDLVATGLSGVIALSLLKFWEKTAKMG-VDQKLNRKLVHITVGSTFMLCWPM  80

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FS G QGAL AALIP  ++ K+ L+GLGI KD+ TVKSMSR+GD+RELLKGPLYY  TI 
Sbjct  81   FSVGNQGALFAALIPIASMIKVGLIGLGIWKDEATVKSMSRYGDHRELLKGPLYYGATIA  140

Query  540  LA  545
            L+
Sbjct  141  LS  142



>ref|XP_010426391.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=240

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRG-YFDQNLNRKLVHVSMGMVFMLCWP  356
            MF  N V+ D+ A  + G I FSCLRFW EI KRG  FDQ L RK VH+++G+VF+LCWP
Sbjct  1    MFPKNTVLSDISACGIFGIITFSCLRFWGEIGKRGGIFDQKLIRKFVHINIGLVFLLCWP  60

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS G QGAL A+++PGLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGPLYYA++I
Sbjct  61   LFSYGIQGALFASIVPGLNILRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPLYYALSI  120

Query  537  TLAC  548
            TLAC
Sbjct  121  TLAC  124



>ref|XP_010520844.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=268

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  N V+ D+ A+  S  +AF+CL FW E+ KRG  DQ L RKLVH+++G+VFMLCWP+
Sbjct  28   MFPENLVLSDVCATGFSTAVAFTCLSFWGEVGKRGILDQTLIRKLVHINIGLVFMLCWPL  87

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FS G QGA++A+L+PG+NI ++LLLGLG+  D+GT+KSMSR GD RELLKGPLYYA +IT
Sbjct  88   FSPGLQGAVLASLVPGVNIIRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGPLYYASSIT  147

Query  540  LAC  548
            LAC
Sbjct  148  LAC  150



>gb|ACU24460.1| unknown [Glycine max]
Length=318

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TM   +P+V D+ A+ +SG +A S LR ++E AKR  FDQ LNRKLVH+S+G++FMLCWP
Sbjct  77   TMLHHDPLVSDVYATAISGVVALSFLRLFQETAKRDLFDQKLNRKLVHISIGLIFMLCWP  136

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS+    +  AALIPG+NIF++L++GLGILKD+ TVKSMSRFGDYRELLKGPLYYA TI
Sbjct  137  LFSTETWASFFAALIPGINIFRMLVIGLGILKDEATVKSMSRFGDYRELLKGPLYYAATI  196

Query  537  TLACAV  554
            TLA  +
Sbjct  197  TLAAII  202



>gb|KFK27385.1| hypothetical protein AALP_AA8G375800 [Arabis alpina]
Length=308

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   N V+ D+ A+ +S  +AFSCL FW EI KRG FDQ L RKLVH+++G+VFMLCWP+
Sbjct  67   MLPENSVLSDVCATGISSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  126

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG QGAL A+L+PGLNI ++LLLG G+  D+GT+KSMSR GD RELL GPLYYA++IT
Sbjct  127  FSSGLQGALFASLVPGLNIIRMLLLGFGVYHDEGTIKSMSRHGDRRELLTGPLYYALSIT  186

Query  540  LAC  548
             AC
Sbjct  187  SAC  189



>gb|KHN02090.1| Putative phytol kinase 3, chloroplastic [Glycine soja]
Length=322

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TM   +P+V D+ A+ +SG +A S LR ++E AKR  FDQ LNRKLVH+S+G++FMLCWP
Sbjct  81   TMLHHDPLVSDVYATAISGVVALSFLRLFQETAKRDLFDQKLNRKLVHISIGLIFMLCWP  140

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS+    +  AALIPG+NIF++L++GLGILKD+ TVKSMSRFGDYRELLKGPLYYA TI
Sbjct  141  LFSTETWASFFAALIPGINIFRMLVIGLGILKDEATVKSMSRFGDYRELLKGPLYYAATI  200

Query  537  TLACAV  554
            TLA  +
Sbjct  201  TLAAII  206



>gb|KJB20420.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=240

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   N +V DL ASV+  G+ F+ L  W+  AK G  DQ LNRKLVH+S+G+VFMLCWP+
Sbjct  1    MLYENSLVSDLFASVVCCGVIFAFLLLWQVTAKCG-VDQKLNRKLVHISIGLVFMLCWPL  59

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FS+G +GA++AA+ PG+NI ++LL+G GI KD+ TVKSMSR+G+YRELLKGPLYYAIT+T
Sbjct  60   FSAGYRGAILAAITPGVNIIRMLLIGSGIWKDEATVKSMSRYGNYRELLKGPLYYAITVT  119

Query  540  LACAV  554
            LAC V
Sbjct  120  LACVV  124



>emb|CBI15917.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPV GD+ A+ L+G  A S LRFW EIAKRG+FDQ + RKLVH+S+G+VFML WP+
Sbjct  1    MLPQNPVAGDICAAALTGAAALSLLRFWGEIAKRGFFDQTVGRKLVHISVGLVFMLFWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGA++AALIPG+NI ++LLLGLGI KD+  VKSMSR GD+RELLKGPLYYA  IT
Sbjct  61   FSSGRQGAVLAALIPGVNIIRMLLLGLGIWKDEAIVKSMSRHGDHRELLKGPLYYASAIT  120

Query  540  LACAV  554
            LACA+
Sbjct  121  LACAI  125



>ref|XP_002278580.2| PREDICTED: probable phytol kinase 2, chloroplastic [Vitis vinifera]
Length=309

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPV GD+ A+ L+G  A S LRFW EIAKRG+FDQ + RKLVH+S+G+VFML WP+
Sbjct  69   MLPQNPVAGDICAAALTGAAALSLLRFWGEIAKRGFFDQTVGRKLVHISVGLVFMLFWPL  128

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSGRQGA++AALIPG+NI ++LLLGLGI KD+  VKSMSR GD+RELLKGPLYYA  IT
Sbjct  129  FSSGRQGAVLAALIPGVNIIRMLLLGLGIWKDEAIVKSMSRHGDHRELLKGPLYYASAIT  188

Query  540  LACAV  554
            LACA+
Sbjct  189  LACAI  193



>ref|XP_010028020.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=244

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  LTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCW  353
            + M   N V+ D +A+ ++GGI       +EE AKRG FDQ LNRKLVHVS+G+VFMLCW
Sbjct  2    VIMLHQNSVMSDALATAVTGGIILLVCLLFEETAKRGLFDQKLNRKLVHVSVGLVFMLCW  61

Query  354  PMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
            P+FSS  +GAL+AA IPG NI ++LL+G GI KD+ TVKSMSRFGD RELL+GPLYY + 
Sbjct  62   PLFSSEHRGALLAATIPGFNIIRMLLVGSGIWKDEATVKSMSRFGDRRELLEGPLYYVLM  121

Query  534  ITLACA  551
            IT ACA
Sbjct  122  ITFACA  127



>gb|KDO66966.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=244

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +   NPV+ D+ AS +S  +A SCLR WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+
Sbjct  50   LLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPL  109

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GA++A+L PG+NI ++LL+G G+ KD+ TVKSMSR+GD RELL GPLYYAITIT
Sbjct  110  FSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITIT  169

Query  540  LACAV  554
            LAC +
Sbjct  170  LACVI  174



>gb|KHG27084.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=240

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   N +V DL A+V+  G+ F+ L  W+  AK G  DQ LNRKLVH+S+G+VFMLCWP+
Sbjct  1    MLYENSLVSDLFAAVVCCGVIFAFLLLWQVTAKCG-VDQKLNRKLVHISIGLVFMLCWPL  59

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FS+G +GA++AA+ PG+NI ++LL+G GI KD+ TVKSMSR+G+YRELLKGPLYYAIT+T
Sbjct  60   FSAGYRGAILAAITPGVNIIRMLLIGSGIWKDEATVKSMSRYGNYRELLKGPLYYAITVT  119

Query  540  LACAV  554
            LAC V
Sbjct  120  LACVV  124



>ref|XP_006425113.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38353.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=284

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPV+ D+ AS +S  +A S LR WEE A+R  FDQ LNRKLVH+S+G+VFMLCWP+FSSG
Sbjct  54   NPVLSDVCASAVSAAVAASSLRLWEETARRDLFDQKLNRKLVHISIGLVFMLCWPLFSSG  113

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             +GA++A+L PG+NI ++LL+G G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC 
Sbjct  114  PRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACV  173

Query  552  V  554
            +
Sbjct  174  I  174



>gb|KDO66964.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=254

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPV+ D+ AS +S  +A SCLR WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG
Sbjct  54   NPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSG  113

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             +GA++A+L PG+NI ++LL+G G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC 
Sbjct  114  PRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACV  173

Query  552  V  554
            +
Sbjct  174  I  174



>ref|XP_002278563.2| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Vitis vinifera]
Length=241

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPV GD+ A+ L+GG   S ++FW  IAKRG+  Q ++RK VH+S+G+VFML WP+
Sbjct  1    MLPQNPVAGDICAAALTGGTVLSLIQFWGGIAKRGFTGQTVSRKFVHISVGLVFMLFWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+AALIPG+NI ++LLLGLGI KD+  VKSMSR+GD+RELLKGPL YA+ IT
Sbjct  61   FSSGCRGALLAALIPGVNIIRMLLLGLGIWKDEAVVKSMSRYGDHRELLKGPLCYALAIT  120

Query  540  LACAV  554
            LACA+
Sbjct  121  LACAI  125



>ref|XP_006425114.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38354.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=290

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPV+ D+ AS +S  +A S LR WEE A+R  FDQ LNRKLVH+S+G+VFMLCWP+FSSG
Sbjct  54   NPVLSDVCASAVSAAVAASSLRLWEETARRDLFDQKLNRKLVHISIGLVFMLCWPLFSSG  113

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             +GA++A+L PG+NI ++LL+G G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC 
Sbjct  114  PRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACV  173

Query  552  V  554
            +
Sbjct  174  I  174



>ref|XP_010910062.1| PREDICTED: probable phytol kinase 2, chloroplastic [Elaeis guineensis]
Length=307

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            +M   +P+V D+ AS ++ G+A   LRFWEE+AKRG F+Q LNRKLVH+S+G+ FML WP
Sbjct  66   SMSPESPLVHDVCASAVTAGVALGLLRFWEELAKRGVFEQKLNRKLVHISIGLAFMLFWP  125

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSG +   +AA+ PG+N  +++L+GLGIL++D  VKSMSR GDYRELLKGP YYA TI
Sbjct  126  LFSSGSRAPFLAAVAPGINAIRMVLMGLGILRNDAMVKSMSRHGDYRELLKGPFYYACTI  185

Query  537  TLACAV  554
            TLA ++
Sbjct  186  TLATSI  191



>ref|XP_006488562.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Citrus 
sinensis]
Length=293

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPV+ D+ AS +S  +A SCLR WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG
Sbjct  57   NPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSG  116

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             +GA++A+L PG+NI ++LL+G G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC 
Sbjct  117  PRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACV  176

Query  552  V  554
            +
Sbjct  177  I  177



>gb|KDO66965.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=290

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NPV+ D+ AS +S  +A SCLR WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG
Sbjct  54   NPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSG  113

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             +GA++A+L PG+NI ++LL+G G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC 
Sbjct  114  PRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACV  173

Query  552  V  554
            +
Sbjct  174  I  174



>emb|CBI15916.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPV GD+ A+ L+GG   S ++FW  IAKRG+  Q ++RK VH+S+G+VFML WP+
Sbjct  53   MLPQNPVAGDICAAALTGGTVLSLIQFWGGIAKRGFTGQTVSRKFVHISVGLVFMLFWPL  112

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG +GAL+AALIPG+NI ++LLLGLGI KD+  VKSMSR+GD+RELLKGPL YA+ IT
Sbjct  113  FSSGCRGALLAALIPGVNIIRMLLLGLGIWKDEAVVKSMSRYGDHRELLKGPLCYALAIT  172

Query  540  LACAV  554
            LACA+
Sbjct  173  LACAI  177



>ref|XP_008811675.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=299

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            +M   +P+  D+ AS ++ G+A   LRFWEE+AKRG F+Q LNRKLVH+S+G+ FML WP
Sbjct  58   SMSPESPLFRDVCASAVTAGVALGLLRFWEELAKRGVFEQKLNRKLVHISIGLAFMLFWP  117

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FSSG Q   +AAL PG+N  ++LL+GLGI ++D  VKS+SR GDYRELLKGPLYYA TI
Sbjct  118  LFSSGSQAPYLAALAPGINAIRMLLMGLGIWRNDAMVKSISRNGDYRELLKGPLYYACTI  177

Query  537  TLACAV  554
            TLA +V
Sbjct  178  TLATSV  183



>ref|XP_010412644.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=265

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRG-YFDQNLNRKLVHVSMGMVFMLCW  353
             MF  N V+ D+ A  + G I FSCL FW EI KRG  FDQ L RKLVH+++G+VF+LCW
Sbjct  22   VMFPKNTVLSDISACGIFGIITFSCLSFWGEIGKRGGIFDQKLIRKLVHINIGLVFLLCW  81

Query  354  -PMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAI  530
             P+FSSG QGAL A+++PGLNI ++LLLGLG+  D+GT+KSMSR GD RELLKGPLYYA+
Sbjct  82   RPLFSSGIQGALFASIVPGLNILRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGPLYYAL  141

Query  531  TITLAC  548
            +ITLAC
Sbjct  142  SITLAC  147



>emb|CDY65783.1| BnaA03g56270D [Brassica napus]
Length=321

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 105/142 (74%), Gaps = 12/142 (8%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQ------------NL  302
            + ++   MF  N V+ D+ A+ +SG +AFSCL FW EI KRG FDQ             L
Sbjct  61   ASSLAAVMFPENSVLSDVCATGISGVVAFSCLGFWGEIGKRGIFDQYVLSDLGLKQNIKL  120

Query  303  NRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSR  482
             RKLVH+++G+VF+LCWP+FSSG QGAL A+LIPGLNI ++LLLGLG+ +D+GT+KSMSR
Sbjct  121  IRKLVHINIGLVFILCWPLFSSGLQGALFASLIPGLNIIRMLLLGLGVYQDEGTIKSMSR  180

Query  483  FGDYRELLKGPLYYAITITLAC  548
             GD RELLKGP YYA++IT AC
Sbjct  181  HGDRRELLKGPFYYALSITSAC  202



>ref|NP_001242263.1| probable phytol kinase 3, chloroplastic [Glycine max]
 sp|Q2N2K0.1|PHYK3_SOYBN RecName: Full=Probable phytol kinase 3, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42677.1| phytol kinase [Glycine max]
Length=319

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  177  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWP  356
            TM   +P+V D+ A+ +SG +A S LR ++E AKR  FDQ LNRKLVH+S+G++FMLC P
Sbjct  78   TMLHHDPLVSDVYATAISGVVALSFLRLFQETAKRDLFDQKLNRKLVHISIGLIFMLCXP  137

Query  357  MFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            +FS+    +  AALIPG+NIF++L++GLGILKD+ TVKSMSRFGDYRELLKGPLYYA TI
Sbjct  138  LFSTETWASFFAALIPGINIFRMLVIGLGILKDEATVKSMSRFGDYRELLKGPLYYAATI  197

Query  537  TLACAV  554
            TLA  +
Sbjct  198  TLAAII  203



>ref|XP_003564535.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=310

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DLV+S ++ G+A + LRF+EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSGR    
Sbjct  79   DLVSSAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGRYAPF  138

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +AAL PG+NI ++LLLGLGI+K++  VKSMSR GD+RELLKGPLYYA TIT A +V
Sbjct  139  LAALAPGINIVRMLLLGLGIMKNEAMVKSMSRSGDHRELLKGPLYYATTITFATSV  194



>ref|XP_006292344.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
 gb|EOA25242.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
Length=207

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            MF  N VV D  A  + G I FSCL FW EI KRG  DQ L RKLVH+++G+VF+LCWP+
Sbjct  1    MFPKNSVVTDSSACGIFGVITFSCLSFWGEIGKRGILDQKLIRKLVHINIGLVFLLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAI  530
            FSSG QGAL A+L+ GLNI ++LLLGLG+  D+GT+KSM+R GD RELLKGPLYY +
Sbjct  61   FSSGIQGALFASLVTGLNIIRMLLLGLGVYHDEGTIKSMTRHGDRRELLKGPLYYVL  117



>ref|XP_006847435.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
 gb|ERN09016.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
Length=241

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   N VV D+ A+ ++ G A   LRFW+E+AKRG FDQ LNRKLVH+S+G+VFML WP+
Sbjct  1    MLPENQVVRDVAAAAIAAGAALGLLRFWDEMAKRGVFDQKLNRKLVHISVGLVFMLFWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITIT  539
            FSSG + A +AAL PG+NI +++LLGLGI+K++  VKSMSR+GD+RELLKGPLYYA TIT
Sbjct  61   FSSGHEAAYLAALAPGINIIRMILLGLGIMKNENMVKSMSRYGDHRELLKGPLYYACTIT  120

Query  540  LACAV  554
            LA AV
Sbjct  121  LATAV  125



>ref|NP_001130181.1| uncharacterized protein LOC100191275 [Zea mays]
 ref|XP_008657098.1| PREDICTED: probable phytol kinase 2, chloroplastic [Zea mays]
 gb|ACF78326.1| unknown [Zea mays]
 gb|ACF84542.1| unknown [Zea mays]
Length=312

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            + A  +++ +G  +  DL ++V++GG+A + L+F+EE+AKRG F+Q L+RKLVH+S+G+V
Sbjct  65   TMAAAISLEAGGALAHDLGSAVVTGGVALALLKFFEELAKRGVFEQKLSRKLVHISVGLV  124

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            FML WP+FSSG     +AAL PG+NI ++LLLGLG++K++  VKSMSR GDYRELLKGPL
Sbjct  125  FMLFWPLFSSGWYTPFLAALAPGVNIIRMLLLGLGLMKNEAMVKSMSRSGDYRELLKGPL  184

Query  519  YYAITITLACAV  554
            YYA TIT A ++
Sbjct  185  YYAATITFATSL  196



>gb|ADE76360.1| unknown [Picea sitchensis]
Length=375

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N +V D++AS L+  +A +CLRFW+E+AKR  FDQ LNRK VH+S+G++FML WP+FS+G
Sbjct  139  NQIVHDIIASALTALVALACLRFWDEMAKRDVFDQKLNRKFVHISIGLIFMLFWPVFSTG  198

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
             Q   +AAL PGLNIF+++ LGLGILK++  VKSMSR G+ RELLKGPLYYA TITL   
Sbjct  199  PQAPYLAALAPGLNIFRMIGLGLGILKNEAMVKSMSRHGNARELLKGPLYYASTITLVTV  258

Query  552  V  554
            +
Sbjct  259  I  259



>gb|KCW54679.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=118

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYR  497
            FSSG +GAL+AALIPG+NI ++LLLG GI KD+ TVKSM+RFGD R
Sbjct  61   FSSGHRGALLAALIPGVNIIRMLLLGSGIWKDEATVKSMTRFGDRR  106



>emb|CDM84848.1| unnamed protein product [Triticum aestivum]
Length=312

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            +V DLV+S ++  IA   LRF+EE+AKRG  DQ LNRKLVH+++GMVF+L WP+FSSGR 
Sbjct  78   LVHDLVSSGVTAAIALGLLRFFEELAKRGVCDQKLNRKLVHITIGMVFLLFWPLFSSGRY  137

Query  378  GALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
                AAL PG+NI ++LLLGLGI+K++  VKSMSR GD+RELLKGPLYYA TITLA +V
Sbjct  138  APFFAALAPGINIIRMLLLGLGIMKNEAMVKSMSRSGDHRELLKGPLYYATTITLATSV  196



>gb|KCW54680.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
 gb|KCW54681.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=141

 Score =   123 bits (309),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYR  497
            FSSG +GAL+AALIPG+NI ++LLLG GI KD+ TVKSM+RFGD R
Sbjct  61   FSSGHRGALLAALIPGVNIIRMLLLGSGIWKDEATVKSMTRFGDRR  106



>gb|KCW54678.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=185

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M   NPVV D++A+ +SGG A + LR +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYR  497
            FSSG +GAL+AALIPG+NI ++LLLG GI KD+ TVKSM+RFGD R
Sbjct  61   FSSGHRGALLAALIPGVNIIRMLLLGSGIWKDEATVKSMTRFGDRR  106



>ref|XP_004970454.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=314

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            + A  +++ +G+ +  DL ++ ++ G+A + L+F+EE+AKRG F++ L+RKLVH+S+G+V
Sbjct  67   TMAAAISLEAGSGLAHDLGSAAVTAGVALALLKFYEELAKRGVFEEKLSRKLVHISVGLV  126

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            F+L WP+FSSG     +AAL PG+NI ++ LLG+G++K++  VKSMSR GDYRELLKGPL
Sbjct  127  FLLFWPLFSSGTYAPFLAALAPGVNIIRMFLLGIGLMKNEAMVKSMSRSGDYRELLKGPL  186

Query  519  YYAITITLACAV  554
            YYA TIT A +V
Sbjct  187  YYATTITFATSV  198



>ref|XP_002864581.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40840.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  IAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglni  416
            +AFSCL FW EI KR   DQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI
Sbjct  81   VAFSCLGFWGEIGKRDLLDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNI  140

Query  417  fkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             ++LLLGLG+  D+GT+KSMSR GD RELLKGPLYYA++IT AC
Sbjct  141  IRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGPLYYALSITSAC  184



>ref|NP_001044703.2| Os01g0832000 [Oryza sativa Japonica Group]
 dbj|BAD81857.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC71742.1| hypothetical protein OsI_04308 [Oryza sativa Indica Group]
 gb|EEE55624.1| hypothetical protein OsJ_03964 [Oryza sativa Japonica Group]
 dbj|BAF06617.2| Os01g0832000 [Oryza sativa Japonica Group]
Length=246

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL ++ ++ G+A + LRF+EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSG     
Sbjct  15   DLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGSYAPF  74

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +AA+ PG+NI ++LLLGLG++K++  VKSMSR GD RELLKGPLYYA TIT A ++
Sbjct  75   LAAVAPGINIIRMLLLGLGVMKNEAMVKSMSRSGDPRELLKGPLYYATTITFATSI  130



>ref|XP_002458716.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
 gb|EES03836.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
Length=341

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            + A  +++ +G  +  DL ++ ++ G+A + L+F+EEIAKRG F+Q L+RKLVH+S+G+V
Sbjct  94   TMAAAISLEAGGGLAHDLGSAAVTAGVALALLKFFEEIAKRGVFEQKLSRKLVHISVGLV  153

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            F+L WP+FSSG     +AAL PG+N+ ++LLLGLG++K++  VKS+SR GDYRELLKGPL
Sbjct  154  FLLFWPLFSSGWYAPFLAALAPGVNVIRMLLLGLGLMKNEAMVKSISRSGDYRELLKGPL  213

Query  519  YYAITITLACAV  554
            YYA TIT A +V
Sbjct  214  YYATTITFATSV  225



>ref|XP_009420002.1| PREDICTED: probable phytol kinase 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            VV DL A+ L+   A   LRFWEE+AKRG F+Q LNRKLVH+S+G+VF+L WP+FSSG Q
Sbjct  64   VVHDLGAAALTSATALGLLRFWEELAKRGVFEQKLNRKLVHISIGLVFLLFWPLFSSGSQ  123

Query  378  GALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
              L+AAL PG+NI ++LLLG GI K+D  VKS+SR GDYRELLKGPLYYA TIT A
Sbjct  124  APLLAALAPGINIIRMLLLGSGIWKNDAMVKSISRHGDYRELLKGPLYYACTITFA  179



>ref|XP_006644954.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=248

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL ++ ++ G+A + LRF+EE+AKRG F+Q LNRKLVH+++G+VF+L WP+FS G     
Sbjct  17   DLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGLVFLLFWPLFSPGSYAPF  76

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +AA+ PG+NI ++LLLGLG++K++  VKSMSR GD+RELLKGPLYYA TIT A +V
Sbjct  77   LAAVAPGINIIRMLLLGLGVMKNEAMVKSMSRSGDHRELLKGPLYYATTITFATSV  132



>sp|Q5N9J9.3|PHYK2_ORYSJ RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
Length=304

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL ++ ++ G+A + LRF+EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSG     
Sbjct  73   DLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGSYAPF  132

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +AA+ PG+NI ++LLLGLG++K++  VKSMSR GD RELLKGPLYYA TIT A ++
Sbjct  133  LAAVAPGINIIRMLLLGLGVMKNEAMVKSMSRSGDPRELLKGPLYYATTITFATSI  188



>ref|XP_008349551.1| PREDICTED: probable phytol kinase 2, chloroplastic [Malus domestica]
Length=190

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = +3

Query  150  KVRSQAVGLT-----MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKL  314
            K RS+   LT     M   NPVV D  A+ ++GG+A   L  W+E AKRG FDQ LNRK 
Sbjct  70   KPRSRRRQLTSTPAIMLPENPVVADTCAAFIAGGVALFFLLLWQETAKRGIFDQKLNRKF  129

Query  315  VHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDY  494
            VHVS+G+VFMLCWP+FSSG QGA  A+L PGLNIF++LLLGLGI KD+ TVKSMSR+GD+
Sbjct  130  VHVSIGLVFMLCWPLFSSGLQGAFFASLTPGLNIFRMLLLGLGIWKDEATVKSMSRYGDH  189

Query  495  R  497
            R
Sbjct  190  R  190



>ref|XP_004978591.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=276

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ NPVV D  A+VL+G  A   LRFWEE+A R   DQ L RKLVH+++G+V+ L WP+
Sbjct  1    MWTENPVVRDAGAAVLTGVAAAVVLRFWEEVANRALLDQTLCRKLVHITVGLVYFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FSS    A  +A LI  +NI K+L++GLG++KDDG V SM+R GD RELLKGPLYYA  I
Sbjct  61   FSSDDVYAPFLAPLIIVVNIIKVLVIGLGVVKDDGVVNSMTRHGDCRELLKGPLYYACAI  120

Query  537  TL  542
            TL
Sbjct  121  TL  122



>gb|KEH28892.1| phytol kinase [Medicago truncatula]
Length=239

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            +V DL A+ +S  + FSC R   E +KRG FDQ L+RKLVH+S G++FMLCWP+FS+ R 
Sbjct  5    LVSDLGAAAISRAVTFSCDRVLRETSKRGLFDQKLHRKLVHISFGLLFMLCWPLFSNDRW  64

Query  378  GALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
             +  AAL PG+ + ++L+  LGI KD+  VKS+SR GDYR+LL+G LYY  TI  A  +
Sbjct  65   ASCYAALAPGVYMCRILVTKLGIYKDEAIVKSLSRIGDYRQLLRGSLYYVATIVFASII  123



>ref|XP_004977648.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=285

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ NPVV D  A+VLSG      LRFWEE+A R   DQ L RKLVH+++G+V+ L WP+
Sbjct  1    MWTENPVVRDAGAAVLSGVAVAVVLRFWEEVASRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FSS    A  +A LI  +NI K+ ++GLG++KD+G V SM+R GD RELLKGPLYYA  I
Sbjct  61   FSSDDVYAPFLAPLIFVINIVKVTVIGLGVVKDEGVVNSMTRHGDCRELLKGPLYYACAI  120

Query  537  TLACAV  554
            TL   V
Sbjct  121  TLTTMV  126



>ref|XP_004977649.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=285

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ NPVV D  A+VLSG      LRFWEE+A R   DQ L RKLVH+++G+V+ L WP+
Sbjct  1    MWTENPVVRDAGAAVLSGVAVAVVLRFWEEVASRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FSS    A  +A LI  +NI K+ ++GLG++KD+G V SM+R GD RELLKGPLYYA  I
Sbjct  61   FSSDDVYAPFLAPLIFVINIVKVTVIGLGVVKDEGVVNSMTRHGDCRELLKGPLYYACAI  120

Query  537  TLACAV  554
            TL   V
Sbjct  121  TLTTMV  126



>ref|XP_009603395.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic, 
partial [Nicotiana tomentosiformis]
Length=218

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  309  KLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFG  488
            +LVH+S+G VFM CWPMFSSGRQGA++AALI GLNI K+LLLGLG+ KDD TVKSMSRFG
Sbjct  20   QLVHISIGPVFMPCWPMFSSGRQGAILAALISGLNIIKMLLLGLGLWKDDATVKSMSRFG  79

Query  489  DYRELLKGPLYYAITITLACAV  554
            D+RELLKGPLYYA TITLACAV
Sbjct  80   DHRELLKGPLYYAFTITLACAV  101



>ref|NP_001065534.2| Os11g0105800 [Oryza sativa Japonica Group]
 gb|ABA91069.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG99032.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68691.1| hypothetical protein OsI_37159 [Oryza sativa Indica Group]
 gb|EEE52600.1| hypothetical protein OsJ_34917 [Oryza sativa Japonica Group]
 dbj|BAF27379.2| Os11g0105800 [Oryza sativa Japonica Group]
Length=274

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            +P++ D  A+VL+G  A + LRFWEE+  R   DQ L RKLVH+++G+V+ L WP+FS+ 
Sbjct  6    SPLLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSAD  65

Query  372  RQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
               A  +A+L+   NI K+ L+GLGI+KDDG + SM+R GD RELLKGPLYYA  ITLA 
Sbjct  66   DVYAPFLASLVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDRRELLKGPLYYACAITLAT  125

Query  549  AV  554
             +
Sbjct  126  VI  127



>gb|ACG40052.1| phytol kinase 2 [Zea mays]
Length=273

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++G+P++ D+ A+VL+G  A + LRFWEEIA R   DQ L RKLVH+++G+VF L WP+
Sbjct  1    MWTGSPLLRDVGAAVLTGVGAAAVLRFWEEIANRALLDQKLCRKLVHITVGLVFFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FSS    A  +A LI  +NI K+ ++GLG +K +G V SM+R GD RELLKGPLYYA  I
Sbjct  61   FSSDDVFAPSLAPLIIIINIMKVTVIGLGFVKAEGVVNSMTRHGDRRELLKGPLYYACAI  120

Query  537  TLACAV  554
            TL   V
Sbjct  121  TLTTIV  126



>ref|XP_008676758.1| PREDICTED: uncharacterized protein LOC100272684 isoform X1 [Zea 
mays]
 gb|AFW64551.1| phytol kinase 2 [Zea mays]
Length=273

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++G+P++ D+ A+VL+G  A + LRFWEEIA R   DQ L RKLVH+++G+VF L WP+
Sbjct  1    MWTGSPLLRDVGAAVLTGVGAAAVLRFWEEIANRALLDQKLCRKLVHITVGLVFFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FSS    A  +A LI  +NI K+ ++GLG +K +G V SM+R GD RELLKGPLYYA  I
Sbjct  61   FSSDDVFAPSLAPLIIIINIMKVTVIGLGFVKAEGVVNSMTRHGDRRELLKGPLYYACAI  120

Query  537  TLACAV  554
            TL   V
Sbjct  121  TLTTIV  126



>ref|XP_008356261.1| PREDICTED: probable phytol kinase 3, chloroplastic [Malus domestica]
Length=266

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  297  NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSM  476
             LNRKLVHVS+G+VFMLCWP+FSSG +GA +A L PGLNIF++LLLGLGI KD+ TVKSM
Sbjct  65   KLNRKLVHVSIGLVFMLCWPLFSSGLRGAFLACLTPGLNIFRMLLLGLGIWKDEATVKSM  124

Query  477  SRFGDYRELLKGPLYYAITITLACAV  554
            SR+GDYRELLKGPLYYA TITLAC +
Sbjct  125  SRYGDYRELLKGPLYYATTITLACLI  150



>gb|EAY81967.1| hypothetical protein OsI_37144 [Oryza sativa Indica Group]
Length=271

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            +PV+ D  A+VL+G  A + LRFWEE+  R   DQ L RKLVH+++G+V+ L WP+FS+ 
Sbjct  3    SPVLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSAD  62

Query  372  RQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
               A  +A+++   NI K+ L+GLGI+KDDG + SM+R GD RELLKGPLYYA  +TLA 
Sbjct  63   DVYAPFLASIVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLAT  122

Query  549  AV  554
             +
Sbjct  123  VI  124



>ref|XP_003579056.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=276

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ +P++ D  A+VL+G  A + LR WEE+  R   DQ L RKLVH+S G+V+ L WP+
Sbjct  1    MWTESPLLRDAGAAVLTGAAALAVLRVWEEVGNRALLDQKLCRKLVHISAGLVYFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FS+    A  +AA++  LNI K++L+GLG++KD+G V SM+R GD+RELLKGPLYYA  I
Sbjct  61   FSADDVYAPFLAAIVIALNIVKVILIGLGVVKDEGVVNSMTRHGDHRELLKGPLYYACAI  120

Query  537  TLACAV  554
             L   V
Sbjct  121  ALTTVV  126



>ref|XP_002450098.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
 gb|EES09086.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
Length=274

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ +P++ D  A+VL+G  A   LRFWEE+A R   DQ L RKLVH+++G+V+ L WP+
Sbjct  1    MWTDSPLLRDAGAAVLTGVTAGVVLRFWEEVANRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FSS    A  +A LI  +NI K+ ++GLG++KD+G V SM+R GD+RELLKGPLYYA  I
Sbjct  61   FSSDDAFAPFLAPLILVINIIKVTVIGLGLVKDEGMVNSMTRHGDHRELLKGPLYYACAI  120

Query  537  TLACAV  554
            T+   V
Sbjct  121  TVTTIV  126



>gb|KEH28894.1| phytol kinase [Medicago truncatula]
Length=239

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            +V D  A  +S  +A SC R  +E AKRG  D  L RKLVH S G+ FMLCWP+FS+ R 
Sbjct  5    LVSDFGAIAISRAVALSCERVLQETAKRGLIDHKLQRKLVHTSFGLAFMLCWPLFSNDRW  64

Query  378  GALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
             +  A L+PG+ +F++L+  LGI KD+  VKS+SRFGDYR LL G LYYA TIT A  +
Sbjct  65   ASFFAVLVPGVYMFRILVTELGIYKDEAIVKSLSRFGDYRVLLMGSLYYAATITFASII  123



>gb|ABA95607.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19373.1| hypothetical protein OsJ_34926 [Oryza sativa Japonica Group]
Length=271

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            + V+ D  A+VL+G  A + LRFWEE+  R   DQ L RKLVH+++G+V+ L WP+FS+ 
Sbjct  3    SQVLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSAD  62

Query  372  RQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
               A  +A+++   NI K+ L+GLGI+KDDG + SM+R GD RELLKGPLYYA  +TLA 
Sbjct  63   DVYAPFLASIVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLAT  122

Query  549  AV  554
             +
Sbjct  123  VI  124



>ref|XP_002442649.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
 gb|EES16487.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
Length=274

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ +P++ D  A+VL+G  A   LR WEE+A R   DQ L RKLVH+++G+V+ L WP+
Sbjct  1    MWTDSPLLRDAGAAVLTGVAAAVVLRIWEEVANRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FS     A  +A LI  +NI K+ ++GLG++KD+G + SM+R GD+RELLKGPLYYA  I
Sbjct  61   FSPDDVFAPFLAPLIIVINIIKVTVIGLGLVKDEGVINSMTRHGDHRELLKGPLYYACAI  120

Query  537  TLACAV  554
            TL   V
Sbjct  121  TLTTIV  126



>ref|NP_001065932.1| Os12g0105500 [Oryza sativa Japonica Group]
 dbj|BAF28951.1| Os12g0105500, partial [Oryza sativa Japonica Group]
Length=280

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            V+ D  A+VL+G  A + LRFWEE+  R   DQ L RKLVH+++G+V+ L WP+FS+   
Sbjct  14   VLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDV  73

Query  378  GA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
             A  +A+++   NI K+ L+GLGI+KDDG + SM+R GD RELLKGPLYYA  +TLA  +
Sbjct  74   YAPFLASIVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVI  133



>ref|XP_006662647.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=273

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++ +P++ D  A+VL+G  +F+ L FWE +A R   DQ L RKLVH+++G+V+ L WP 
Sbjct  1    MWTESPLLRDAGAAVLTGAASFAVLSFWELVANRALLDQKLCRKLVHITVGLVYFLMWPF  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            FS+    A  +A+++  LNI K+ L+GLGI+KD+G V SM+R GD RELLKGPLYYA  I
Sbjct  61   FSADDVYAPFLASIVIVLNIIKVTLIGLGIVKDEGVVNSMTRNGDCRELLKGPLYYACAI  120

Query  537  TLACAV  554
            TL   +
Sbjct  121  TLTTII  126



>emb|CDY65781.1| BnaA03g56250D [Brassica napus]
Length=263

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  303  NRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSR  482
             RKLVH+++G+VF LCWP+FSSG QGAL A+LI G+NI ++LLLGLG+ +D+GT+KSMSR
Sbjct  63   TRKLVHINIGLVFTLCWPLFSSGLQGALFASLIIGVNIIRMLLLGLGVYQDEGTIKSMSR  122

Query  483  FGDYRELLKGPLYYAITITLAC  548
             GD RELLKGPLYYAI +TLAC
Sbjct  123  HGDRRELLKGPLYYAIAVTLAC  144



>gb|AFW64552.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_110888 [Zea 
mays]
Length=147

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            M++G+P++ D+ A+VL+G  A + LRFWEEIA R   DQ L RKLVH+++G+VF L WP+
Sbjct  1    MWTGSPLLRDVGAAVLTGVGAAAVLRFWEEIANRALLDQKLCRKLVHITVGLVFFLMWPL  60

Query  360  FSSGRQGA-LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            FSS    A  +A LI  +NI K+ ++GLG +K +G V SM+R GD RELLKGPL
Sbjct  61   FSSDDVFAPSLAPLIIIINIMKVTVIGLGFVKAEGVVNSMTRHGDRRELLKGPL  114



>ref|XP_002966017.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
 ref|XP_002971473.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ27222.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ33437.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
Length=247

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL+ S ++   A   LRF++E+AKR  FD+ L+RKLVH+ +G++FML WP+FS   +   
Sbjct  16   DLLMSAVTLSGALGSLRFFDELAKRDVFDKKLSRKLVHICVGLIFMLFWPLFSDAPRARY  75

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
            +AA+ P  N  +++  G G+L++   VK++SR G  RELLKGPLYYAITI++A 
Sbjct  76   LAAIAPLTNALRMVAFGTGLLENKAFVKAVSRDGHPRELLKGPLYYAITISIAT  129



>ref|XP_010650879.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Vitis vinifera]
Length=229

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  300  LNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMS  479
            ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGLGI KD+  VKSMS
Sbjct  29   VSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGLGIWKDEAVVKSMS  88

Query  480  RFGDYRELLKGPLYYAITITLACAV  554
            R+GD+RELLKGPL YA+ ITLACA+
Sbjct  89   RYGDHRELLKGPLCYALAITLACAI  113



>ref|XP_001780576.1| predicted protein [Physcomitrella patens]
 gb|EDQ54670.1| predicted protein, partial [Physcomitrella patens]
Length=240

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 80/121 (66%), Gaps = 8/121 (7%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D VA+V++   A   L+F++E+AKR   ++ L+RKL H+  GMVFML WP+FSS  Q   
Sbjct  3    DFVAAVITLAGALGVLQFFDELAKRDLLEKKLSRKLCHILSGMVFMLLWPLFSSAPQAKW  62

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYR--------ELLKGPLYYAITITL  542
            +AAL P  N  +++ LGLGI K++  VK++SR G  R        ELL GPLYYAITIT+
Sbjct  63   LAALAPAANGLRMIGLGLGIWKNEALVKAISRGGSQRQYLRTFCSELLHGPLYYAITITI  122

Query  543  A  545
            +
Sbjct  123  S  123



>ref|XP_001764046.1| predicted protein [Physcomitrella patens]
 gb|EDQ71185.1| predicted protein [Physcomitrella patens]
Length=250

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D V +V +   A   L+F++E+AKR + ++ L+RKL H+  G+VFML WP+FS+      
Sbjct  19   DYVVAVFTLTGALGILQFFDELAKRDFLEKTLSRKLCHILSGLVFMLFWPLFSTAPLAKY  78

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
            +AA     N F+++ LGLG+ K++  VK++SR G  RELL+GPLYYAI I +A
Sbjct  79   LAAFALVANGFRMIGLGLGLWKNESLVKAISRGGSRRELLQGPLYYAIAILVA  131



>ref|XP_005643081.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18537.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
Length=281

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  LTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCW  353
            L +   NP++ D+ A+V++   A + ++ +  ++ RG  DQ L+RKLVH+  G  F LCW
Sbjct  31   LLVLQQNPLLQDVCATVVAAAGAIALVKIFRALSSRGIVDQKLSRKLVHILAGPGFALCW  90

Query  354  PMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
            P+FS+       AA++P LN+ ++L LG G++ D  TV +MSR GD  ELL+GPLYY + 
Sbjct  91   PLFSADPNARFFAAIVPCLNLLRVLALGTGVIDDPKTVNAMSREGDKSELLRGPLYYVVV  150

Query  534  I  536
            +
Sbjct  151  L  151



>gb|KCW57521.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
 gb|KCW57522.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=187

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            MLCWP+FSSG + AL+AA +PGLNI ++LL+G GI KD+  VKSMSRFGD+RELLKGPLY
Sbjct  1    MLCWPLFSSGHRSALLAATVPGLNIIRVLLVGSGIWKDEAIVKSMSRFGDHRELLKGPLY  60

Query  522  YAITITLACA  551
            YA TIT ACA
Sbjct  61   YASTITFACA  70



>ref|XP_001766222.1| predicted protein [Physcomitrella patens]
 gb|EDQ68854.1| predicted protein, partial [Physcomitrella patens]
Length=234

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  VLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAli  401
            VL GG  +  +RF++ + K+ Y  Q L+RKLVH++ G++F  CWP +SS      +AAL+
Sbjct  9    VLFGGWVW--VRFFDFLTKKKYLGQKLSRKLVHITSGLLFASCWPFYSSFPGAQYLAALV  66

Query  402  pglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
            P  N  +LL+ GLG LKD+G VKS+SR GD RELL+GPLYY + +  +
Sbjct  67   PVSNGIRLLVYGLGFLKDEGLVKSVSREGDPRELLRGPLYYVVVLVFS  114



>ref|XP_002315347.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa]
 gb|EEF01518.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa]
Length=361

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A+S +R ++ + +R    Q+L+RKLVH+  G++F  CWP+FS+  Q   +A+
Sbjct  132  ATVLAG--AYSLVRTFDTLTQRNLIQQSLSRKLVHILSGLLFAACWPIFSTSTQARYLAS  189

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ G  ++ D+G +KS++R G+ +ELL+GPLYY + + L CA+
Sbjct  190  VVPLVNCLRLIVNGFSLVTDEGLIKSVTREGNPQELLRGPLYYVLILIL-CAL  241



>ref|WP_010480729.1| phosphatidate cytidylyltransferase [Acaryochloris sp. CCMEE 5410]
Length=244

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +3

Query  183  FSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMF  362
             + NP++ D V  V++  +A S LR  + +A  G  +Q L+RK++H+  G +F+LCWP F
Sbjct  6    LTANPLIQDSVVMVITLMLALSWLRIMDALAANGMLEQKLSRKIIHMGTGPLFVLCWPFF  65

Query  363  SSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITL  542
            S        AAL+P     + + +G+G ++D   V++M+R G+ +E+LKGPL+Y + + +
Sbjct  66   SPQPTARYFAALVPLAITLQFIAIGVGWIQDPDAVQAMTRTGNPKEILKGPLFYGL-VFV  124

Query  543  ACAV  554
            AC +
Sbjct  125  ACTI  128



>gb|KCW54683.1| hypothetical protein EUGRSUZ_I00622 [Eucalyptus grandis]
Length=187

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            MLCWP+FSS  +GAL+AA IPG NI ++LL+G GI KD+ TVKSMSRFGD RELL+GPLY
Sbjct  1    MLCWPLFSSEHRGALLAATIPGFNIIRMLLVGSGIWKDEATVKSMSRFGDRRELLEGPLY  60

Query  522  YAITITLACA  551
            Y + IT ACA
Sbjct  61   YVLMITFACA  70



>ref|XP_007144301.1| hypothetical protein PHAVU_007G144700g [Phaseolus vulgaris]
 gb|ESW16295.1| hypothetical protein PHAVU_007G144700g [Phaseolus vulgaris]
Length=303

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +3

Query  234  GIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipgln  413
            G A++ +R ++E+ +R    Q L+RKLVH+  G++F+  WP+FS+  +    AA +P +N
Sbjct  78   GGAYALVRAFDELTRRNILHQGLSRKLVHILSGLLFLFSWPIFSNSPKARYFAAFVPLVN  137

Query  414  ifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
              +LL+ GL +  D+G +KS++R GD  ELL+GPLYY + +TL CA+
Sbjct  138  CLRLLMNGLSLASDEGLIKSLTREGDPEELLRGPLYYVLILTL-CAL  183



>ref|XP_008456566.1| PREDICTED: probable phytol kinase 1, chloroplastic [Cucumis melo]
Length=302

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL G  A+S +R ++ + +R    QNL+RKLVH+  G++F + WP+FS+  +    A+
Sbjct  72   AAVLVG--AYSLVRGFDNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTEARYFAS  129

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ GL + KD+G +KS++R G   ELL+GPLYY + + L+  +
Sbjct  130  IVPSVNCLRLVINGLSLTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVI  182



>ref|WP_012164598.1| phosphatidate cytidylyltransferase [Acaryochloris marina]
 gb|ABW29270.1| phosphatidate cytidylyltransferase [Acaryochloris marina MBIC11017]
Length=244

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 72/117 (62%), Gaps = 0/117 (0%)
 Frame = +3

Query  183  FSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMF  362
             + NP++ D V  V++  +A S LR  + +A  G  +Q L+RK++H+  G +F+LCWP F
Sbjct  6    LTANPLIQDSVVMVITLMLALSWLRIMDALAANGILEQKLSRKIIHMGTGPLFVLCWPFF  65

Query  363  SSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
            S        AAL+P     + + +G+G ++D   V++M+R G+ +E+LKGPL+Y + 
Sbjct  66   SPQPTACYFAALVPLAITLQFIGIGVGWIQDPDAVQAMTRTGNPKEILKGPLFYGLV  122



>ref|XP_006436584.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 ref|XP_006485240.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|ESR49824.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 gb|KDO55301.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis]
Length=301

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL G  A+  +  ++ +++R    Q+L+RKLVH+  G++FM+ WP+FS+  +    AA
Sbjct  72   AAVLVG--AYGLVLSFDNLSQRKLIQQSLSRKLVHILSGLLFMVSWPIFSTSTEARYFAA  129

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+P +N  +L++ GL ++KDDG +KS++R G+ +ELL+GPLYY + + L+  V
Sbjct  130  LVPLVNCLRLVINGLSLVKDDGLIKSVTREGNPKELLRGPLYYVLMLILSALV  182



>ref|NP_001239775.1| probable phytol kinase 1, chloroplastic [Glycine max]
 sp|Q2N2K1.1|PHYK1_SOYBN RecName: Full=Probable phytol kinase 1, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42676.1| phytol kinase [Glycine max]
Length=302

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 74/111 (67%), Gaps = 2/111 (2%)
 Frame = +3

Query  222  VLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAli  401
            VL GG  ++ +R ++E+ +R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +
Sbjct  75   VLGGG--YALVRAFDELTRRNILQQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFV  132

Query  402  pglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            P +N  +LL+ GL +  D+G +KS++R GD  ELL+GPLYY + + L+  V
Sbjct  133  PLVNCLRLLVNGLSLASDEGLIKSVTREGDPLELLRGPLYYVLILILSALV  183



>ref|XP_004138682.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004159238.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cucumis 
sativus]
Length=297

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL G  A+S +R ++ + +R    QNL+RKLVH+  G++F + WP+FS+       A+
Sbjct  71   AAVLIG--AYSLVRGFDNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTGARYFAS  128

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ GL + KD+G +KS++R G   ELL+GPLYY + + L+  +
Sbjct  129  IVPTVNCLRLVINGLSLTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVI  181



>gb|KGN63038.1| hypothetical protein Csa_2G385070 [Cucumis sativus]
Length=300

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL G  A+S +R ++ + +R    QNL+RKLVH+  G++F + WP+FS+       A+
Sbjct  71   AAVLIG--AYSLVRGFDNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTGARYFAS  128

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ GL + KD+G +KS++R G   ELL+GPLYY + + L+  +
Sbjct  129  IVPTVNCLRLVINGLSLTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVI  181



>ref|XP_011024295.1| PREDICTED: probable phytol kinase 1, chloroplastic [Populus euphratica]
Length=307

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A+  +R ++ + +R    Q+L+RKLVH+  G++F  CWP+FS+  Q    A+
Sbjct  78   ATVLAG--AYGLVRTFDTLTQRNLIQQSLSRKLVHILSGLLFAGCWPIFSTSAQARYFAS  135

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ G  ++ D+G +KS++R G+ +ELL+GPLYY + + L CA+
Sbjct  136  VVPLVNCLRLIVHGFSLVTDEGLIKSVTREGNPQELLRGPLYYVLILIL-CAL  187



>ref|XP_003556292.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Glycine 
max]
Length=298

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +3

Query  222  VLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAli  401
            VL GG  ++ +R ++E+ +R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +
Sbjct  71   VLGGG--YALVRAFDELTRRNILQQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFV  128

Query  402  pglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            P +N  +LL+ GL +  D+G +KS++R GD  ELL+GPLYY + I + CA+
Sbjct  129  PLVNCLRLLVNGLSLASDEGLIKSVTREGDPLELLRGPLYY-VLILIFCAL  178



>ref|XP_011094481.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Sesamum indicum]
Length=308

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +3

Query  189  GNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS  368
            G  V+ D  A+ L  G A++ +  ++ + +R   +Q L+RKLVH+  G++F+  WP+FS+
Sbjct  68   GGAVLQDAAATALVVGGAYALVSTFDNLTRRNIIEQTLSRKLVHILSGLLFLASWPIFSA  127

Query  369  GRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
                   A+++P LN  +L++ GL +  D+G +KS+SR G   ELL+GPLYY + + L C
Sbjct  128  STGARYFASVVPSLNCLRLVMNGLSLTTDEGLIKSVSREGKPEELLRGPLYYVLVLIL-C  186

Query  549  AV  554
            A+
Sbjct  187  AI  188



>ref|XP_004307151.1| PREDICTED: phytol kinase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=311

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A VL+G  A++ +  ++ + KR    Q+L+RKLVH+S G++F+L WP+FS+  +    A 
Sbjct  82   ALVLAG--AYTLVLCFDYLTKRNVLQQSLSRKLVHISSGLLFVLSWPIFSTSTEARYFAT  139

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P  N  +LLL GL ++ ++G VKS++R G+ +ELL+GPLYY + I + CA+
Sbjct  140  VVPLFNGLRLLLSGLSLVPNEGLVKSVTREGNPKELLRGPLYYVL-ILIVCAL  191



>ref|XP_011398499.1| putative phytol kinase 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM25603.1| putative phytol kinase 1, chloroplastic [Auxenochlorella protothecoides]
Length=200

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +3

Query  249  CLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkll  428
             ++ ++ +      D+NL+RKLVH   G +F++ WP+F+S  +  L+AA +P LN+ +L 
Sbjct  53   IVQIFDRLEAAAIIDRNLSRKLVHTLAGPLFLVSWPLFASNPESKLIAAAVPFLNVIRLT  112

Query  429  llglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT---ITLAC  548
            L+G G+++D+  V +MSR GD  ELL+GPL+Y +    +TLAC
Sbjct  113  LVGTGLVRDERVVAAMSRTGDKSELLRGPLFYVLVLFAVTLAC  155



>gb|KEH43364.1| phytol kinase [Medicago truncatula]
Length=306

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +3

Query  234  GIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipgln  413
            G A++ +  ++++ +R   DQ L+RKLVH+  G++F++ WP+FS+  +    AA +P +N
Sbjct  81   GGAYALVFSFDDLTRRNVIDQGLSRKLVHILSGLLFLVSWPIFSNSLEARYFAAFVPLVN  140

Query  414  ifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
              +LL+ GL ++ D G +KS++R GD +ELL+GPLYY   + L+  V
Sbjct  141  FLRLLVNGLSLVTDPGLIKSVTRKGDPKELLRGPLYYVGILMLSALV  187



>ref|XP_004234914.1| PREDICTED: probable phytol kinase 1, chloroplastic [Solanum lycopersicum]
Length=320

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = +3

Query  189  GNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS  368
            G  +V D  A+ L    A++ +  ++ +++R   +QNL+RKLVH+  G++FM  WP+FS 
Sbjct  80   GGSMVQDAGATALVIAGAYAFVSTFDLLSERKLIEQNLSRKLVHILSGLLFMASWPIFSV  139

Query  369  GRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
              +    AA++P  N  +L++ GL +  D+G VKS++R G   ELL+GPLYY + + L+ 
Sbjct  140  SGRARYFAAVVPLTNCLRLVIHGLSLATDEGLVKSVTREGKPEELLRGPLYYVLVLILSA  199

Query  549  AV  554
             +
Sbjct  200  VL  201



>ref|XP_004496158.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cicer 
arietinum]
Length=309

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  234  GIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipgln  413
            G A++ +  +++  ++   +Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N
Sbjct  84   GGAYALVFAFDDFTRKNILNQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVN  143

Query  414  ifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
              +LL+ GL +  D G +KS++R GD +ELL+GPLYY + + L CAV
Sbjct  144  FLRLLVNGLSLTSDQGLIKSVTRKGDPKELLRGPLYYVVILML-CAV  189



>ref|XP_010552940.1| PREDICTED: phytol kinase 1, chloroplastic [Tarenaya hassleriana]
Length=313

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 79/128 (62%), Gaps = 3/128 (2%)
 Frame = +3

Query  159  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMV  338
            + A G+ M   +PV+ D+ A+    G A+S +  ++ + KR    Q+L+RKLVH+  G++
Sbjct  66   TTAAGVAM---DPVLQDVGATAAILGGAYSLVFAFKNLTKRDLIPQSLSRKLVHILSGLL  122

Query  339  FMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPL  518
            F L WP+FS+  +    AAL+P +N  +LL+ GL +  D   ++S++R G   ELLKGPL
Sbjct  123  FALSWPIFSASTEARYFAALVPLVNCLRLLVNGLSVSPDASLIQSVTREGKAEELLKGPL  182

Query  519  YYAITITL  542
            YY I + +
Sbjct  183  YYVIVLII  190



>ref|XP_008375637.1| PREDICTED: probable phytol kinase 1, chloroplastic [Malus domestica]
Length=305

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A VL+G  A+  +  ++ + +R    QNL+RKLVH+  G+ FML WP+FS+       A+
Sbjct  76   AVVLAG--AYGLVLCFDNLTQRNLLRQNLSRKLVHILSGIFFMLSWPIFSTSTDARYFAS  133

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +LLL G  ++ ++G VKS++R G+ +ELL+GPLYY + + L CA+
Sbjct  134  VVPLVNCLRLLLHGFSLVTNEGLVKSVTREGNPKELLRGPLYYVLILIL-CAL  185



>ref|XP_010067215.1| PREDICTED: probable phytol kinase 1, chloroplastic [Eucalyptus 
grandis]
Length=309

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A+S +  ++ + +R    Q+L+RKLVH+  G++FM  WP+FS+  +    A+
Sbjct  80   AAVLAG--AYSLVFAFDTLTQRNLIQQSLSRKLVHILSGLLFMASWPIFSNSMEARYFAS  137

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+P +N F+L++ GL +  D+G VKS++R G  +ELL+GPLYY + + L CA+
Sbjct  138  LVPLVNCFRLVVNGLSLAADEGLVKSVTREGSPQELLRGPLYYVLILIL-CAI  189



>ref|XP_008218941.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Prunus mume]
Length=239

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = +3

Query  153  VRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMG  332
            +R+ A GL   +G        A VL+G  A+  +  ++ + +R    Q+L+RKLVH+  G
Sbjct  64   LRAAADGLLQDAGA------TAFVLAG--AYGLVLCFDNLTQRNLLQQSLSRKLVHILSG  115

Query  333  MVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKG  512
            ++FML WP+FS+       A+++P +N  +LLL GL I+ ++G VKS++R G+ +ELL+G
Sbjct  116  LLFMLSWPIFSTSTAARYFASVVPLVNCLRLLLHGLSIVTNEGLVKSVTREGNPKELLRG  175

Query  513  PLYYAITITLACAV  554
            PLYY + + L CA+
Sbjct  176  PLYYVLILIL-CAL  188



>ref|XP_009361416.1| PREDICTED: probable phytol kinase 1, chloroplastic [Pyrus x bretschneideri]
Length=308

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A V++G  A+  +  ++ + +R    QNL+RKLVH+  G+ FML WP+FS+       A+
Sbjct  79   AVVIAG--AYGLVLCFDNLTQRNLLRQNLSRKLVHILSGIFFMLSWPIFSTSTNARYFAS  136

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +LLL G  ++ ++G VKS++R G+ +ELL+GPLYY + + L CA+
Sbjct  137  VVPLVNCLRLLLHGFSLVPNEGLVKSVTREGNPKELLRGPLYYVLVLIL-CAL  188



>ref|XP_002970593.1| hypothetical protein SELMODRAFT_411298 [Selaginella moellendorffii]
 gb|EFJ28723.1| hypothetical protein SELMODRAFT_411298 [Selaginella moellendorffii]
Length=130

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +3

Query  231  GGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipgl  410
            G +     + +E + +    DQ L+RKLVH++ G +FM  WP+FSS      + +L+P  
Sbjct  15   GAVVAGAYQVFELLTRFNVLDQKLSRKLVHMTTGPLFMPSWPLFSSSSASRYICSLVPLA  74

Query  411  nifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
            N  +LL+LGLG+  ++G VKSMSR GD +ELL+GPLYY
Sbjct  75   NAVRLLILGLGLRTNEGVVKSMSRDGDAKELLRGPLYY  112



>ref|XP_010906566.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=274

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +3

Query  213  VASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVA  392
             A VL+G  A+S +R ++ + +R   +++L+RK+VHV  G++FM  WP+FSS  +    A
Sbjct  92   TALVLAG--AYSLVRAFDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFA  149

Query  393  AlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            A++P +N  +L+  GL I  D+G +KS++R G   ELL+GPLYY + + + C+V
Sbjct  150  AIVPLVNCIRLVTYGLRIFTDEGLIKSVTREGKPEELLRGPLYY-VMVLMFCSV  202



>ref|XP_003580789.1| PREDICTED: probable phytol kinase, chloroplastic [Brachypodium 
distachyon]
Length=312

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A++L    A+S +R ++ + +R   +Q+L+RK+VHV  G++FM  WP+FS+  +    AA
Sbjct  76   ATLLVTAGAYSLVRAFDALTERRLVEQSLSRKIVHVLSGVMFMSSWPLFSNSNEARFFAA  135

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITL  542
            ++P LN  +LL  GLG   D+  VKS++R G   ELL+GPLYY I + L
Sbjct  136  VVPFLNGIRLLTYGLGFYSDEALVKSVTREGKREELLRGPLYYVIVLLL  184



>ref|XP_008218940.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Prunus mume]
Length=308

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = +3

Query  153  VRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMG  332
            +R+ A GL   +G        A VL+G  A+  +  ++ + +R    Q+L+RKLVH+  G
Sbjct  64   LRAAADGLLQDAGA------TAFVLAG--AYGLVLCFDNLTQRNLLQQSLSRKLVHILSG  115

Query  333  MVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKG  512
            ++FML WP+FS+       A+++P +N  +LLL GL I+ ++G VKS++R G+ +ELL+G
Sbjct  116  LLFMLSWPIFSTSTAARYFASVVPLVNCLRLLLHGLSIVTNEGLVKSVTREGNPKELLRG  175

Query  513  PLYYAITITLACAV  554
            PLYY + + L CA+
Sbjct  176  PLYYVLILIL-CAL  188



>ref|XP_009591844.1| PREDICTED: probable phytol kinase 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=350

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = +3

Query  189  GNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS  368
            G  ++ D  A+ L    A++ +  ++ +++R    QNL+RKLVH+  G++FM  WP+FS+
Sbjct  108  GGSMLQDAGATALVIAGAYALVSTFDFLSERKLIQQNLSRKLVHILSGLLFMASWPIFSA  167

Query  369  GRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             R     A+++P  N  +L++ GL +  D+G +KS++R G   ELL+GPLYY + + L+ 
Sbjct  168  SRWARYFASVVPLTNCLRLVIHGLSLATDEGLLKSVTREGKPEELLRGPLYYVLVLILSA  227



>ref|XP_009783010.1| PREDICTED: probable phytol kinase 1, chloroplastic [Nicotiana 
sylvestris]
Length=321

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  AFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnif  419
            A++ +  ++ +++R   +QNL+RKLVH+  G++FM  WP+FS+ R     A+++P  N  
Sbjct  96   AYALVSTFDFLSERKLIEQNLSRKLVHILSGLLFMASWPIFSASRWARYFASVVPLTNCL  155

Query  420  kllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
            +L++ GL +  D+G +KS++R G   ELL+GPLYY + + L+ 
Sbjct  156  RLVINGLSLATDEGLLKSVTREGKPEELLRGPLYYVLVLILSA  198



>ref|XP_010906565.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=323

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A VL+G  A+S +R ++ + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA
Sbjct  93   ALVLAG--AYSLVRAFDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFAA  150

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L+  GL I  D+G +KS++R G   ELL+GPLYY + + + C+V
Sbjct  151  IVPLVNCIRLVTYGLRIFTDEGLIKSVTREGKPEELLRGPLYY-VMVLMFCSV  202



>ref|XP_010067173.1| PREDICTED: probable phytol kinase 1, chloroplastic [Eucalyptus 
grandis]
Length=309

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 77/113 (68%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A+S +  ++ + +R    Q+L+RKLVH+  G++FM  WP+FS+  +    A+
Sbjct  80   AAVLAG--AYSLVFAFDTLTQRNLIQQSLSRKLVHILSGLLFMAAWPIFSNSMEARYFAS  137

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+P +N F+L++ GL +  D G VKS++R G  +ELL+GPLYY + + L CA+
Sbjct  138  LVPLVNCFRLVVNGLSLAADKGLVKSVTREGSPQELLRGPLYYVLILIL-CAI  189



>gb|EEE61880.1| hypothetical protein OsJ_16572 [Oryza sativa Japonica Group]
Length=314

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D  A VL    A+S +R ++ +  R   +QNL+RK+VHV  G++FM  WP+FS+  +   
Sbjct  76   DWAAKVLITAGAYSLVRAFDGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARF  135

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL  GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  136  FAAIVPLLNCIRLLTYGLRLSTDEALVKSVTREGKPEELLRGPLYY  181



>ref|XP_007218720.1| hypothetical protein PRUPE_ppa009034mg [Prunus persica]
 gb|EMJ19919.1| hypothetical protein PRUPE_ppa009034mg [Prunus persica]
Length=308

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A VL+G  A+  +  ++ + +R    Q+L+RKLVH+  G++FML WP+FS+       A 
Sbjct  79   AFVLAG--AYGLVLCFDNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFAT  136

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +LLL GL I+ ++G VKS++R G+ +ELL+GPLYY + + L CA+
Sbjct  137  VVPLVNCLRLLLHGLSIVTNEGLVKSVTREGNPKELLRGPLYYVLILIL-CAL  188



>ref|XP_006364440.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=316

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +3

Query  189  GNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS  368
            G  ++ D  A+ L    A++ +  ++ +++R   +QNL+RKLVH+  G++FM  WP+FS+
Sbjct  76   GGSMLQDAGATALVIAGAYAFVSTFDFLSERKLIEQNLSRKLVHILSGLLFMASWPIFSA  135

Query  369  GRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
                   A+++P  N  +L++ GL +  D+G +KS++R G   ELL+GPLYY + + L C
Sbjct  136  SGWARYFASVVPLTNCLRLVIHGLSLATDEGLIKSVTREGKPEELLRGPLYYVLVLIL-C  194

Query  549  AV  554
            AV
Sbjct  195  AV  196



>ref|XP_010423571.1| PREDICTED: phytol kinase 1, chloroplastic-like [Camelina sativa]
Length=308

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  69   NSLLHDVAATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  128

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             +    AA +P +N  +L++ GL +  +   +KS++R G   ELLKGPL+Y + + ++ 
Sbjct  129  SEARYFAAFVPLVNGLRLVVNGLSVSPNSTLIKSVTREGRPEELLKGPLFYVLALLMSA  187



>sp|Q7XR51.1|PHYK1_ORYSJ RecName: Full=Probable phytol kinase 1, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 emb|CAE02829.1| OSJNBa0043A12.34 [Oryza sativa Japonica Group]
 emb|CAH67696.1| H0624F09.4 [Oryza sativa Indica Group]
 gb|EEC78224.1| hypothetical protein OsI_17864 [Oryza sativa Indica Group]
Length=314

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D  A++L    A+S +R ++ +  R   +QNL+RK+VHV  G++FM  WP+FS+  +   
Sbjct  76   DCAATLLITAGAYSLVRAFDGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARF  135

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL  GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  136  FAAIVPLLNCIRLLTYGLRLSTDEALVKSVTREGKPEELLRGPLYY  181



>ref|WP_013560255.1| phosphatidate cytidylyltransferase [Anaerolinea thermophila]
 dbj|BAJ63878.1| putative phosphatidate cytidylyltransferase [Anaerolinea thermophila 
UNI-1]
Length=233

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +3

Query  225  LSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlip  404
            L+ GIA   LR  + +A RG+   +L+RK++H+  G +F+LCW  F +      +AAL+P
Sbjct  9    LTFGIALLWLRVNDYLAYRGWVSSSLSRKIIHLGTGPIFVLCWLFFPNTPLSKWLAALVP  68

Query  405  glnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
             L   +  L+G G ++D   V +MSR GD RE+L+GPLYY +   L   +
Sbjct  69   LLITLQFFLVGTGWIRDPQAVSAMSRTGDRREILRGPLYYGVVFVLLTLI  118



>ref|XP_006364441.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X2 [Solanum tuberosum]
Length=313

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +3

Query  189  GNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS  368
            G  ++ D  A+ L    A++ +  ++ +++R   +QNL+RKLVH+  G++FM  WP+FS+
Sbjct  76   GGSMLQDAGATALVIAGAYAFVSTFDFLSERKLIEQNLSRKLVHILSGLLFMASWPIFSA  135

Query  369  GRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
                   A+++P  N  +L++ GL +  D+G +KS++R G   ELL+GPLYY + + L C
Sbjct  136  SGWARYFASVVPLTNCLRLVIHGLSLATDEGLIKSVTREGKPEELLRGPLYYVLVLIL-C  194

Query  549  AV  554
            AV
Sbjct  195  AV  196



>ref|XP_010490961.1| PREDICTED: phytol kinase 1, chloroplastic [Camelina sativa]
Length=308

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  69   NSLLHDVAATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  128

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
             +    AA +P +N  +L++ GL +  +   +KS++R G   ELLKGPL+Y + + ++
Sbjct  129  SEARYFAAFVPLVNGLRLVVNGLSVSPNSTLIKSVTREGRPEELLKGPLFYVLALLMS  186



>gb|KDP45055.1| hypothetical protein JCGZ_01555 [Jatropha curcas]
Length=319

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  189  GNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS  368
            G  ++ D  A+V     A+  +  ++ + +R    QNL+RKLVH+  G++F + WP+FS+
Sbjct  79   GGALLQDAGATVAVLAGAYVLVLVFDTLTQRKLIQQNLSRKLVHILSGLLFAVSWPIFST  138

Query  369  GRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
              +    A L+P +N  +L++ GL +  +DG +KS++R G   ELLKGPLYY + + L C
Sbjct  139  STEARYFATLVPLVNGLRLVIHGLSLATNDGLIKSVTREGKPEELLKGPLYYVLMLIL-C  197

Query  549  AV  554
            A+
Sbjct  198  AL  199



>gb|ACP43458.1| phytol kinase [Lactuca sativa]
Length=309

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = +3

Query  195  PVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGR  374
            P++ D  A+++  G A+  +  ++ + +R   +QNL+RKLVH+  G+++M CWP+FS+  
Sbjct  71   PLLQDAGATIIVVGGAYGLVAGFDYLTQRQIIEQNLSRKLVHILSGLLYMGCWPIFSTST  130

Query  375  QGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
                 A + P LN  +LL+ GL ++ ++  +KS++R G   ELL+GPLYY + + L+
Sbjct  131  DARYFAVIAPLLNCTRLLVHGLSLVPNEDLIKSVTREGKPEELLRGPLYYVLMLILS  187



>ref|XP_002447301.1| hypothetical protein SORBIDRAFT_06g032370 [Sorghum bicolor]
 gb|EES11629.1| hypothetical protein SORBIDRAFT_06g032370 [Sorghum bicolor]
Length=304

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D   +VL    A+S +R ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +   
Sbjct  67   DGAVTVLITAGAYSLVRVFDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARY  126

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL+ GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  127  FAAVVPLLNSIRLLIYGLRLYTDEALVKSVTREGKPEELLRGPLYY  172



>ref|NP_001105847.1| probable phytol kinase, chloroplastic precursor [Zea mays]
 sp|Q2N2K4.1|PHYK_MAIZE RecName: Full=Probable phytol kinase, chloroplastic; Flags: Precursor 
[Zea mays]
 gb|ABA42673.1| phytol kinase [Zea mays]
 gb|ACG37691.1| phytol kinase 2 [Zea mays]
 tpg|DAA35443.1| TPA: putative phytol kinase, Precursor [Zea mays]
Length=303

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D   +VL    A+S +R ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +   
Sbjct  63   DGAVTVLITAGAYSLVRVFDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARY  122

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL+ GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  123  FAAVVPFLNSMRLLIYGLRLYTDEALVKSVTREGKPEELLRGPLYY  168



>ref|XP_001694607.1| phytol kinase-related protein [Chlamydomonas reinhardtii]
 gb|EDP02602.1| phytol kinase-related protein [Chlamydomonas reinhardtii]
Length=304

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +3

Query  252  LRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifklll  431
            ++ ++ +A  G  +Q L+RKLVH + G +F+L W +FS+     ++AA++P LN  +L  
Sbjct  70   VKLFDYLAANGTLEQKLSRKLVHTTTGPIFVLTWALFSANPMARVLAAVVPMLNFMRLFA  129

Query  432  lglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
            +G G++ D G V S+SR GD  ELLKGPL+Y +T+  A
Sbjct  130  VGTGLVSDPGLVNSVSRSGDRTELLKGPLFYVVTLVAA  167



>ref|XP_002532923.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF29465.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=249

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A+  +  ++ + +R    Q L+RKLVH+  G++F + WP+FS+  +    A+
Sbjct  79   AAVLAG--AYGLVLTFDTLTQRNIIQQTLSRKLVHILSGLLFAVSWPIFSNSVEARYFAS  136

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ GL +  D+G +KS++R G+ +ELL+GPLYY + +   CA+
Sbjct  137  IVPLVNCLRLVINGLTLATDEGLIKSVTREGNPKELLRGPLYYVLVLIF-CAL  188



>gb|AIE88275.1| hypothetical protein OG_BBa0063K01.6 [Oryza glaberrima]
Length=314

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D  A++L    A+S +R ++ +  R   +QNL+RK+VHV  G++FM  WP+FS+  +   
Sbjct  76   DGAATLLITAGAYSLVRAFDGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARF  135

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL  GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  136  FAAIVPLLNCIRLLTYGLRLSTDEALVKSVTREGKPEELLRGPLYY  181



>ref|XP_002871097.1| hypothetical protein ARALYDRAFT_325092 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47356.1| hypothetical protein ARALYDRAFT_325092 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  65   NSMLHDVGATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  124

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             +    AA +P +N  +L++ GL +  +   +KS++R G   ELLKGPL+Y + + ++ 
Sbjct  125  TEARYFAAFVPLVNGLRLVINGLSVSPNSTLIKSVTREGRPEELLKGPLFYVLALLISA  183



>ref|XP_006398907.1| hypothetical protein EUTSA_v10014196mg [Eutrema salsugineum]
 gb|ESQ40360.1| hypothetical protein EUTSA_v10014196mg [Eutrema salsugineum]
Length=306

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D+ A+V   G A++ +  +E + KR    QNL+RKLVH+  G++F++ WP+FS+  +   
Sbjct  72   DVGATVAVVGGAYALVFSFESLTKRNVIPQNLSRKLVHILSGLLFVISWPIFSASTEARY  131

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             AA +P +N  +L++ GL +  +   +KS++R G   ELLKGPL+Y I + ++ 
Sbjct  132  FAAFVPLVNGLRLVVNGLSVSPNSTLIKSVTREGRPEELLKGPLFYVIALLVSV  185



>ref|XP_010452347.1| PREDICTED: phytol kinase 1, chloroplastic-like [Camelina sativa]
Length=307

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 73/119 (61%), Gaps = 0/119 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q L+RKLVH+  G++F+L WP+FS  
Sbjct  69   NSLLHDVAATVAVLGGAYALVLSFESLTKRNVIQQRLSRKLVHILSGLLFVLAWPIFSGS  128

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             +    AA +P +N  +L++ GL +  +   +KS++R G   ELL+GPL+Y + + ++ 
Sbjct  129  SEARYFAAFVPLVNGLRLVINGLSVSPNSTLIKSVTREGRPEELLEGPLFYVLALLMSA  187



>ref|NP_196069.1| phytol kinase 1 [Arabidopsis thaliana]
 sp|Q9LZ76.1|PHYK1_ARATH RecName: Full=Phytol kinase 1, chloroplastic; AltName: Full=Vitamin 
E pathway gene 5 protein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85555.1| putative protein [Arabidopsis thaliana]
 gb|AAX22258.1| At5g04490 [Arabidopsis thaliana]
 gb|AED90752.1| phytol kinase 1 [Arabidopsis thaliana]
Length=304

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  65   NSLLHDVGATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  124

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
             +    AA +P +N  +L++ GL I  +   +KS++R G   ELLKGPL+Y + +
Sbjct  125  TEARYFAAFVPLVNGLRLVINGLSISPNSMLIKSVTREGRAEELLKGPLFYVLAL  179



>gb|AAM61593.1| unknown [Arabidopsis thaliana]
Length=304

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  65   NSLLHDVGATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  124

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
             +    AA +P +N  +L++ GL I  +   +KS++R G   ELLKGPL+Y + +
Sbjct  125  TEARYFAAFVPLVNGLRLVINGLSISPNSMLIKSVTREGRAEELLKGPLFYVLAL  179



>ref|XP_006288296.1| hypothetical protein CARUB_v10001540mg [Capsella rubella]
 gb|EOA21194.1| hypothetical protein CARUB_v10001540mg [Capsella rubella]
Length=307

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  68   NSMLHDVGATVAVLGGAYALVVSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  127

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
             +    AA +P +N  +L++ GL +  +   +KS++R G   ELLKGPL+Y + + ++
Sbjct  128  SEARYFAAFVPLVNGLRLVINGLSLSPNSTLIKSVTREGRPEELLKGPLFYVLALLIS  185



>gb|AAO42044.1| unknown protein [Arabidopsis thaliana]
Length=304

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            N ++ D+ A+V   G A++ +  +E + KR    Q+L+RKLVH+  G++F+L WP+FS  
Sbjct  65   NSLLHDVGAAVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGS  124

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
             +    AA +P +N  +L++ GL I  +   +KS++R G   ELLKGPL+Y + +
Sbjct  125  TEARYFAAFVPLVNGLRLVINGLSISPNSMLIKSVTREGRAEELLKGPLFYVLAL  179



>ref|XP_008795886.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=309

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 66/104 (63%), Gaps = 0/104 (0%)
 Frame = +3

Query  243  FSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifk  422
            +S +R ++ + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA +P +N  +
Sbjct  86   YSLVRAFDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSIEARYFAAFVPLVNCIR  145

Query  423  llllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+  GL I  D+G +KS++R G   ELL+GPLYY + +     V
Sbjct  146  LVTYGLRIFSDEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVV  189



>ref|XP_009396489.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=316

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 0/123 (0%)
 Frame = +3

Query  186  SGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFS  365
            S   V+ D  A+      A+S +  ++ +A+R    ++L+RK VHV  G+++M  WP FS
Sbjct  76   SAGVVLQDAAATTFCFAGAYSLVLVFDTLAERNIIQKSLSRKAVHVLSGLLYMATWPFFS  135

Query  366  SGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
            S       AA++P LN  +LL  GL +L D+G VKS++R G   ELL+GPLYY I + L 
Sbjct  136  SSMVARYFAAVVPLLNCIRLLCYGLRLLTDEGVVKSVAREGRPEELLRGPLYYVIVLLLC  195

Query  546  CAV  554
              V
Sbjct  196  TLV  198



>emb|CDO99832.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = +3

Query  240  AFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnif  419
            A++ +  ++++       QNL+RKLVH+  G++FM  WPMFS+       A+L+P +N  
Sbjct  103  AYTLVSTFDKLTSANLIQQNLSRKLVHILSGLLFMASWPMFSTSTGARYFASLVPLINCL  162

Query  420  kllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
            +L++ GL + KD+G V S++R G   ELL+GPLYY + + L+
Sbjct  163  RLVVYGLSLAKDEGLVNSVTREGKPEELLRGPLYYVMILILS  204



>ref|XP_008795888.1| PREDICTED: probable phytol kinase, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=278

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 66/104 (63%), Gaps = 0/104 (0%)
 Frame = +3

Query  243  FSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifk  422
            +S +R ++ + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA +P +N  +
Sbjct  86   YSLVRAFDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSIEARYFAAFVPLVNCIR  145

Query  423  llllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+  GL I  D+G +KS++R G   ELL+GPLYY + +     V
Sbjct  146  LVTYGLRIFSDEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVV  189



>ref|XP_009130827.1| PREDICTED: phytol kinase 1, chloroplastic-like [Brassica rapa]
 gb|AFB74217.1| phytol kinase [Brassica napus]
Length=307

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +3

Query  186  SGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFS  365
            S + ++ D+ A+V   G A++ +  +E + KR    Q L+RKLVH+  G++F+L WP+FS
Sbjct  66   STDYLLHDVGATVAVLGGAYALVLLFESLTKRDVIPQRLSRKLVHILSGLLFVLSWPIFS  125

Query  366  SGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
            +  +    AA +P +N  +L++ GL +  +   ++S++R G   ELLKGPL+Y + + +A
Sbjct  126  ASTEARYFAAFVPLVNGLRLVVNGLSVSPNSTLIQSVTREGRPEELLKGPLFYVLALLVA  185

Query  546  C  548
             
Sbjct  186  A  186



>ref|XP_008805007.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=186

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            ML WP+FSSG     +AA++PG+NI ++LL+GLGI ++D  VKSMSR GDYRELLKGPLY
Sbjct  1    MLFWPLFSSGSHAPFLAAVVPGINIIRMLLMGLGIWRNDAIVKSMSRHGDYRELLKGPLY  60

Query  522  YAITITLA  545
            YA  +TLA
Sbjct  61   YACALTLA  68



>ref|XP_006588439.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Glycine max]
 ref|XP_006588440.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Glycine max]
Length=250

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +3

Query  264  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  443
            + +  R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  35   DSLGLRKLIGQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGLS  94

Query  444  ilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +  D+G +KS++R GD  ELL+GPLYY + + L+  V
Sbjct  95   LASDEGLIKSVTREGDPLELLRGPLYYVLILILSALV  131



>gb|ABA42672.1| phytol kinase [Zea mays]
Length=268

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D   +VL    A+S +R ++E+ +R   +++L+RK+VHV  G++FM  WP+ S+  +   
Sbjct  28   DGAVTVLITAGAYSLVRVFDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLVSNSTEARY  87

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL+ GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  88   FAAVVPFLNSMRLLIYGLRLYTDEALVKSVTREGKPEELLRGPLYY  133



>gb|KJB20421.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=160

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  450  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            KD+ TVKSMSR+G+YRELLKGPLYYAIT+TLAC V
Sbjct  10   KDEATVKSMSRYGNYRELLKGPLYYAITVTLACVV  44



>ref|XP_001418836.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97129.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=251

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 62/106 (58%), Gaps = 0/106 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D+ AS L+   AF  ++ ++ +A RG F    +RKLVHV+ G  F   WP+FS+      
Sbjct  19   DVAASALTTIGAFVWVKAFDALADRGAFASTTSRKLVHVTSGTFFACTWPLFSASGAARF  78

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA IP     +L  +G G++K+   V+++SR G   ELLKGPLYY
Sbjct  79   FAAAIPLAQGVRLFGIGSGMIKNASAVRAVSREGGKEELLKGPLYY  124



>gb|AFW84692.1| hypothetical protein ZEAMMB73_467064 [Zea mays]
Length=187

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            ML WP+FSSG     +AAL PG+NI ++LLLGLG++K++  VKSMSR GDYRELLKGPLY
Sbjct  1    MLFWPLFSSGWYTPFLAALAPGVNIIRMLLLGLGLMKNEAMVKSMSRSGDYRELLKGPLY  60

Query  522  YAITITLACAV  554
            YA TIT A ++
Sbjct  61   YAATITFATSL  71



>gb|KJB60479.1| hypothetical protein B456_009G307400 [Gossypium raimondii]
Length=221

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            ASV +G  A++ +  ++ + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+
Sbjct  69   ASVFAG--AYALVFTFDILTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFAS  126

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+P  N  +L++ GL +  D   +KS++R G+ +ELL+GPLYY + + + CA+
Sbjct  127  LVPLFNCLRLVIHGLSLTDDQSLIKSVTREGNPKELLRGPLYY-VAMLMLCAL  178



>emb|CDY69673.1| BnaCnng64700D [Brassica napus]
Length=304

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +3

Query  201  VGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQG  380
            VG  VA VLSG  A++ +  +E + KR    Q L+RKLVH+  G++F L WP+FS+  + 
Sbjct  71   VGATVA-VLSG--AYALVLLFESLTKRDVIPQRLSRKLVHILSGLLFALSWPIFSASTEA  127

Query  381  ALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
               AA +P +N  +L++ GL +  +   ++S++R G   ELLKGPL+Y + + +A 
Sbjct  128  RYFAAFVPLVNGLRLVVNGLSVSPNSTLIQSVTREGRPEELLKGPLFYVLALLVAA  183



>ref|XP_009774666.1| PREDICTED: probable phytol kinase 3, chloroplastic, partial [Nicotiana 
sylvestris]
Length=96

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  150  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQ  296
            ++ S+     MF  NPV+GDL+A+ LSGGIA S LR WEE AKRG FDQ
Sbjct  48   RLHSEVRPKAMFLENPVMGDLIATALSGGIALSMLRLWEETAKRGVFDQ  96



>ref|XP_010278283.1| PREDICTED: probable phytol kinase, chloroplastic [Nelumbo nucifera]
Length=326

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D  A++L    A++ +  ++++      +Q  +RKLVH+  G+++M  WP+FS+      
Sbjct  87   DAGATMLVTAGAYALVLAFDKLTMLNVVEQTFSRKLVHILSGLLYMFSWPIFSTSITARF  146

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
             AAL+P LN  +L++ GL +  D+G VKS++R G+  ELL+GPLYY + + L CAV
Sbjct  147  FAALVPFLNCVRLVVYGLSLANDEGLVKSVTREGNPEELLRGPLYYVLILIL-CAV  201



>gb|KJB60478.1| hypothetical protein B456_009G307400 [Gossypium raimondii]
Length=298

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            ASV +G  A++ +  ++ + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+
Sbjct  69   ASVFAG--AYALVFTFDILTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFAS  126

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+P  N  +L++ GL +  D   +KS++R G+ +ELL+GPLYY + + + CA+
Sbjct  127  LVPLFNCLRLVIHGLSLTDDQSLIKSVTREGNPKELLRGPLYY-VAMLMLCAL  178



>ref|XP_004344106.1| phytol kinase 2, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR20703.1| phytol kinase 2, putative [Acanthamoeba castellanii str. Neff]
Length=238

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +3

Query  237  IAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglni  416
            +A   L+  E +  RG    N  RK +HV  G +F+LCW  F    Q    AA++PGL  
Sbjct  15   VALLWLKAMETLRDRGVLSANACRKWIHVGTGPLFILCWLAFPQDAQARYWAAVVPGLIT  74

Query  417  fkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAI  530
             +  LLGLG+LKD+ TV+S+SR GD  ELLKGPL Y I
Sbjct  75   LRFALLGLGVLKDEKTVRSLSRTGDRTELLKGPLIYGI  112



>gb|EPS60714.1| phytol kinase, partial [Genlisea aurea]
Length=241

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = +3

Query  183  FSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMF  362
            FSG  V+ D+ A+ L  G A++ +  ++ +  R   ++ L+RKLVH+  G++F+  WP+F
Sbjct  2    FSG-IVLQDVGATGLIVGGAYALVSVFDLLTSRKIVEKALSRKLVHILSGLLFLAAWPIF  60

Query  363  SSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITL  542
            S+      +A+L+P +N  +LLL GL + KD+  + S+SR G   ELL+GPLYY + + L
Sbjct  61   STSTGARYLASLVPTMNFLRLLLNGLSLTKDEALIASVSREGKPEELLRGPLYYVVVLML  120



>emb|CBI40186.3| unnamed protein product [Vitis vinifera]
Length=294

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query  264  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  443
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N  +L++ GL 
Sbjct  79   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCLRLVIYGLS  138

Query  444  ilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +  D+G +KS++R G   ELL+GPLYY + I L C +
Sbjct  139  LATDEGLIKSVTREGKPEELLRGPLYYVL-ILLVCTM  174



>gb|KHG03995.1| putative phytol kinase 1, chloroplastic [Gossypium arboreum]
Length=334

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            ASV +G  A++ +  ++ + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+
Sbjct  105  ASVFAG--AYALVFTFDILTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFAS  162

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+P +N  +L++ GL +  D   +KS++R G+ +ELL+GPLYY + + + CA+
Sbjct  163  LVPLINCLRLVIHGLSLSDDQSLIKSVTREGNPKELLRGPLYY-VAMLMLCAL  214



>ref|XP_002269950.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Vitis vinifera]
Length=302

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query  264  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  443
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N  +L++ GL 
Sbjct  87   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCLRLVIYGLS  146

Query  444  ilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +  D+G +KS++R G   ELL+GPLYY + I L C +
Sbjct  147  LATDEGLIKSVTREGKPEELLRGPLYYVL-ILLVCTM  182



>ref|XP_006838740.1| hypothetical protein AMTR_s00002p00254420 [Amborella trichopoda]
 gb|ERN01309.1| hypothetical protein AMTR_s00002p00254420 [Amborella trichopoda]
Length=255

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  VGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQG  380
            V D+ A VL    A+  +  ++ + K+   +Q L+RKLVH+  G++F+  WP+FSS  + 
Sbjct  17   VQDVGAMVLVMSGAYFLVLSFDVLTKKSIIEQKLSRKLVHILSGLLFLSSWPIFSSSVEA  76

Query  381  ALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
               AA++P +N  +L++ GL I+ ++G V+S++R G   ELL+GPLYY + +
Sbjct  77   RYFAAIVPLVNSLRLVVYGLSIVTNEGLVQSVTRDGRPEELLRGPLYYVLAL  128



>gb|KHN00934.1| Putative phytol kinase 1, chloroplastic [Glycine soja]
Length=227

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 66/103 (64%), Gaps = 1/103 (1%)
 Frame = +3

Query  246  SCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkl  425
            S L  +  + +R      L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +L
Sbjct  6    SPLLVFSAVHRRAPPPSGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRL  65

Query  426  lllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+ GL +  D+G +KS++R GD  ELL+GPLYY + I + CA+
Sbjct  66   LVNGLSLASDEGLIKSVTREGDPLELLRGPLYY-VLILIFCAL  107



>emb|CDY44860.1| BnaC09g50600D [Brassica napus]
Length=299

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL A+    G A++ +  +E + KR    Q L+RKLVH+  G++F+L WP+FS+ ++   
Sbjct  65   DLGATGAVLGGAYALVLSFESLTKRNVISQRLSRKLVHILSGLLFVLSWPIFSASKEARY  124

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
              AL+P +N  +L++ GL I  +   +KS++R G   ELL+GPL+Y + + ++ 
Sbjct  125  FTALVPLVNCVRLVVNGLSISPNSTLIKSVTREGRPEELLRGPLFYVLALLVSA  178



>ref|XP_007010114.1| Vitamin E pathway gene 5 isoform 1 [Theobroma cacao]
 gb|EOY18924.1| Vitamin E pathway gene 5 isoform 1 [Theobroma cacao]
Length=348

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A++ +  ++ + ++    QNL+RKLVH+  G++F + WP+FS+       A+
Sbjct  119  AAVLAG--AYALVFTFDTLTQKELIQQNLSRKLVHILSGLLFAVSWPIFSNSLLARYFAS  176

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ GL +  D   +KS++R G+ +ELL+GPLYY + + L CA+
Sbjct  177  VVPLVNCVRLVIHGLSLADDQRLIKSVTREGNPKELLRGPLYYVLILIL-CAL  228



>ref|XP_007010115.1| Vitamin E pathway gene 5 isoform 2 [Theobroma cacao]
 gb|EOY18925.1| Vitamin E pathway gene 5 isoform 2 [Theobroma cacao]
Length=345

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A+VL+G  A++ +  ++ + ++    QNL+RKLVH+  G++F + WP+FS+       A+
Sbjct  119  AAVLAG--AYALVFTFDTLTQKELIQQNLSRKLVHILSGLLFAVSWPIFSNSLLARYFAS  176

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            ++P +N  +L++ GL +  D   +KS++R G+ +ELL+GPLYY + + L CA+
Sbjct  177  VVPLVNCVRLVIHGLSLADDQRLIKSVTREGNPKELLRGPLYYVLILIL-CAL  228



>ref|XP_004960241.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=300

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +3

Query  240  AFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnif  419
            A++ +R ++ + +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  
Sbjct  74   AYALVRTFDVLTERRLVEKSLSRKIVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSM  133

Query  420  kllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
            +LL  GL +  D+  VKS++R G   ELL+GPLYY
Sbjct  134  RLLTYGLRLSTDEALVKSVTREGKPEELLRGPLYY  168



>ref|XP_002955247.1| hypothetical protein VOLCADRAFT_45651 [Volvox carteri f. nagariensis]
 gb|EFJ43766.1| hypothetical protein VOLCADRAFT_45651 [Volvox carteri f. nagariensis]
Length=198

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  QNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKS  473
            Q L+RKLVH + G +F+L W +FS+      +AA++P LN  +L+ +G G++ D G VKS
Sbjct  1    QKLSRKLVHTTTGPIFVLTWILFSASPDARYLAAVVPMLNFSRLMAVGTGLISDPGLVKS  60

Query  474  MSRFGDYRELLKGPLYYAITITLA  545
            +SR GD  ELLKGPL+Y +T+  A
Sbjct  61   VSRSGDRGELLKGPLFYVVTLVAA  84



>ref|XP_011098893.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=241

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            +  DL A+V S G+    + F++          +L RKL+H+S G++ MLCWPMFS    
Sbjct  6    IAADLFAAVFSFGVCQLVIAFFKLTYDLALIHIHLYRKLIHISAGLIVMLCWPMFSGDLW  65

Query  378  GALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
            G + AALIPGL +FKLL+  L   K+   +K + R+ D R+L++  L Y ++I
Sbjct  66   GRVCAALIPGLCVFKLLVPALITQKEHQLIKLLQRYRDSRDLVQATLAYVLSI  118



>gb|KFK24895.1| hypothetical protein AALP_AA8G038700 [Arabis alpina]
Length=302

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 72/116 (62%), Gaps = 0/116 (0%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQ  377
            ++ D+ A+V   G A++ +  ++ + KR    Q+L+RKLVH+  G++F+L WP+FS   +
Sbjct  65   ILHDVGATVAVLGGAYALVLSFDNLTKRNVIPQSLSRKLVHILSGLLFVLSWPIFSESTE  124

Query  378  GALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
                AA +P +N  +L++ GL +  +   +KS++R G   ELL+GPL+Y   + ++
Sbjct  125  ARYFAAFVPLVNCLRLVVNGLSVTPNSTLIKSVTREGRPEELLRGPLFYVFALLVS  180



>ref|XP_010665627.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=317

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +3

Query  261  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  440
            ++ +  R    + L+RKLVH+  G++F+  WP+FS+  +    A+L P  N  +L++ GL
Sbjct  101  FDYLTDRNIISKKLSRKLVHIFSGLLFVASWPLFSTSSEARYFASLAPLANCLRLVVYGL  160

Query  441  gilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
             +  D+G +KS++R G   ELL GPLYY +T+ + CA+
Sbjct  161  SLATDEGLIKSVTREGKPEELLTGPLYYVLTLAV-CAI  197



>ref|XP_009122590.1| PREDICTED: phytol kinase 1, chloroplastic-like [Brassica rapa]
 emb|CDX70220.1| BnaA10g25690D [Brassica napus]
Length=299

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 70/114 (61%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL A+    G A++ +  +E + KR    Q  +RKLVH+  G++F+L WP+FS  ++   
Sbjct  65   DLGATGAVLGGAYALVLSFESLTKRNVISQRFSRKLVHILSGLLFVLSWPIFSPSKEARY  124

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLAC  548
             AAL+P +N  +L++ GL +  +   +KS++R G   ELL+GPL+Y + + ++ 
Sbjct  125  FAALVPLVNCVRLVVNGLSVSPNSTLIKSVTREGRPEELLRGPLFYVLALLVSA  178



>ref|XP_010906567.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X3 
[Elaeis guineensis]
Length=256

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +3

Query  291  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVK  470
            +Q+L+RK+VHV  G++FM  WP+FSS  +    AA++P +N  +L+  GL I  D+G +K
Sbjct  49   EQSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFAAIVPLVNCIRLVTYGLRIFTDEGLIK  108

Query  471  SMSRFGDYRELLKGPLYYAITITLACAV  554
            S++R G   ELL+GPLYY + + + C+V
Sbjct  109  SVTREGKPEELLRGPLYY-VMVLMFCSV  135



>ref|XP_005770298.1| hypothetical protein EMIHUDRAFT_436338 [Emiliania huxleyi CCMP1516]
 gb|EOD17869.1| hypothetical protein EMIHUDRAFT_436338 [Emiliania huxleyi CCMP1516]
Length=242

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +3

Query  270  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgil  449
            +AK G +     RKL+H++ G VF+L WP F      A+ AA +P     K  L+G G++
Sbjct  31   LAKAGVYPTTFTRKLLHMAAGPVFILTWPWFGKQPSSAVWAAAVPACMTAKFALVGAGLI  90

Query  450  KDDGTVKSMSRFGDYRELLKGPLYY  524
            + D  VK MSR GD RELL+GPL Y
Sbjct  91   QQDADVKLMSRTGDRRELLRGPLLY  115



>ref|XP_005773265.1| hypothetical protein EMIHUDRAFT_369009 [Emiliania huxleyi CCMP1516]
 gb|EOD20836.1| hypothetical protein EMIHUDRAFT_369009 [Emiliania huxleyi CCMP1516]
Length=241

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +3

Query  270  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgil  449
            +AK G +     RKL+H++ G VF+L WP F      A+ AA +P     K  L+G G++
Sbjct  30   LAKAGVYPTTFTRKLLHMAAGPVFILTWPWFGKQPSSAVWAAAVPACMTAKFALVGAGLI  89

Query  450  KDDGTVKSMSRFGDYRELLKGPLYY  524
            + D  VK MSR GD RELL+GPL Y
Sbjct  90   QQDADVKLMSRTGDRRELLRGPLLY  114



>ref|WP_040625197.1| phosphatidate cytidylyltransferase [Smithella sp. ME-1]
Length=233

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +3

Query  237  IAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglni  416
            I+   LRF +  A +G   + L+RK++H+  G +F+L W +F        +AA+IP    
Sbjct  13   ISIIWLRFIDYFASKGLISKKLSRKIIHIGTGPIFVLSWLLFPEDPLSRYLAAIIPLFIT  72

Query  417  fkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITL  542
             +  L+G+G++ D  +V +MSR GD +E+LKGP +Y +   L
Sbjct  73   IQFFLIGIGVINDQASVDAMSRTGDPKEILKGPFFYGVIFVL  114



>emb|CDP04896.1| unnamed protein product [Coffea canephora]
Length=142

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  327  MGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGD-YREL  503
            MG+VF LCWP FSSG QG  +AA++PG N FK+LLLGL + KD+  VK MS  GD YR++
Sbjct  1    MGLVFTLCWPRFSSGNQGGFLAAMVPGFNAFKMLLLGLEMRKDEKAVKLMSGLGDHYRQI  60

Query  504  LKGPLYYAITITLACAV  554
            LK   Y+   I+LA  V
Sbjct  61   LKASFYFLTAISLASVV  77



>ref|WP_026735418.1| phosphatidate cytidylyltransferase [Fischerella sp. PCC 9605]
Length=234

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 1/117 (1%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            NP+VG+L+A+VL+    F  +        R    Q+++RK+ H+  G +     P++S  
Sbjct  9    NPLVGNLIATVLTFIYVFGLVALMNFCVTRLGLAQDISRKITHIGAGSIIAFL-PLYSDL  67

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITL  542
                 +   I  + +  L+  G     DD  VK+M+R GD RELLKGPLY+ I  T+
Sbjct  68   HWSKYLNVTIFLVWLILLIQKGFFASPDDEAVKTMTRTGDRRELLKGPLYFVIVATI  124



>ref|XP_003057921.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57872.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=248

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = +3

Query  252  LRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifklll  431
            ++ ++ +A     ++ L+RKL+H S G  F+L WP+FS+       AA +P L   +L+ 
Sbjct  30   VKLFDVLASNDVLERKLSRKLIHTSCGPFFVLLWPLFSASPSAKYFAAAVPVLQGIRLMA  89

Query  432  lglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +G+G ++++  ++++SR GD  ELL+GPLYY   + +  AV
Sbjct  90   IGVGAIENEDAIRAVSREGDRTELLRGPLYYTAVLVVCTAV  130



>ref|XP_004996012.1| hypothetical protein PTSG_03426 [Salpingoeca rosetta]
 gb|EGD82776.1| hypothetical protein PTSG_03426 [Salpingoeca rosetta]
Length=237

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = +3

Query  210  LVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSS--GRQGA  383
            LV+  ++G +  +  +    +A          R+L H  MG VFM CWP+FS+    Q A
Sbjct  4    LVSYAVTGAVCLALEQGLRALAGHQVVSSVTARRLTHALMGPVFMGCWPLFSATPTTQEA  63

Query  384  LVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            L+AA +P L   K  L+G GIL DD TV+ + R GD  E+L GP+ Y I  T A A+
Sbjct  64   LLAASVPLLVTLKFALIGFGILNDDFTVRMLCRHGDRTEILYGPVQYGIIFTTATAL  120



>gb|EYU45411.1| hypothetical protein MIMGU_mgv1a012281mg [Erythranthe guttata]
Length=255

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (56%), Gaps = 2/97 (2%)
 Frame = +3

Query  255  RFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllll  434
            R  ++   +G  + +L RKLVH+SMG++ MLCWPM S GR+  ++        +    +L
Sbjct  39   RLLKQSYDKGLLNVHLFRKLVHISMGLIIMLCWPMLSCGRRRRILGG--LVPVLCMYRVL  96

Query  435  glgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
              G   +   + S  R+ DYRELLK  L YA+ + LA
Sbjct  97   LAGFGTNYKPMDSQGRYRDYRELLKAALGYALAVFLA  133



>ref|XP_002500009.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61267.1| predicted protein, partial [Micromonas sp. RCC299]
Length=235

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 62/101 (61%), Gaps = 0/101 (0%)
 Frame = +3

Query  252  LRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifklll  431
            ++ ++ +A +   ++ L+RK++H + G  F L WP+FSS       AA +P L   +L  
Sbjct  17   VKLFDVLASKKILERKLSRKVIHTTSGPFFALTWPLFSSSPAACYFAACVPALQAVRLFG  76

Query  432  lglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            +G G++K++  V+++SR GD  ELLKGPL Y I + +  A+
Sbjct  77   IGSGLIKNENAVRAVSREGDKGELLKGPLIYTIVLVVTTAL  117



>ref|XP_009804931.1| PREDICTED: probable phytol kinase 2, chloroplastic [Nicotiana 
sylvestris]
Length=102

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYR  497
            MLCWPMFSS RQGA++A+LIPGLNI K+LLLGLG+ KDD TVKSMSRFGD+R
Sbjct  1    MLCWPMFSSDRQGAILASLIPGLNIIKMLLLGLGLWKDDATVKSMSRFGDHR  52



>ref|WP_016859908.1| phosphatidate cytidylyltransferase [Fischerella muscicola]
Length=234

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            +P+VG+L+A+VL+    F  +        R    Q+L+RK+ H+  G + +   P+++  
Sbjct  9    SPLVGNLIATVLTFIYVFGLVALMNICVTRFGLPQDLSRKITHIGAGSIIVFL-PLYNDS  67

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
                 +  LI  + +  L+  GL    DD  VK+M+R GD RELLKGPLY+ I 
Sbjct  68   HWSKYLNILIMVVWLILLIQKGLFANPDDEAVKTMTRTGDRRELLKGPLYFVIV  121



>gb|EWM22868.1| phosphatidate cytidylyltransferase [Nannochloropsis gaditana]
Length=301

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +3

Query  270  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgil  449
            +A R        RKL+H+  G +F+LCWP+FSS    +  AA  P        ++GLGI+
Sbjct  54   LATRNICASTTARKLMHIGCGPIFLLCWPLFSSLPSASYFAAGAPLALTSFFTIVGLGII  113

Query  450  KDDGTVKSMSRFGDYRELLKGPLYYAITITLA  545
             +  TVKSMSR G  +ELL+GPL+Y   + +A
Sbjct  114  VNPATVKSMSRTGARQELLRGPLFYGSVMIIA  145



>ref|WP_026723041.1| phosphatidate cytidylyltransferase [Fischerella sp. PCC 9431]
Length=234

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 64/118 (54%), Gaps = 1/118 (1%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPM  359
            +F  +P+VG+L+A+VL+    F  +        R    Q+++RK+ H+  G + +   P+
Sbjct  5    IFGVSPLVGNLLATVLTFIYVFGLVALMNICVTRFGLPQDISRKITHIGAGSIIVFL-PL  63

Query  360  FSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
            ++       +  LI  + +  L+  GL    DD  VK+M+R GD RELLKGPLY+ I 
Sbjct  64   YNDLHWSKYLNILIMVVWLILLIQKGLFADSDDEAVKTMTRTGDRRELLKGPLYFVIV  121



>ref|XP_007514499.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14739.1| predicted protein [Bathycoccus prasinos]
Length=345

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            + VV D+VA+VL+   +   ++ ++E+A+R   +  L+RKLVHV+ G  F + W +F   
Sbjct  97   HAVVRDVVATVLTISGSLLWVKLFDELARREILEAKLSRKLVHVTSGTFFAMTWCLFGDQ  156

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITI  536
                  A L+P L  F+L  +G G++++   V+++SR G   ELL GP YY I +
Sbjct  157  WYSKAFATLVPSLQAFRLFAIGSGLIENKNAVRAVSRGGGKEELLYGPFYYTIVL  211



>ref|XP_008795887.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=280

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 52/104 (50%), Gaps = 29/104 (28%)
 Frame = +3

Query  243  FSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifk  422
            +S +R ++ + +R   +++L+RK+VHV  G++FM  WP+FS                   
Sbjct  86   YSLVRAFDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFS-------------------  126

Query  423  llllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
                      D+G +KS++R G   ELL+GPLYY + +     V
Sbjct  127  ----------DEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVV  160



>ref|WP_008082386.1| phosphatidate cytidylyltransferase [Aciduliprofundum boonei]
 ref|YP_003482797.1| phosphatidate cytidylyltransferase [Aciduliprofundum boonei T469]
 gb|EDY36944.1| phosphatidate cytidylyltransferase [Aciduliprofundum boonei T469]
 gb|ADD08235.1| phosphatidate cytidylyltransferase [Aciduliprofundum boonei T469]
Length=275

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFML  347
            +GL  F G P+V D+VA  ++    F  +   +++   G    N++RK++H     +++ 
Sbjct  1    MGLLGFIGIPIVEDIVAFFITLIAIFGLIGINDKLRNSGKLSINVSRKIIHTFAAPIYIF  60

Query  348  CWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYA  527
             +P +S      L+A ++P +   K L +GLGI KD+  V +MSR GD RELL+G  YY 
Sbjct  61   FFPFYSGSWYSPLIAMIVPLIFALKFLTVGLGIAKDEAFVNTMSRSGDPRELLRGTFYYT  120

Query  528  ITITLAC  548
            + +    
Sbjct  121  LVMIFVT  127



>ref|WP_008085193.1| phosphatidate cytidylyltransferase [Aciduliprofundum boonei]
 gb|EDY35068.1| phosphatidate cytidylyltransferase [Aciduliprofundum boonei T469]
Length=274

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFML  347
            +GL  F G P+V D+VA  ++    F  +   +++   G    N++RK++H     +++ 
Sbjct  1    MGLLGFIGIPIVEDIVAFFITLIAIFGLIGINDKLRNSGKLSINVSRKIIHTFAAPIYIF  60

Query  348  CWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYA  527
             +P +S      L+A ++P +   K L +GLGI KD+  V +MSR GD RELL+G  YY 
Sbjct  61   FFPFYSGSWYSPLIAMIVPLIFALKFLTVGLGIAKDEAFVNTMSRSGDPRELLRGTFYYT  120

Query  528  ITITLAC  548
            + +    
Sbjct  121  LVMIFVT  127



>sp|Q2N2K3.1|PHYK_WHEAT RecName: Full=Probable phytol kinase, chloroplastic; Flags: Precursor 
[Triticum aestivum]
 gb|ABA42674.1| phytol kinase [Triticum aestivum]
Length=300

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = +3

Query  216  ASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAA  395
            A++L    A+S +R ++ + +R    Q+L+RK+VHV  G+ FM  WP+FS+       AA
Sbjct  66   ATLLVTAGAYSLVRAFDALTERRLVQQSLSRKVVHVLSGVFFMASWPLFSNSTSARFFAA  125

Query  396  lipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGP  515
            ++P LN  +LL  GLG   D+  VKS++R G   ELL+GP
Sbjct  126  VVPFLNCVRLLTYGLGFYSDEALVKSVTREGKREELLRGP  165



>ref|XP_005854647.1| hypothetical protein NGA_2086500 [Nannochloropsis gaditana CCMP526]
 gb|EKU21713.1| hypothetical protein NGA_2086500 [Nannochloropsis gaditana CCMP526]
Length=344

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 63/134 (47%), Gaps = 18/134 (13%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL  + L G  +   L+ W  +A  G  D   +RKL+H   G +F+LCWP FS+     L
Sbjct  97   DLGGAALVGMASAVWLKLWTSLAISGAIDSKDSRKLIHCGSGPLFLLCWPFFSAEGTARL  156

Query  387  VAAlipglnifkllllglgil------------------KDDGTVKSMSRFGDYRELLKG  512
             AA +P L I  ++  GL                     K  G V ++SR G+  E+L+G
Sbjct  157  FAAGVPLLQIVAMIASGLAKAPSPAKNDSGIGAGESAMGKPSGLVAAISRSGNPAEVLRG  216

Query  513  PLYYAITITLACAV  554
            PL Y + + LA  V
Sbjct  217  PLIYVVILLLATVV  230



>gb|EWM28810.1| Phosphatidate cytidylyltransferase [Nannochloropsis gaditana]
Length=344

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 63/134 (47%), Gaps = 18/134 (13%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            DL  + L G  +   L+ W  +A  G  D   +RKL+H   G +F+LCWP FS+     L
Sbjct  97   DLGGAALVGMASAVWLKLWTSLAISGAIDSKDSRKLIHCGSGPLFLLCWPFFSAEGTARL  156

Query  387  VAAlipglnifkllllglgil------------------KDDGTVKSMSRFGDYRELLKG  512
             AA +P L I  ++  GL                     K  G V ++SR G+  E+L+G
Sbjct  157  FAAGVPLLQIVAMIASGLAKAPSPAKNDSGIRAGESAMGKPSGLVAAISRSGNPAEVLRG  216

Query  513  PLYYAITITLACAV  554
            PL Y + + LA  V
Sbjct  217  PLIYVVILLLATVV  230



>ref|XP_005781745.1| hypothetical protein EMIHUDRAFT_99736 [Emiliania huxleyi CCMP1516]
 gb|EOD29316.1| hypothetical protein EMIHUDRAFT_99736 [Emiliania huxleyi CCMP1516]
Length=311

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 55/126 (44%), Gaps = 12/126 (10%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D  ++ +  G A+  + FW ++A  G    NL+RK++H     +FMLCWP+FS      +
Sbjct  70   DAASASVCAGAAWMWVAFWSKLAADGRIQPNLSRKIIHTGSAPLFMLCWPLFSPAPSAPI  129

Query  387  VAAli----------pglnifkllllglgilKDDGT--VKSMSRFGDYRELLKGPLYYAI  530
            +A  +           G               DD    VK++SR G   E L GP  Y +
Sbjct  130  LAGAVPLLQIIRLYRAGRAQPAQPTPVGAAEADDTADLVKAISRSGSRSEALGGPFLYTL  189

Query  531  TITLAC  548
             + +A 
Sbjct  190  VLLVAT  195



>ref|XP_005777419.1| hypothetical protein EMIHUDRAFT_469241 [Emiliania huxleyi CCMP1516]
 gb|EOD24990.1| hypothetical protein EMIHUDRAFT_469241 [Emiliania huxleyi CCMP1516]
Length=341

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 55/126 (44%), Gaps = 12/126 (10%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D  ++ +  G A+  + FW ++A  G    NL+RK++H     +FMLCWP+FS      +
Sbjct  66   DAASASVCAGAAWMWVAFWSKLAADGRIQPNLSRKIIHTGSAPLFMLCWPLFSPAPSAPI  125

Query  387  VAAli----------pglnifkllllglgilKDDGT--VKSMSRFGDYRELLKGPLYYAI  530
            +A  +           G               DD    VK++SR G   E L GP  Y +
Sbjct  126  LAGAVPLLQIIRLYRAGRAQPAQPTPVGAAEADDTADLVKAISRSGSRSEALGGPFLYTL  185

Query  531  TITLAC  548
             + +A 
Sbjct  186  VLLVAT  191



>ref|WP_015283132.1| dolichol kinase [Aciduliprofundum sp. MAR08-339]
 ref|YP_007246674.1| dolichol kinase [Aciduliprofundum sp. MAR08-339]
 gb|AGB04508.1| dolichol kinase [Aciduliprofundum sp. MAR08-339]
Length=275

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +3

Query  168  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFML  347
            +GL  F G P+V D++A  ++    F+ +   +++   G    N++RK++H     +++ 
Sbjct  1    MGLLAFIGIPIVEDIIAFFITLVAIFALIGINDKLRNSGKLSINVSRKVIHTFAAPIYVF  60

Query  348  CWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYA  527
             +P +SS     ++A+++P +   K L +GLGI +D+  V +MSR GD +ELL+G  YY 
Sbjct  61   FFPFYSSSWYSPIIASIVPLIFALKFLTIGLGISRDEAFVNTMSRSGDPKELLRGTFYYT  120

Query  528  I  530
            +
Sbjct  121  L  121



>ref|XP_009396497.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=328

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  186  SGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFD-QNLNRKLVHVSMGMVFMLCWPMF  362
            S   V+ D  A+      A+S +  ++ +A+R     Q+L+RK VHV  G+++M  WP F
Sbjct  76   SAGVVLQDAAATTFCFAGAYSLVLVFDTLAERNIIQKQSLSRKAVHVLSGLLYMATWPFF  135

Query  363  -----------SSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLK  509
                       SS       AA++P LN  +LL  GL +L D+G VKS++R G   ELL+
Sbjct  136  RSVIVLTQSICSSSMVARYFAAVVPLLNCIRLLCYGLRLLTDEGVVKSVAREGRPEELLR  195

Query  510  GPLYYAITITLACAV  554
            GPLYY I + L   V
Sbjct  196  GPLYYVIVLLLCTLV  210



>ref|XP_005645987.1| hypothetical protein COCSUDRAFT_53992 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21443.1| hypothetical protein COCSUDRAFT_53992 [Coccomyxa subellipsoidea 
C-169]
Length=238

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  AKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgilK  452
            ++R   DQ L+RK++H+  G++F+L WP ++       + A +P +      ++GLG + 
Sbjct  25   SRRKVMDQTLSRKVMHIGNGILFVLFWPCYTEHAVSKYLCASVPLVAALHFAMVGLGAVT  84

Query  453  DDGTVKSMSRFGDYRELLKGPLYYAITI  536
            D+  V S +R GD RELL+GPL Y   I
Sbjct  85   DESLVASATRTGDRRELLRGPLLYGTII  112



>ref|XP_005850569.1| hypothetical protein CHLNCDRAFT_140477 [Chlorella variabilis]
 gb|EFN58467.1| hypothetical protein CHLNCDRAFT_140477 [Chlorella variabilis]
Length=286

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +3

Query  270  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgil  449
            + + G     L RK++H+  G ++MLCWP++S+      +AA +P L   + +L+G GI+
Sbjct  31   VGRLGLLPTRLARKMMHIGTGPLYMLCWPLYSAAPSSRWLAASVPALAGVQFMLVGTGIV  90

Query  450  KDDGTVKSMSRFGDYRELLKGPLYYA  527
            +DD  V   SR G   ELL+GPL YA
Sbjct  91   RDDTLVAGASRSGRREELLRGPLLYA  116



>gb|AFW84693.1| hypothetical protein ZEAMMB73_467064 [Zea mays]
Length=160

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  450  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV  554
            K++  VKSMSR GDYRELLKGPLYYA TIT A ++
Sbjct  10   KNEAMVKSMSRSGDYRELLKGPLYYAATITFATSL  44



>gb|EMT05709.1| Putative phytol kinase 2, chloroplastic [Aegilops tauschii]
Length=267

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 18/78 (23%)
 Frame = +3

Query  198  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFD------------------QNLNRKLVHV  323
            +V DLV+S L+ G+A     F + + +RG+ D                    LNRKL+H+
Sbjct  13   LVQDLVSSALTAGVAHGLFHFIQGLVERGFCDLWDLYKNLYLGMVGVYLIMKLNRKLMHI  72

Query  324  SMGMVFMLCWPMFSSGRQ  377
            ++GMV +L WP+FSSGR+
Sbjct  73   TIGMVPLLFWPLFSSGRE  90



>ref|WP_017309557.1| phosphatidate cytidylyltransferase [Fischerella sp. PCC 9339]
Length=234

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 64/120 (53%), Gaps = 2/120 (2%)
 Frame = +3

Query  192  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSG  371
            +P+VG+L+A+VL+    F  +             Q+++RK+ H+  G + +   P+++  
Sbjct  9    SPLVGNLLATVLTFIYVFGLVALMNFCVTSFGLPQDISRKITHIGAGSIIVFL-PLYNDL  67

Query  372  RQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAITITLACA  551
                 +  LI  + +  L+  G     DD  VK+M+R GD RELLKGPLY+ I I++ C 
Sbjct  68   HWSKYLNILIMVVWLILLIQKGFFANPDDEAVKTMTRTGDRRELLKGPLYFVI-ISIICG  126



>tpg|DAA35442.1| TPA: hypothetical protein ZEAMMB73_657762 [Zea mays]
Length=159

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D   +VL    A+S +R ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +   
Sbjct  63   DGAVTVLITAGAYSLVRVFDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARY  122

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGD  491
             AA++P LN  +LL+ GL +  D+  VKS++R G 
Sbjct  123  FAAVVPFLNSMRLLIYGLRLYTDEALVKSVTREGK  157



>emb|CDP05574.1| unnamed protein product [Coffea canephora]
Length=165

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  342  MLCWPMFSSGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLY  521
            MLCWPMFSSG QG  +AA++PG N FKLLLLGL + KD+  VK MS  GD+  +L    Y
Sbjct  1    MLCWPMFSSGNQGGFLAAMVPGFNAFKLLLLGLEMRKDEKAVKLMSGLGDHCSVLNASFY  60

Query  522  YAITITLACAV  554
            Y   I+LA  V
Sbjct  61   YLTAISLASVV  71



>ref|WP_016874337.1| phosphatidate cytidylyltransferase [Chlorogloeopsis fritschii]
Length=235

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = +3

Query  186  SGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFS  365
            S +P+VG+L+ ++L+    F  +        R    Q+++RK+ H+  G + +   P+++
Sbjct  7    SFSPLVGNLLVTLLTFIYVFGLVALMNFCVTRFGLPQDISRKITHIGAGSIIVFL-PLYN  65

Query  366  SGRQGALVAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYYAIT  533
                   +   I  +    L+L G     DD  VK+M+R GD RELLKGPLY+ I 
Sbjct  66   DLHWSKYLNVTIFVVWFILLILKGFFASPDDEAVKTMTRTGDRRELLKGPLYFVIV  121



>ref|XP_002970346.1| hypothetical protein SELMODRAFT_411288 [Selaginella moellendorffii]
 gb|EFJ28476.1| hypothetical protein SELMODRAFT_411288 [Selaginella moellendorffii]
Length=132

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  264  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  443
            E + +    DQ L+RKLVH++MG +FML WP+FSS      + +L+P  N  +LL+LGLG
Sbjct  55   ELLTRFNVLDQKLSRKLVHMTMGPLFMLSWPIFSSSSASRYICSLVPLANAVRLLILGLG  114

Query  444  ilKDDGTVKSMSRFGDYR  497
            +  ++G VKSMSR GD +
Sbjct  115  LGTNEGVVKSMSRDGDAK  132



>sp|Q2N2K2.1|PHYK2_SOYBN RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42675.1| phytol kinase [Glycine max]
Length=292

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 11/106 (10%)
 Frame = +3

Query  207  DLVASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGAL  386
            D   +VL    A+S +R ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +   
Sbjct  63   DGAVTVLITAGAYSLVRVFDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARY  122

Query  387  VAAlipglnifkllllglgilKDDGTVKSMSRFGDYRELLKGPLYY  524
             AA++P LN  +LL+ GL +  D+             ELL+GPLYY
Sbjct  123  FAAVVPFLNSMRLLIYGLRLYTDEAL-----------ELLRGPLYY  157



>ref|XP_010042655.1| PREDICTED: probable phytol kinase 3, chloroplastic isoform X2 
[Eucalyptus grandis]
Length=135

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  180  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDQN  299
            M   NPV+ D +A+ ++GGIA S LR +EE AKRG FDQ+
Sbjct  86   MLHENPVLSDALAAAVTGGIALSSLRLFEETAKRGLFDQS  125



>ref|XP_005818786.1| hypothetical protein GUITHDRAFT_149059 [Guillardia theta CCMP2712]
 gb|EKX31806.1| hypothetical protein GUITHDRAFT_149059 [Guillardia theta CCMP2712]
Length=301

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 55/130 (42%), Gaps = 25/130 (19%)
 Frame = +3

Query  213  VASVLSGGIAFSCLRFWEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVA  392
            +A V+  G   + L  W  +AK G  D  ++RK+VH   G +F+L WP+FSS     L+A
Sbjct  47   IAQVVGAG---AWLAIWSNLAKYGMIDPKVSRKIVHCGSGPLFLLTWPLFSSSHTAPLLA  103

Query  393  ----------------------AlipglnifkllllglgilKDDGTVKSMSRFGDYRELL  506
                                  AL                 +D G V ++SR G   E++
Sbjct  104  SIGLSVQSAADSDELPAVPTINALRLAGEEEGRGESDGRRRRDSGLVTAISRSGRSEEVM  163

Query  507  KGPLYYAITI  536
            +GPL Y + +
Sbjct  164  QGPLIYTLVL  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800