BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF017L05

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608692.1|  PREDICTED: V-type proton ATPase subunit H          259   3e-81   Nicotiana tomentosiformis
ref|XP_006343605.1|  PREDICTED: V-type proton ATPase subunit H-li...    257   3e-80   Solanum tuberosum [potatoes]
ref|XP_004242619.1|  PREDICTED: V-type proton ATPase subunit H          256   6e-80   Solanum lycopersicum
ref|XP_010251374.1|  PREDICTED: V-type proton ATPase subunit H          253   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_007029672.1|  Vacuolar ATP synthase subunit H family prote...    251   4e-78   
ref|XP_011084696.1|  PREDICTED: V-type proton ATPase subunit H-like     251   4e-78   Sesamum indicum [beniseed]
ref|XP_006484607.1|  PREDICTED: V-type proton ATPase subunit H-li...    249   3e-77   Citrus sinensis [apfelsine]
ref|XP_008343829.1|  PREDICTED: V-type proton ATPase subunit H-like     248   9e-77   
ref|XP_007029671.1|  Vacuolar ATP synthase subunit H family prote...    248   1e-76   
ref|XP_010087456.1|  V-type proton ATPase subunit H                     248   1e-76   Morus notabilis
gb|EYU39750.1|  hypothetical protein MIMGU_mgv1a006219mg                247   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_008443235.1|  PREDICTED: V-type proton ATPase subunit H          247   2e-76   Cucumis melo [Oriental melon]
ref|XP_009792608.1|  PREDICTED: V-type proton ATPase subunit H          247   2e-76   Nicotiana sylvestris
ref|XP_004136630.1|  PREDICTED: V-type proton ATPase subunit H-like     246   6e-76   Cucumis sativus [cucumbers]
ref|XP_010023341.1|  PREDICTED: V-type proton ATPase subunit H          244   1e-75   Eucalyptus grandis [rose gum]
gb|AAO65974.1|  putative vacuolar ATPase subunit H protein              244   4e-75   Suaeda salsa
ref|XP_008800912.1|  PREDICTED: probable V-type proton ATPase sub...    244   4e-75   Phoenix dactylifera
emb|CAD27445.1|  putative vacuolar ATPase subunit H                     244   4e-75   Mesembryanthemum crystallinum
ref|XP_008357071.1|  PREDICTED: V-type proton ATPase subunit H-like     243   5e-75   Malus domestica [apple tree]
gb|AIZ49542.1|  V-ATPase subunit H1                                     243   7e-75   Eriobotrya japonica [loquat]
ref|XP_010662098.1|  PREDICTED: V-type proton ATPase subunit H          243   7e-75   Vitis vinifera
gb|EYU39492.1|  hypothetical protein MIMGU_mgv1a006273mg                243   9e-75   Erythranthe guttata [common monkey flower]
ref|XP_006350112.1|  PREDICTED: V-type proton ATPase subunit H-like     243   1e-74   Solanum tuberosum [potatoes]
ref|XP_004307846.1|  PREDICTED: V-type proton ATPase subunit H          242   1e-74   Fragaria vesca subsp. vesca
ref|XP_009361140.1|  PREDICTED: V-type proton ATPase subunit H          242   2e-74   Pyrus x bretschneideri [bai li]
ref|XP_004251740.1|  PREDICTED: V-type proton ATPase subunit H-like     242   2e-74   Solanum lycopersicum
ref|XP_008234540.1|  PREDICTED: V-type proton ATPase subunit H          241   2e-74   Prunus mume [ume]
ref|XP_010673864.1|  PREDICTED: V-type proton ATPase subunit H          242   3e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007217990.1|  hypothetical protein PRUPE_ppa005592mg             241   3e-74   Prunus persica
ref|XP_011077102.1|  PREDICTED: V-type proton ATPase subunit H-like     241   3e-74   Sesamum indicum [beniseed]
ref|XP_008791823.1|  PREDICTED: probable V-type proton ATPase sub...    240   7e-74   Phoenix dactylifera
ref|XP_010912757.1|  PREDICTED: probable V-type proton ATPase sub...    240   8e-74   Elaeis guineensis
ref|XP_010930282.1|  PREDICTED: probable V-type proton ATPase sub...    240   9e-74   Elaeis guineensis
ref|XP_003548002.1|  PREDICTED: V-type proton ATPase subunit H-li...    238   4e-73   Glycine max [soybeans]
ref|XP_004509230.1|  PREDICTED: V-type proton ATPase subunit H-li...    238   4e-73   Cicer arietinum [garbanzo]
ref|XP_011044458.1|  PREDICTED: V-type proton ATPase subunit H is...    236   4e-72   Populus euphratica
gb|KJB18498.1|  hypothetical protein B456_003G056300                    236   4e-72   Gossypium raimondii
ref|XP_006574707.1|  PREDICTED: V-type proton ATPase subunit H-like     236   4e-72   Glycine max [soybeans]
gb|KHG22602.1|  V-type proton ATPase subunit H -like protein            236   8e-72   Gossypium arboreum [tree cotton]
ref|XP_010526971.1|  PREDICTED: V-type proton ATPase subunit H-like     233   5e-71   Tarenaya hassleriana [spider flower]
gb|ACJ85007.1|  unknown                                                 233   5e-71   Medicago truncatula
ref|XP_010547995.1|  PREDICTED: V-type proton ATPase subunit H          232   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_009609770.1|  PREDICTED: V-type proton ATPase subunit H-like     220   4e-70   
ref|XP_006437440.1|  hypothetical protein CICLE_v10031531mg             230   6e-70   
ref|XP_002319248.2|  hypothetical protein POPTR_0013s07630g             225   1e-68   
emb|CDX69032.1|  BnaC01g04210D                                          227   1e-68   
ref|XP_002869169.1|  vacuolar ATP synthase subunit H family protein     226   2e-68   
ref|XP_009115735.1|  PREDICTED: V-type proton ATPase subunit H-like     226   2e-68   Brassica rapa
gb|AAK59761.1|  AT3g42050/F4M19_10                                      226   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189791.1|  V-type proton ATPase subunit H                        226   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432453.1|  PREDICTED: V-type proton ATPase subunit H-like     226   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006412262.1|  hypothetical protein EUTSA_v10025183mg             226   3e-68   
gb|KCW59595.1|  hypothetical protein EUGRSUZ_H02340                     225   4e-68   Eucalyptus grandis [rose gum]
ref|XP_010437658.1|  PREDICTED: V-type proton ATPase subunit H-li...    225   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010447124.1|  PREDICTED: V-type proton ATPase subunit H          224   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009416984.1|  PREDICTED: probable V-type proton ATPase sub...    225   8e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283723.1|  hypothetical protein CARUB_v10004791mg             224   1e-67   Capsella rubella
emb|CBI26482.3|  unnamed protein product                                225   1e-67   Vitis vinifera
ref|XP_010437659.1|  PREDICTED: V-type proton ATPase subunit H-li...    224   2e-67   
ref|XP_009778019.1|  PREDICTED: V-type proton ATPase subunit H-like     221   2e-67   Nicotiana sylvestris
ref|XP_006858816.1|  hypothetical protein AMTR_s00066p00170500          224   3e-67   
gb|ABR17502.1|  unknown                                                 223   3e-67   Picea sitchensis
gb|KJB26715.1|  hypothetical protein B456_004G256400                    222   2e-66   Gossypium raimondii
ref|XP_003629515.1|  V-type proton ATPase subunit H                     221   2e-66   
ref|XP_007029673.1|  Vacuolar ATP synthase subunit H family prote...    217   3e-66   
emb|CDP04144.1|  unnamed protein product                                211   3e-66   Coffea canephora [robusta coffee]
gb|EPS61013.1|  hypothetical protein M569_13786                         220   5e-66   Genlisea aurea
dbj|BAH20255.1|  AT3G42050                                              219   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044454.1|  PREDICTED: V-type proton ATPase subunit H is...    219   2e-65   Populus euphratica
ref|NP_001146965.1|  vacuolar ATPase subunit H protein                  219   2e-65   Zea mays [maize]
emb|CDY49280.1|  BnaA03g50930D                                          218   3e-65   Brassica napus [oilseed rape]
emb|CDX72455.1|  BnaC07g44770D                                          218   3e-65   
ref|XP_009138267.1|  PREDICTED: V-type proton ATPase subunit H          218   3e-65   Brassica rapa
gb|ACF84665.1|  unknown                                                 218   3e-65   Zea mays [maize]
ref|XP_002877351.1|  predicted protein                                  206   1e-64   
ref|XP_002453051.1|  hypothetical protein SORBIDRAFT_04g037430          216   3e-64   
gb|AET03991.2|  vacuolar H+-ATPase subunit H, putative                  216   3e-64   Medicago truncatula
ref|XP_007156009.1|  hypothetical protein PHAVU_003G250900g             216   4e-64   Phaseolus vulgaris [French bean]
ref|XP_006657814.1|  PREDICTED: probable V-type proton ATPase sub...    215   5e-64   Oryza brachyantha
ref|XP_002460834.1|  hypothetical protein SORBIDRAFT_02g035880          215   5e-64   Sorghum bicolor [broomcorn]
gb|EEC82241.1|  hypothetical protein OsI_26411                          215   1e-63   Oryza sativa Indica Group [Indian rice]
gb|ABF47532.1|  At3g42050-S                                             203   2e-63   Arabidopsis lyrata subsp. petraea
gb|KDP39537.1|  hypothetical protein JCGZ_02557                         213   2e-63   Jatropha curcas
sp|Q84ZC0.1|VATH_ORYSJ  RecName: Full=Probable V-type proton ATPa...    213   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001288363.1|  uncharacterized protein LOC103647744               213   3e-63   Zea mays [maize]
gb|ABF47535.1|  At3g42050-L                                             203   4e-63   Arabidopsis lyrata subsp. petraea
gb|ABF47536.1|  At3g42050-L                                             203   4e-63   Arabidopsis lyrata subsp. petraea
ref|XP_002325805.1|  putative vacuolar ATPase subunit H family pr...    212   5e-63   
ref|XP_004957961.1|  PREDICTED: probable V-type proton ATPase sub...    212   5e-63   Setaria italica
emb|CDX76266.1|  BnaA08g11340D                                          210   4e-62   
gb|ABF47538.1|  At3g42050-L                                             200   5e-62   Arabidopsis lyrata subsp. petraea
gb|ABG75917.1|  vacuolar proton ATPase subunit H                        209   1e-61   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ84958.1|  predicted protein                                      209   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010237225.1|  PREDICTED: probable V-type proton ATPase sub...    208   2e-61   Brachypodium distachyon [annual false brome]
gb|ABF47537.1|  At3g42050-L                                             199   2e-61   Arabidopsis lyrata subsp. petraea
ref|XP_008791825.1|  PREDICTED: probable V-type proton ATPase sub...    205   2e-60   
ref|XP_010912758.1|  PREDICTED: probable V-type proton ATPase sub...    204   3e-60   
ref|XP_001756205.1|  predicted protein                                  194   3e-56   
gb|AFK35511.1|  unknown                                                 193   8e-56   Lotus japonicus
gb|KHN44512.1|  V-type proton ATPase subunit H                          191   4e-55   Glycine soja [wild soybean]
ref|XP_001761877.1|  predicted protein                                  191   8e-55   
ref|XP_009415033.1|  PREDICTED: probable V-type proton ATPase sub...    190   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN00570.1|  Protein DA1-related 1                                   192   8e-53   Glycine soja [wild soybean]
emb|CDY57740.1|  BnaC03g77060D                                          184   2e-52   Brassica napus [oilseed rape]
ref|XP_002520072.1|  vacuolar ATP synthase subunit h, putative          180   1e-50   
ref|NP_001175249.1|  Os07g0549700                                       169   2e-50   
gb|KDO49207.1|  hypothetical protein CISIN_1g0474482mg                  168   7e-49   Citrus sinensis [apfelsine]
gb|EMT32310.1|  Putative V-type proton ATPase subunit H                 170   3e-47   
ref|XP_002980222.1|  hypothetical protein SELMODRAFT_444469             164   9e-45   
ref|XP_002963102.1|  hypothetical protein SELMODRAFT_141399             164   9e-45   Selaginella moellendorffii
gb|EMS54494.1|  putative V-type proton ATPase subunit H                 160   2e-43   Triticum urartu
gb|ABF47531.1|  At3g42050                                               145   4e-41   Turritis glabra
ref|XP_010912760.1|  PREDICTED: probable V-type proton ATPase sub...    138   2e-35   
ref|XP_005845340.1|  hypothetical protein CHLNCDRAFT_32265              130   2e-32   Chlorella variabilis
ref|XP_005646211.1|  vacuolar ATP synthase subunit H                    130   3e-32   Coccomyxa subellipsoidea C-169
gb|KIZ02492.1|  V-type H+-transporting ATPase 54 kD subunit             129   4e-32   Monoraphidium neglectum
gb|KJB26714.1|  hypothetical protein B456_004G256400                    127   8e-32   Gossypium raimondii
ref|XP_001689562.1|  vacuolar ATP synthase subunit H                    126   6e-31   Chlamydomonas reinhardtii
ref|XP_002955475.1|  vacuolar ATP synthase, subunit H                   116   3e-27   Volvox carteri f. nagariensis
ref|XP_011398291.1|  putative V-type proton ATPase subunit H            113   3e-26   Auxenochlorella protothecoides
ref|XP_006855970.1|  hypothetical protein AMTR_s00037p00233270        98.2    4e-23   
gb|KDD73222.1|  hypothetical protein H632_c2410p0                     88.6    4e-19   Helicosporidium sp. ATCC 50920
ref|XP_004365301.1|  vacuolar proton pump subunit H                   81.3    1e-14   Capsaspora owczarzaki ATCC 30864
tpg|DAA63056.1|  TPA: hypothetical protein ZEAMMB73_267119            77.8    1e-13   
tpg|DAA41086.1|  TPA: hypothetical protein ZEAMMB73_371057            77.8    2e-13   
gb|KIM32034.1|  hypothetical protein M408DRAFT_327392                 75.5    1e-12   Serendipita vermifera MAFF 305830
ref|XP_002500993.1|  H+-or Na+-translocating f-type, v-type and A...  75.5    1e-12   Micromonas commoda
ref|XP_007267525.1|  ATPase, V1 complex, subunit H                    73.2    5e-12   Fomitiporia mediterranea MF3/22
gb|EJT97397.1|  ATPase V1 complex subunit H                           72.8    9e-12   Dacryopinax primogenitus
emb|CEJ00193.1|  hypothetical protein RMCBS344292_14258               71.2    3e-11   Rhizopus microsporus
emb|CEI94961.1|  hypothetical protein RMCBS344292_09162               71.2    3e-11   Rhizopus microsporus
ref|XP_009510674.1|  PREDICTED: V-type proton ATPase subunit H-like   68.2    4e-11   Phalacrocorax carbo [common cormorant]
ref|XP_010203038.1|  PREDICTED: V-type proton ATPase subunit H-like   68.2    4e-11   Colius striatus
ref|XP_007863478.1|  ATPase, V1 complex, subunit H                    70.5    4e-11   Gloeophyllum trabeum ATCC 11539
gb|ESA21230.1|  hypothetical protein GLOINDRAFT_343254                70.5    5e-11   
emb|CCA75096.1|  related to vacuolar ATP synthase subunit H           70.5    5e-11   Serendipita indica DSM 11827
ref|XP_005301264.1|  PREDICTED: V-type proton ATPase subunit H        70.1    7e-11   Chrysemys picta bellii
ref|XP_009078245.1|  PREDICTED: V-type proton ATPase subunit H is...  70.1    7e-11   Acanthisitta chloris
gb|KFP72436.1|  V-type proton ATPase subunit H                        70.1    7e-11   Acanthisitta chloris
ref|XP_009078254.1|  PREDICTED: V-type proton ATPase subunit H is...  70.1    7e-11   Acanthisitta chloris
ref|XP_783560.3|  PREDICTED: V-type proton ATPase subunit H isofo...  69.7    9e-11   
ref|XP_006112246.1|  PREDICTED: V-type proton ATPase subunit H is...  69.7    9e-11   
ref|XP_003759824.1|  PREDICTED: V-type proton ATPase subunit H        69.7    1e-10   Sarcophilus harrisii
gb|EDM11582.1|  vacuolar ATPase subunit H, isoform CRA_b              67.0    1e-10   Rattus norvegicus [brown rat]
ref|XP_006112245.1|  PREDICTED: V-type proton ATPase subunit H is...  69.7    1e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|NP_998784.1|  V-type proton ATPase subunit H isoform 2            69.3    1e-10   Homo sapiens [man]
ref|XP_007396061.1|  hypothetical protein PHACADRAFT_121574           69.3    1e-10   Phanerochaete carnosa HHB-10118-sp
ref|NP_998785.1|  V-type proton ATPase subunit H isoform 1            69.3    1e-10   Homo sapiens [man]
dbj|BAG53609.1|  unnamed protein product                              69.3    1e-10   Homo sapiens [man]
gb|KFP03790.1|  V-type proton ATPase subunit H                        68.9    1e-10   Calypte anna
ref|XP_005152605.1|  PREDICTED: V-type proton ATPase subunit H        69.3    1e-10   Melopsittacus undulatus
ref|XP_008495780.1|  PREDICTED: V-type proton ATPase subunit H is...  69.3    1e-10   
ref|NP_001126091.1|  V-type proton ATPase subunit H                   69.3    1e-10   Pongo abelii [orang utan]
gb|AAD27720.1|AF132945_1  CGI-11 protein                              69.3    1e-10   Homo sapiens [man]
ref|XP_008495781.1|  PREDICTED: V-type proton ATPase subunit H is...  68.9    2e-10   
emb|CBQ69911.1|  related to vacuolar ATP synthase subunit H           69.3    2e-10   Sporisorium reilianum SRZ2
ref|NP_001089309.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...  68.9    2e-10   Xenopus laevis [clawed frog]
gb|KFO84025.1|  V-type proton ATPase subunit H                        68.6    2e-10   Buceros rhinoceros silvestris
gb|KFQ23695.1|  V-type proton ATPase subunit H                        68.6    2e-10   Mesitornis unicolor
ref|XP_009870253.1|  PREDICTED: V-type proton ATPase subunit H        68.2    2e-10   Apaloderma vittatum
gb|KFP72776.1|  V-type proton ATPase subunit H                        68.2    2e-10   Apaloderma vittatum
ref|XP_007428279.1|  PREDICTED: V-type proton ATPase subunit H is...  68.9    2e-10   Python bivittatus
ref|XP_003291419.1|  hypothetical protein DICPUDRAFT_156018           68.6    2e-10   Dictyostelium purpureum
ref|XP_010141561.1|  PREDICTED: V-type proton ATPase subunit H        68.6    2e-10   Buceros rhinoceros silvestris
ref|XP_010185105.1|  PREDICTED: V-type proton ATPase subunit H is...  68.6    2e-10   Mesitornis unicolor
ref|NP_001184255.1|  V-type proton ATPase subunit H                   68.6    2e-10   Gallus gallus [bantam]
gb|KGL96621.1|  V-type proton ATPase subunit H                        68.6    2e-10   Charadrius vociferus
gb|KFQ29813.1|  V-type proton ATPase subunit H                        68.6    2e-10   Merops nubicus
ref|XP_002197593.1|  PREDICTED: V-type proton ATPase subunit H        68.6    2e-10   Taeniopygia guttata
dbj|BAE30587.1|  unnamed protein product                              65.1    2e-10   Mus musculus [mouse]
ref|XP_010185106.1|  PREDICTED: V-type proton ATPase subunit H is...  68.6    2e-10   Mesitornis unicolor
ref|XP_008938694.1|  PREDICTED: V-type proton ATPase subunit H is...  68.6    2e-10   Merops nubicus
gb|ACQ57864.1|  Vacuolar proton pump subunit H                        65.5    2e-10   Anoplopoma fimbria
gb|ETE73254.1|  V-type proton ATPase subunit H                        68.6    2e-10   Ophiophagus hannah
gb|KFP46271.1|  V-type proton ATPase subunit H                        68.2    3e-10   Cathartes aura
gb|KFV18096.1|  V-type proton ATPase subunit H                        68.2    3e-10   Tauraco erythrolophus
gb|KFW04373.1|  V-type proton ATPase subunit H                        68.2    3e-10   Fulmarus glacialis
ref|XP_011357460.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Pteropus vampyrus
ref|XP_004580845.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   
gb|KFP17284.1|  V-type proton ATPase subunit H                        68.2    3e-10   Egretta garzetta
gb|KFO55130.1|  V-type proton ATPase subunit H                        68.2    3e-10   Corvus brachyrhynchos
ref|XP_009671845.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   Struthio camelus australis
ref|XP_009575443.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   Fulmarus glacialis
ref|XP_006924026.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   
ref|XP_009925475.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Haliaeetus albicilla
ref|XP_009568732.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Cuculus canorus
ref|XP_006924025.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Pteropus alecto
ref|XP_010707226.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   Meleagris gallopavo [common turkey]
gb|ELK02307.1|  V-type proton ATPase subunit H                        67.8    3e-10   Pteropus alecto
ref|XP_009984629.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Tauraco erythrolophus
gb|AFM90690.1|  ATPase, H+ transporting, lysosomal, V1 subunit H      68.2    3e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_009638644.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Egretta garzetta
ref|XP_005240812.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   
ref|XP_005418370.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   Geospiza fortis
ref|XP_005042123.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    3e-10   Ficedula albicollis
ref|XP_005479350.1|  PREDICTED: V-type proton ATPase subunit H        68.2    3e-10   Zonotrichia albicollis
gb|KFR06255.1|  V-type proton ATPase subunit H                        68.2    4e-10   Nipponia nippon
ref|XP_010169924.1|  PREDICTED: V-type proton ATPase subunit H is...  68.2    4e-10   Antrostomus carolinensis
gb|EOA97074.1|  Vacuolar proton pump subunit H                        67.8    4e-10   Anas platyrhynchos [duck]
ref|XP_009287620.1|  PREDICTED: V-type proton ATPase subunit H        67.8    4e-10   Aptenodytes forsteri
gb|KFM01728.1|  V-type proton ATPase subunit H                        67.8    4e-10   Aptenodytes forsteri
ref|XP_005506565.1|  PREDICTED: V-type proton ATPase subunit H is...  67.8    4e-10   Columba livia [carrier pigeon]
ref|XP_008643145.1|  PREDICTED: V-type proton ATPase subunit H        67.8    4e-10   Corvus brachyrhynchos
gb|KFU96510.1|  V-type proton ATPase subunit H                        67.8    4e-10   Chaetura pelagica
ref|XP_009984630.1|  PREDICTED: V-type proton ATPase subunit H is...  67.8    4e-10   Tauraco erythrolophus
gb|KFW72760.1|  V-type proton ATPase subunit H                        67.8    4e-10   Pygoscelis adeliae
ref|XP_005025557.1|  PREDICTED: V-type proton ATPase subunit H is...  67.8    4e-10   
gb|EMC87078.1|  V-type proton ATPase subunit H                        67.8    4e-10   
tpg|DAA60696.1|  TPA: putative ribosomal protein S4 (RPS4A) famil...  65.1    4e-10   
ref|XP_009925483.1|  PREDICTED: V-type proton ATPase subunit H is...  67.8    4e-10   Haliaeetus albicilla
ref|XP_005025556.1|  PREDICTED: V-type proton ATPase subunit H is...  67.8    4e-10   
gb|KFV08719.1|  V-type proton ATPase subunit H                        67.8    4e-10   Pterocles gutturalis
gb|KFO70823.1|  V-type proton ATPase subunit H                        67.8    4e-10   Cuculus canorus
gb|KFV80563.1|  V-type proton ATPase subunit H                        67.8    4e-10   Struthio camelus australis
gb|KFP92999.1|  V-type proton ATPase subunit H                        67.8    4e-10   Haliaeetus albicilla
gb|ADI40573.1|  lysosomal H+-transporting ATPase V1 subunit H         66.2    4e-10   Cynopterus sphinx [greater short-nosed fruit bat]
ref|XP_009638645.1|  PREDICTED: V-type proton ATPase subunit H is...  67.8    4e-10   Egretta garzetta
ref|XP_004887507.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    5e-10   
ref|XP_006994248.1|  PREDICTED: V-type proton ATPase subunit H-li...  67.4    5e-10   Peromyscus maniculatus bairdii
ref|XP_004887509.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    5e-10   
ref|XP_006994249.1|  PREDICTED: V-type proton ATPase subunit H-li...  67.4    5e-10   Peromyscus maniculatus bairdii
ref|XP_006140948.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    5e-10   Tupaia chinensis
emb|CEP16084.1|  hypothetical protein                                 67.0    5e-10   Parasitella parasitica
ref|XP_002758941.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    5e-10   Callithrix jacchus [common marmoset]
ref|XP_003940899.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Saimiri boliviensis boliviensis
ref|XP_008253747.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003734984.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Callithrix jacchus [common marmoset]
ref|XP_003506606.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Cricetulus griseus [Chinese hamsters]
ref|NP_001270161.1|  uncharacterized protein LOC101926423             67.4    6e-10   Macaca fascicularis [crab eating macaque]
ref|XP_008253748.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Oryctolagus cuniculus [domestic rabbit]
ref|NP_001013951.1|  V-type proton ATPase subunit H                   67.0    6e-10   Rattus norvegicus [brown rat]
ref|XP_005362304.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Microtus ochrogaster [prairie voles]
ref|XP_003902802.1|  PREDICTED: V-type proton ATPase subunit H is...  67.4    6e-10   Papio anubis [baboon]
ref|XP_003428501.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   
ref|NP_001016182.1|  V-type proton ATPase subunit H                   67.0    7e-10   Xenopus tropicalis [western clawed frog]
ref|XP_007645254.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_002123830.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   
ref|XP_005857374.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   Myotis brandtii
ref|XP_005362305.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   Microtus ochrogaster [prairie voles]
ref|XP_001515221.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   
ref|XP_009860941.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   
ref|XP_005857375.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   Myotis brandtii
ref|XP_007516038.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    7e-10   Erinaceus europaeus [common hedgehog]
gb|EGW09777.1|  V-type proton ATPase subunit H                        67.0    7e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_006237863.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    8e-10   Rattus norvegicus [brown rat]
ref|XP_011235919.1|  PREDICTED: V-type proton ATPase subunit H        66.6    8e-10   
gb|ERE85970.1|  V-type proton ATPase subunit H                        67.0    8e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_007516039.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    8e-10   
ref|XP_006237866.1|  PREDICTED: V-type proton ATPase subunit H is...  67.0    8e-10   Rattus norvegicus [brown rat]
gb|KDQ60593.1|  hypothetical protein JAAARDRAFT_31557                 66.6    8e-10   Jaapia argillacea MUCL 33604
ref|XP_007064175.1|  PREDICTED: V-type proton ATPase subunit H        66.6    9e-10   Chelonia mydas [green seaturtle]
ref|XP_003466039.2|  PREDICTED: V-type proton ATPase subunit H        66.6    9e-10   Cavia porcellus [guinea pig]
gb|AAL75942.1|AF125105_1  vacuolar proton pump subunit SFD alpha ...  66.6    9e-10   Homo sapiens [man]
ref|XP_010609402.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    9e-10   Fukomys damarensis [Damara mole rat]
ref|NP_598587.2|  V-type proton ATPase subunit H                      66.6    9e-10   Mus musculus [mouse]
gb|ABD83887.1|  ATPase H+ transporting lysosomal V1 subunit H         63.9    9e-10   Ictalurus punctatus
ref|XP_644034.1|  vacuolar ATP synthase subunit H                     66.6    9e-10   Dictyostelium discoideum AX4
ref|XP_005396122.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    9e-10   Chinchilla lanigera
ref|XP_005396120.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   Chinchilla lanigera
gb|ADI40572.1|  lysosomal H+-transporting ATPase V1 subunit H         66.6    1e-09   Miniopterus schreibersii [Common bent-wing bat]
ref|XP_003793747.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   Otolemur garnettii
ref|XP_008570281.1|  PREDICTED: V-type proton ATPase subunit H        66.6    1e-09   Galeopterus variegatus [Malayan flying lemur]
gb|AAH09154.1|  ATPase, H+ transporting, lysosomal V1 subunit H       66.6    1e-09   Mus musculus [mouse]
ref|XP_004410073.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   Odobenus rosmarus divergens
ref|XP_004435757.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   
ref|XP_003793748.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   
ref|XP_004435755.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   
ref|XP_004410075.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   Odobenus rosmarus divergens
gb|EPQ02129.1|  V-type proton ATPase subunit H                        66.6    1e-09   Myotis brandtii
ref|XP_006495497.1|  PREDICTED: V-type proton ATPase subunit H is...  66.6    1e-09   
gb|ELW71992.1|  V-type proton ATPase subunit H                        66.6    1e-09   Tupaia chinensis
ref|XP_006191106.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   Camelus ferus
ref|XP_005613222.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   Equus caballus [domestic horse]
ref|XP_006191105.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
ref|XP_004679936.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   Condylura cristata
ref|XP_004479904.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   Dasypus novemcinctus
ref|XP_004479906.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
ref|XP_011391828.1|  hypothetical protein UMAG_05503                  66.6    1e-09   Ustilago maydis 521
gb|KFR13189.1|  V-type proton ATPase subunit H                        66.2    1e-09   Opisthocomus hoazin [hoatzin]
ref|XP_005613224.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
gb|KII88913.1|  hypothetical protein PLICRDRAFT_40550                 66.2    1e-09   
ref|NP_001278637.1|  V-type proton ATPase subunit H isoform 1         66.2    1e-09   
ref|XP_004679937.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
ref|XP_003224355.1|  PREDICTED: V-type proton ATPase subunit H        66.2    1e-09   
ref|XP_004479905.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
ref|XP_006259999.1|  PREDICTED: V-type proton ATPase subunit H        66.2    1e-09   
ref|XP_008842643.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
gb|EHH28502.1|  V-type proton ATPase subunit H                        66.2    1e-09   
ref|NP_775377.2|  V-type proton ATPase subunit H isoform 2            66.2    1e-09   
ref|XP_004633431.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    1e-09   
ref|XP_009935989.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    1e-09   
gb|EPB90895.1|  hypothetical protein HMPREF1544_02313                 65.9    2e-09   
ref|XP_006023922.1|  PREDICTED: V-type proton ATPase subunit H is...  66.2    2e-09   
ref|XP_008842645.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_004633432.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_007764866.1|  ATPase V1 complex subunit H                      65.9    2e-09   
ref|XP_009935988.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|NP_001279139.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...  65.9    2e-09   
ref|XP_006023923.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
gb|AFN11665.1|  vacuolar ATPase subunit H                             66.2    2e-09   
gb|KFQ64347.1|  V-type proton ATPase subunit H                        65.9    2e-09   
ref|XP_007090622.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_001949116.3|  PREDICTED: V-type proton ATPase subunit H        65.9    2e-09   
ref|XP_004602396.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_005993507.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_010285565.1|  PREDICTED: V-type proton ATPase subunit H        65.9    2e-09   
ref|XP_005993508.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_004602395.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_004697612.1|  PREDICTED: V-type proton ATPase subunit H is...  65.9    2e-09   
ref|XP_006900599.1|  PREDICTED: V-type proton ATPase subunit H-like   65.9    2e-09   
gb|AAM34678.1|AF506234_1  vacuolar ATP synthase subunit H             65.5    2e-09   
ref|XP_004697613.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    2e-09   
ref|XP_006871918.1|  PREDICTED: V-type proton ATPase subunit H-li...  65.5    2e-09   
gb|ADI40571.1|  lysosomal H+-transporting ATPase V1 subunit H         65.5    2e-09   
ref|XP_007487189.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    2e-09   
ref|XP_007487188.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    2e-09   
ref|XP_007260240.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    2e-09   
gb|EMP31779.1|  V-type proton ATPase subunit H                        65.5    2e-09   
ref|XP_007260239.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    2e-09   
ref|XP_003999861.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    3e-09   
ref|XP_007260236.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    3e-09   
ref|XP_007260238.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    3e-09   
emb|CDI55972.1|  related to vacuolar ATP synthase subunit H           65.5    3e-09   
ref|XP_003999862.1|  PREDICTED: V-type proton ATPase subunit H is...  65.5    3e-09   
dbj|GAC97724.1|  hypothetical protein PHSY_005311                     65.5    3e-09   
ref|XP_005085988.1|  PREDICTED: V-type proton ATPase subunit H        65.5    3e-09   
ref|XP_004275066.1|  PREDICTED: V-type proton ATPase subunit H is...  65.1    3e-09   
ref|XP_007326764.1|  hypothetical protein AGABI1DRAFT_118298          65.1    3e-09   
ref|XP_004275067.1|  PREDICTED: V-type proton ATPase subunit H is...  65.1    3e-09   
gb|AHM92104.1|  vATPase subunit H                                     65.1    3e-09   
ref|XP_007338813.1|  ATPase, V1 complex, subunit H                    65.1    3e-09   
ref|XP_006458312.1|  hypothetical protein AGABI2DRAFT_199848          65.1    3e-09   
ref|XP_005322963.1|  PREDICTED: V-type proton ATPase subunit H is...  65.1    4e-09   
dbj|GAM29018.1|  hypothetical protein SAMD00019534_121940             64.7    4e-09   
ref|XP_005322961.1|  PREDICTED: V-type proton ATPase subunit H is...  65.1    4e-09   
gb|ELK26175.1|  V-type proton ATPase subunit H                        65.1    4e-09   
gb|EPY76341.1|  V-type proton ATPase subunit H                        65.1    4e-09   
ref|XP_004375664.1|  PREDICTED: V-type proton ATPase subunit H is...  64.7    4e-09   
ref|XP_004375665.1|  PREDICTED: V-type proton ATPase subunit H is...  64.7    4e-09   
emb|CEP09165.1|  hypothetical protein                                 64.7    4e-09   
ref|XP_006769146.1|  PREDICTED: V-type proton ATPase subunit H is...  64.7    4e-09   
ref|XP_004653416.1|  PREDICTED: V-type proton ATPase subunit H is...  64.7    4e-09   
ref|XP_006769145.1|  PREDICTED: V-type proton ATPase subunit H is...  64.7    5e-09   
ref|XP_004653417.1|  PREDICTED: V-type proton ATPase subunit H is...  64.7    5e-09   
ref|XP_011413696.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.7    5e-09   
gb|EPB83862.1|  hypothetical protein HMPREF1544_09374                 64.3    5e-09   
ref|XP_008141569.1|  PREDICTED: V-type proton ATPase subunit H        64.3    5e-09   
ref|XP_009901987.1|  PREDICTED: V-type proton ATPase subunit H        64.3    5e-09   
ref|XP_966693.3|  PREDICTED: V-type proton ATPase subunit H isofo...  64.3    6e-09   
ref|NP_001280516.1|  V-type proton ATPase subunit H                   64.3    6e-09   
gb|ACI34030.1|  Vacuolar proton pump subunit H                        64.3    6e-09   
ref|XP_011413698.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.3    6e-09   
ref|XP_011413697.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.3    6e-09   
ref|XP_006077052.1|  PREDICTED: V-type proton ATPase subunit H is...  64.3    6e-09   
ref|XP_004011726.1|  PREDICTED: V-type proton ATPase subunit H is...  64.3    6e-09   
gb|KIP10325.1|  hypothetical protein PHLGIDRAFT_125667                64.3    6e-09   
tpg|DAA22751.1|  TPA: V-type proton ATPase subunit H                  64.3    6e-09   
ref|NP_777129.2|  V-type proton ATPase subunit H                      64.3    6e-09   
sp|O46563.2|VATH_BOVIN  RecName: Full=V-type proton ATPase subuni...  64.3    6e-09   
ref|XP_006077050.1|  PREDICTED: V-type proton ATPase subunit H is...  64.3    6e-09   
ref|XP_005215461.1|  PREDICTED: V-type proton ATPase subunit H is...  64.3    6e-09   
ref|XP_004011727.1|  PREDICTED: V-type proton ATPase subunit H is...  64.3    6e-09   
ref|XP_011413699.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.3    6e-09   
ref|XP_002590036.1|  hypothetical protein BRAFLDRAFT_281437           64.3    6e-09   
ref|XP_005742564.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.3    7e-09   
ref|XP_004542994.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.3    7e-09   
ref|XP_003438111.1|  PREDICTED: V-type proton ATPase subunit H-li...  64.3    7e-09   
ref|XP_010220748.1|  PREDICTED: V-type proton ATPase subunit H        62.0    7e-09   
ref|XP_010968999.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  64.3    7e-09   
ref|XP_007105305.1|  PREDICTED: V-type proton ATPase subunit H is...  63.9    7e-09   
ref|XP_004542995.1|  PREDICTED: V-type proton ATPase subunit H-li...  63.9    7e-09   
ref|XP_007105306.1|  PREDICTED: V-type proton ATPase subunit H is...  63.9    7e-09   
ref|XP_002736386.1|  PREDICTED: V-type proton ATPase subunit H-like   63.9    7e-09   
gb|AAC02987.1|  vacuolar proton pump subunit SFD alpha isoform        63.9    7e-09   
ref|XP_005476564.1|  PREDICTED: V-type proton ATPase subunit H-li...  63.9    8e-09   
gb|AAC02986.1|  vacuolar proton pump subunit SFD beta isoform         63.9    8e-09   
ref|XP_007950398.1|  PREDICTED: V-type proton ATPase subunit H is...  63.9    8e-09   
ref|XP_004079489.1|  PREDICTED: V-type proton ATPase subunit H is...  63.9    8e-09   
gb|KIO27114.1|  hypothetical protein M407DRAFT_73717                  63.9    8e-09   
ref|XP_005742565.1|  PREDICTED: V-type proton ATPase subunit H-li...  63.9    8e-09   
ref|XP_011485363.1|  PREDICTED: V-type proton ATPase subunit H is...  63.9    8e-09   
ref|XP_007950399.1|  PREDICTED: V-type proton ATPase subunit H is...  63.9    8e-09   
ref|NP_001133475.1|  Vacuolar proton pump subunit H                   63.9    9e-09   
dbj|GAN10605.1|  ATPase, V1 complex, subunit H                        63.5    9e-09   
sp|Q9TVC1.1|VATH_PIG  RecName: Full=V-type proton ATPase subunit ...  63.5    9e-09   
ref|XP_544082.2|  PREDICTED: V-type proton ATPase subunit H isofo...  63.5    9e-09   
emb|CAB39532.1|  54 kDa vacuolar H(+)-ATPase subunit                  63.5    9e-09   
ref|NP_999405.1|  V-type proton ATPase subunit H                      63.5    1e-08   
ref|XP_010789727.1|  PREDICTED: V-type proton ATPase subunit H is...  63.5    1e-08   
ref|XP_005638031.1|  PREDICTED: V-type proton ATPase subunit H is...  63.5    1e-08   
ref|XP_010789726.1|  PREDICTED: V-type proton ATPase subunit H is...  63.5    1e-08   
emb|CEG77426.1|  hypothetical protein RMATCC62417_12180               63.5    1e-08   
ref|XP_010987846.1|  PREDICTED: V-type proton ATPase subunit H        63.5    1e-08   
ref|XP_007464083.1|  PREDICTED: V-type proton ATPase subunit H is...  63.5    1e-08   
gb|KIJ08448.1|  hypothetical protein PAXINDRAFT_139280                60.8    1e-08   
ref|XP_007464084.1|  PREDICTED: V-type proton ATPase subunit H is...  63.2    1e-08   
ref|XP_005815100.1|  PREDICTED: V-type proton ATPase subunit H-like   63.2    1e-08   
gb|KIK63759.1|  hypothetical protein GYMLUDRAFT_450965                63.2    1e-08   
ref|XP_007168671.1|  PREDICTED: V-type proton ATPase subunit H is...  63.2    1e-08   
ref|XP_007548603.1|  PREDICTED: V-type proton ATPase subunit H is...  63.2    1e-08   
ref|XP_007168672.1|  PREDICTED: V-type proton ATPase subunit H is...  63.2    1e-08   
gb|ELT88874.1|  hypothetical protein CAPTEDRAFT_223312                63.2    1e-08   
gb|KIJ17093.1|  hypothetical protein PAXINDRAFT_111820                60.8    1e-08   
dbj|GAN10345.1|  ATPase, V1 complex, subunit H                        62.8    2e-08   
ref|XP_003408364.1|  PREDICTED: V-type proton ATPase subunit H is...  63.2    2e-08   
ref|XP_007548605.1|  PREDICTED: V-type proton ATPase subunit H is...  62.8    2e-08   
ref|XP_010586611.1|  PREDICTED: V-type proton ATPase subunit H is...  62.8    2e-08   
ref|XP_007090623.1|  PREDICTED: V-type proton ATPase subunit H is...  62.8    2e-08   
ref|NP_001040488.1|  vacuolar ATP synthase subunit H                  62.8    2e-08   
gb|KIO04112.1|  hypothetical protein M404DRAFT_144318                 62.8    2e-08   
ref|XP_007090621.1|  PREDICTED: V-type proton ATPase subunit H is...  62.8    2e-08   
ref|XP_009453663.1|  PREDICTED: V-type proton ATPase subunit H        62.8    2e-08   
gb|EST08308.1|  hypothetical protein PSEUBRA_SCAF17g04287             62.8    2e-08   
ref|XP_005653120.1|  PREDICTED: V-type proton ATPase subunit H is...  62.4    2e-08   
ref|XP_004929804.1|  PREDICTED: V-type proton ATPase subunit H-like   62.4    2e-08   
gb|ADI40574.1|  lysosomal H+-transporting ATPase V1 subunit H         62.0    3e-08   
gb|ETS65182.1|  hypothetical protein PaG_00247                        62.4    3e-08   
emb|CAG12279.1|  unnamed protein product                              62.4    3e-08   
dbj|GAC75545.1|  vacuolar H+-ATPase V1 sector, subunit H              62.4    3e-08   
ref|XP_007880880.1|  hypothetical protein PFL1_05159                  62.4    3e-08   
dbj|GAK67100.1|  conserved hypothetical protein                       62.4    3e-08   
ref|XP_008285726.1|  PREDICTED: V-type proton ATPase subunit H        62.0    3e-08   
ref|XP_010864268.1|  PREDICTED: V-type proton ATPase subunit H is...  62.0    3e-08   
ref|XP_010727568.1|  PREDICTED: V-type proton ATPase subunit H is...  62.0    3e-08   
ref|XP_010864266.1|  PREDICTED: V-type proton ATPase subunit H is...  62.0    3e-08   
ref|XP_010727569.1|  PREDICTED: V-type proton ATPase subunit H is...  62.0    3e-08   
emb|CDH53184.1|  atpase v1 complex subunit h                          62.0    3e-08   
gb|ENN77808.1|  hypothetical protein YQE_05692                        62.0    3e-08   
gb|AEE62279.1|  unknown                                               62.0    3e-08   
gb|ERL95137.1|  hypothetical protein D910_12406                       62.0    4e-08   
emb|CDH53183.1|  atpase v1 complex subunit h                          61.6    4e-08   
gb|ERL95136.1|  hypothetical protein D910_12406                       62.0    4e-08   
gb|KIJ60597.1|  hypothetical protein HYDPIDRAFT_116892                61.6    4e-08   
ref|XP_008332709.1|  PREDICTED: V-type proton ATPase subunit H is...  61.6    5e-08   
dbj|BAN20615.1|  vacuolar H[+] ATPase subunit                         61.6    5e-08   
dbj|GAM26531.1|  hypothetical protein SAMD00019534_097060             61.2    5e-08   
emb|CCM03836.1|  predicted protein                                    61.2    5e-08   
ref|XP_005101408.1|  PREDICTED: V-type proton ATPase subunit H-like   61.2    5e-08   
emb|CDS14131.1|  hypothetical protein LRAMOSA06301                    61.2    5e-08   
ref|XP_008332710.1|  PREDICTED: V-type proton ATPase subunit H is...  61.2    5e-08   
ref|XP_005966485.1|  PREDICTED: V-type proton ATPase subunit H        61.2    6e-08   
ref|XP_006634089.1|  PREDICTED: V-type proton ATPase subunit H-like   61.2    7e-08   
gb|AHF70969.1|  vacuolar ATP synthase subunit H                       60.8    8e-08   
gb|EMD38663.1|  hypothetical protein CERSUDRAFT_113838                60.5    1e-07   
gb|KIK81118.1|  hypothetical protein PAXRUDRAFT_833089                60.1    1e-07   
sp|Q9U5N0.1|VATH_MANSE  RecName: Full=V-type proton ATPase subuni...  60.1    1e-07   
gb|EFA79804.1|  vacuolar ATP synthase subunit H                       59.3    1e-07   
emb|CBY25111.1|  unnamed protein product                              59.7    2e-07   
ref|XP_011500008.1|  PREDICTED: V-type proton ATPase subunit H        60.1    2e-07   
ref|XP_004367300.1|  vacuolar ATP synthase subunit H                  59.7    2e-07   
ref|XP_011061960.1|  PREDICTED: V-type proton ATPase subunit H-like   57.4    2e-07   
ref|XP_002051650.1|  GJ11146                                          59.3    3e-07   
gb|KDR12485.1|  V-type proton ATPase subunit H                        59.3    3e-07   
gb|KIK40766.1|  hypothetical protein CY34DRAFT_86648                  58.9    3e-07   
ref|XP_008036124.1|  ATPase V1 complex subunit H                      58.9    3e-07   
gb|KEP50199.1|  V-type proton ATPase subunit H                        58.9    3e-07   
gb|EUC56956.1|  V-type proton ATPase subunit H                        58.9    3e-07   
ref|XP_007384849.1|  ATPase V1 complex subunit H                      58.5    4e-07   
gb|AAD47254.1|AF159457_1  vacuolar ATPase SFD subunit                 58.5    4e-07   
ref|NP_723993.1|  vacuolar H[+]-ATPase SFD subunit, isoform D         58.5    4e-07   
gb|EFZ20349.1|  hypothetical protein SINV_15431                       56.2    5e-07   
ref|XP_003975495.1|  PREDICTED: V-type proton ATPase subunit H-like   58.5    5e-07   
ref|NP_523585.2|  vacuolar H[+]-ATPase SFD subunit, isoform A         58.2    5e-07   
ref|NP_723992.1|  vacuolar H[+]-ATPase SFD subunit, isoform B         58.5    5e-07   
ref|XP_002428318.1|  vacuolar ATP synthase subunit H, putative        58.2    6e-07   
emb|CDS13760.1|  hypothetical protein LRAMOSA05934                    58.2    6e-07   
gb|EHJ66535.1|  hypothetical protein KGM_18477                        58.2    6e-07   
ref|XP_002090530.1|  GE13171                                          58.2    7e-07   
ref|XP_001731033.1|  hypothetical protein MGL_2032                    58.2    7e-07   
emb|CDH54650.1|  atpase v1 complex subunit h                          57.8    7e-07   
ref|XP_011213954.1|  PREDICTED: V-type proton ATPase subunit H is...  57.8    7e-07   
ref|XP_005181998.1|  PREDICTED: V-type proton ATPase subunit H        57.8    7e-07   
ref|XP_011189552.1|  PREDICTED: V-type proton ATPase subunit H is...  57.8    7e-07   
ref|XP_001878316.1|  predicted protein                                57.8    8e-07   
ref|XP_003692426.1|  PREDICTED: V-type proton ATPase subunit H-like   57.8    8e-07   
ref|XP_001652018.1|  AAEL006516-PA                                    57.8    9e-07   
gb|AAX27712.2|  SJCHGC05549 protein                                   56.6    9e-07   
ref|XP_008048661.1|  PREDICTED: V-type proton ATPase subunit H        57.4    9e-07   
ref|XP_001844037.1|  vacuolar ATP synthase subunit H                  57.8    9e-07   
gb|KHJ43624.1|  v-ATPase subunit H                                    57.8    9e-07   
dbj|BAM18133.1|  vacuolar H[+]-ATPase SFD subunit                     57.4    1e-06   
ref|XP_007364518.1|  ATPase V1 complex subunit H                      57.4    1e-06   
ref|XP_004536257.1|  PREDICTED: V-type proton ATPase subunit H-li...  57.4    1e-06   
ref|XP_002064801.1|  GK15126                                          57.4    1e-06   
gb|KJA27303.1|  hypothetical protein HYPSUDRAFT_1097962               57.4    1e-06   
ref|XP_310211.4|  AGAP009486-PA                                       57.4    1e-06   
gb|KDQ13172.1|  hypothetical protein BOTBODRAFT_33784                 57.4    1e-06   
emb|CDW52300.1|  V type proton ATPase subunit H                       57.4    1e-06   
ref|XP_003394807.1|  PREDICTED: v-type proton ATPase subunit H-li...  57.0    1e-06   
gb|KIK18316.1|  hypothetical protein PISMIDRAFT_14479                 57.0    1e-06   
ref|XP_003394806.1|  PREDICTED: v-type proton ATPase subunit H-li...  57.0    1e-06   
ref|XP_011213953.1|  PREDICTED: V-type proton ATPase subunit H is...  57.0    1e-06   
ref|XP_002114416.1|  hypothetical protein TRIADDRAFT_36227            57.0    2e-06   
ref|XP_002003753.1|  GI21354                                          57.0    2e-06   
ref|XP_011189551.1|  PREDICTED: V-type proton ATPase subunit H is...  57.0    2e-06   
ref|XP_008217755.1|  PREDICTED: V-type proton ATPase subunit H is...  56.6    2e-06   
gb|KFQ43719.1|  V-type proton ATPase subunit H                        55.8    2e-06   
ref|XP_008217756.1|  PREDICTED: V-type proton ATPase subunit H is...  56.6    2e-06   
ref|XP_003425170.1|  PREDICTED: V-type proton ATPase subunit H is...  56.6    2e-06   
ref|XP_011329950.1|  PREDICTED: V-type proton ATPase subunit H is...  56.6    2e-06   



>ref|XP_009608692.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
 ref|XP_009608693.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
Length=454

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            MP ++AELTTEQVL RDIPWETYMTTKL+TGTG QLLRRYDKKAESYK QLLDDDGP Y+
Sbjct  1    MPMENAELTTEQVLRRDIPWETYMTTKLVTGTGFQLLRRYDKKAESYKAQLLDDDGPGYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFV+ILRDI KEET+EYVLALIDEMLT NPKRARLFHD SLADEDTYEPFLRLLWKGNW
Sbjct  61   RVFVTILRDIFKEETVEYVLALIDEMLTANPKRARLFHDNSLADEDTYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSLIVS R
Sbjct  121  FIQEKSCKILSLIVSAR  137



>ref|XP_006343605.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343606.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006343608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X4 [Solanum 
tuberosum]
Length=454

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M T++AELTTE+VL RDIPWETYMTTKLITGTGLQLLRRYDKKAESYK QLLDDDGP Y+
Sbjct  1    MTTENAELTTEEVLRRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKAQLLDDDGPGYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFV+ILRDI KEET+EYVLALIDEMLT NPKRARLFHD+SLADEDTYEPFLRLLWKGNW
Sbjct  61   RVFVTILRDIFKEETVEYVLALIDEMLTANPKRARLFHDESLADEDTYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSL VS R
Sbjct  121  FIQEKSCKILSLTVSAR  137



>ref|XP_004242619.1| PREDICTED: V-type proton ATPase subunit H [Solanum lycopersicum]
Length=454

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M T+  ELTTE+VL RDIPWETYMTTKLITGTGLQLLRRYDKKAESYK QLLDDDGP Y+
Sbjct  1    MTTESVELTTEEVLRRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKAQLLDDDGPGYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFV+ILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLADEDTYEPFLRLLWKGNW
Sbjct  61   RVFVTILRDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLADEDTYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSL VS R
Sbjct  121  FIQEKSCKILSLTVSAR  137



>ref|XP_010251374.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
 ref|XP_010251375.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
Length=452

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYD ++ESY+  LLDDDGPAY+RVF
Sbjct  2    DHAELTTEQVLKRDIPWETYMTTKLITGTCLQLLRRYDNRSESYRAALLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VNILRDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKILSLIVSVR
Sbjct  122  EKSCKILSLIVSVR  135



>ref|XP_007029672.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
 gb|EOY10174.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
Length=453

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = +1

Query  133  DHAELTTEQV-LTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRV  309
            DHAEL TEQV L RDIPWETYMTTKLI+GTGLQLLRRYD +AESY+ QLLDDDGPAY+RV
Sbjct  2    DHAELNTEQVVLKRDIPWETYMTTKLISGTGLQLLRRYDNRAESYRAQLLDDDGPAYVRV  61

Query  310  FVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFV  489
            FVSILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA+EDTYEPFLRLLWKGNWF+
Sbjct  62   FVSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLANEDTYEPFLRLLWKGNWFI  121

Query  490  QEKSCKILSLIVSVR  534
            QEKSCKIL+LIVS R
Sbjct  122  QEKSCKILALIVSAR  136



>ref|XP_011084696.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  D AEL+TEQVL RDIPWETYMTTKLITGTGLQLLRRYDKK E+YK QLLDDDGPAY+
Sbjct  1    MTMDQAELSTEQVLRRDIPWETYMTTKLITGTGLQLLRRYDKKPENYKAQLLDDDGPAYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFVSILRDI KEET+EYVLALIDEML+ NPKRARLFHDKSL DED YEPFLRLLWKGNW
Sbjct  61   RVFVSILRDIFKEETVEYVLALIDEMLSANPKRARLFHDKSLKDEDVYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F QEKSCKILSLIVS R
Sbjct  121  FTQEKSCKILSLIVSGR  137



>ref|XP_006484607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Citrus 
sinensis]
Length=452

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLI+GTGLQLLRRYD ++ES++ QLLDDDGP+Y+RVF
Sbjct  2    DHAELTTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRSESHRAQLLDDDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIYKEETVEYVLALIDEMLTANPKRARLFHDKSLASEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ IVS R
Sbjct  122  EKSCKILASIVSAR  135



>ref|XP_008343829.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008343831.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ESY++QLLDDDGPAY++VF
Sbjct  2    DHAELTTEQVLNRDIPWETYMTTKLITGTCLQLLRRYDKRSESYRSQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            + ILRDI KEET+EYVLALIDEMLT NPKRARLFHD SLAD+D YEPFLRLLWKGNWF+Q
Sbjct  62   IGILRDIFKEETVEYVLALIDEMLTANPKRARLFHDSSLADKDIYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL++IVS R
Sbjct  122  EKSCKILAVIVSAR  135



>ref|XP_007029671.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10173.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
Length=459

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 127/141 (90%), Gaps = 7/141 (5%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAEL TEQVL RDIPWETYMTTKLI+GTGLQLLRRYD +AESY+ QLLDDDGPAY+RVF
Sbjct  2    DHAELNTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRAESYRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR-------LLW  471
            VSILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA+EDTYEPFL+       LLW
Sbjct  62   VSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLANEDTYEPFLKSEEYKHVLLW  121

Query  472  KGNWFVQEKSCKILSLIVSVR  534
            KGNWF+QEKSCKIL+LIVS R
Sbjct  122  KGNWFIQEKSCKILALIVSAR  142



>ref|XP_010087456.1| V-type proton ATPase subunit H [Morus notabilis]
 gb|EXB29137.1| V-type proton ATPase subunit H [Morus notabilis]
Length=453

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYD ++ESY+ QLLDD+GPAY+RVF
Sbjct  2    DHAELTTEQVLKRDIPWETYMTTKLITGTCLQLLRRYDNRSESYRAQLLDDNGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EY+LALIDEML  NPKRARLFHDKSLA EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYILALIDEMLAANPKRARLFHDKSLAGEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ IVS R
Sbjct  122  EKSCKILASIVSAR  135



>gb|EYU39750.1| hypothetical protein MIMGU_mgv1a006219mg [Erythranthe guttata]
Length=452

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            MPTD AE+TT++VL+RDIPWETYMTTKLITGTGLQLLRRYDKK E+ K  LLDDDGPAYI
Sbjct  1    MPTDQAEITTDEVLSRDIPWETYMTTKLITGTGLQLLRRYDKKPENKKADLLDDDGPAYI  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
             VFVSILRDI KEET+EYVLALIDEML+ NPKRARLFHDKSLA ED YEPF+RLLWKGNW
Sbjct  61   HVFVSILRDIFKEETVEYVLALIDEMLSANPKRARLFHDKSLAGEDLYEPFIRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSLIVS R
Sbjct  121  FIQEKSCKILSLIVSGR  137



>ref|XP_008443235.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
 ref|XP_008443236.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
Length=454

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  D AEL+TEQVLTRDIPWETYM+TKLI+GT LQLLRRYD + ESY+ QLLDDDGPAY+
Sbjct  1    MAIDQAELSTEQVLTRDIPWETYMSTKLISGTSLQLLRRYDNRPESYRAQLLDDDGPAYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFVSILRDI KEET+EYVLALIDEMLT NPKRARLFHD SLA ED YEPFLRLLWKGNW
Sbjct  61   RVFVSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDPSLASEDAYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKIL+LIVS R
Sbjct  121  FIQEKSCKILALIVSAR  137



>ref|XP_009792608.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana sylvestris]
Length=454

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            MP ++AELTTEQVL+RDIPWETYM TKLITGT  QLLRRYDKKAESYK QLLDDDG  Y+
Sbjct  1    MPMENAELTTEQVLSRDIPWETYMATKLITGTDFQLLRRYDKKAESYKAQLLDDDGRGYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFV+IL D+ KEET+EYVLALIDEMLT NPKRARLFHD SL DEDTYEPFLRLLWKGNW
Sbjct  61   RVFVTILHDVFKEETVEYVLALIDEMLTANPKRARLFHDNSLEDEDTYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSLIVS R
Sbjct  121  FIQEKSCKILSLIVSAR  137



>ref|XP_004136630.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus]
 ref|XP_004162622.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus]
 gb|KGN59423.1| hypothetical protein Csa_3G819800 [Cucumis sativus]
Length=454

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  D AEL+TEQVL RDIPWETYMTTKLI+GT LQLLRRYD + ESY+ QLLDDDGPAY+
Sbjct  1    MAIDQAELSTEQVLRRDIPWETYMTTKLISGTSLQLLRRYDNRPESYRAQLLDDDGPAYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFVSILRDI KEET+EYVLALIDEMLT NPKRARLFHD SLA ED YEPFLRLLWKGNW
Sbjct  61   RVFVSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDPSLASEDAYEPFLRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKIL+LIVS R
Sbjct  121  FIQEKSCKILALIVSAR  137



>ref|XP_010023341.1| PREDICTED: V-type proton ATPase subunit H [Eucalyptus grandis]
Length=443

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL RDIPWETYMTTKLITGT LQLLRRYDK++ESY+ QLLDDDGPAY RVF
Sbjct  2    DQAELTTDQVLRRDIPWETYMTTKLITGTCLQLLRRYDKRSESYRAQLLDDDGPAYARVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALIDEMLT NPKRARLFHD+SL++EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VNILRDIFKEETVEYVLALIDEMLTANPKRARLFHDESLSNEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EK CKILSLIVS R
Sbjct  122  EKCCKILSLIVSAR  135



>gb|AAO65974.1| putative vacuolar ATPase subunit H protein [Suaeda salsa]
 gb|AEP40377.1| vacuolar proton pump ATPase subunit H [Suaeda corniculata]
Length=465

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M TD AELTT+QVL RDIPWETYMTTKLITGT LQLLRRYDK+ ES +  LLDDDGP+Y+
Sbjct  1    MATDQAELTTDQVLKRDIPWETYMTTKLITGTALQLLRRYDKRPESQRASLLDDDGPSYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFVSILRDI KEET+EYVLALIDEMLT NPKRARLFHD SLA+ED YEPF+RLLWKGNW
Sbjct  61   RVFVSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDASLANEDIYEPFVRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKIL+LIVS R
Sbjct  121  FIQEKSCKILALIVSAR  137



>ref|XP_008800912.1| PREDICTED: probable V-type proton ATPase subunit H [Phoenix dactylifera]
Length=452

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLITGT LQLLRRYD K+ES +  LLDDDGPAY++VF
Sbjct  2    DRAELTTEQVLKRDIPWETYMSTKLITGTCLQLLRRYDNKSESQRAALLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALIDEMLT NPKRARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VNILRDIAKEETVEYVLALIDEMLTANPKRARLFHDRSLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKILSLIVSVR
Sbjct  122  EKSCKILSLIVSVR  135



>emb|CAD27445.1| putative vacuolar ATPase subunit H [Mesembryanthemum crystallinum]
Length=470

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  DHAEL+TEQV+ RDIPWETYMTTKLI+GT LQLLRRYDKK ES +  LLDDDGPAY+
Sbjct  1    MTIDHAELSTEQVMKRDIPWETYMTTKLISGTSLQLLRRYDKKPESQRASLLDDDGPAYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFV+ILRDI KEET+EYVL+LIDEMLT NPKRARLFHD SLA+ED YEPF+RLLWKGNW
Sbjct  61   RVFVNILRDIFKEETVEYVLSLIDEMLTANPKRARLFHDNSLANEDVYEPFIRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKIL+LIVS R
Sbjct  121  FIQEKSCKILALIVSAR  137



>ref|XP_008357071.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008357072.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ESY++QLLDDDGPAY++VF
Sbjct  2    DHAELTTEQVLNRDIPWETYMTTKLITGTCLQLLRRYDKRSESYRSQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDE+LT NPKRARLFHD SL D+D YEPFLRLLWK NWF+Q
Sbjct  62   VGILRDIFKEETVEYVLALIDEVLTANPKRARLFHDSSLVDKDIYEPFLRLLWKSNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  122  EKSCKILALIVSAR  135



>gb|AIZ49542.1| V-ATPase subunit H1 [Eriobotrya japonica]
Length=452

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ESY++QLLDDDGPAY++VF
Sbjct  2    DHAELTTEQVLNRDIPWETYMTTKLITGTCLQLLRRYDKRSESYRSQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDEMLT NPKRARLFHD SL D+D YEPFLRLLWK NWF+Q
Sbjct  62   VGILRDIFKEETVEYVLALIDEMLTANPKRARLFHDSSLVDKDIYEPFLRLLWKSNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
             KSCKIL+LIVS R
Sbjct  122  AKSCKILALIVSAR  135



>ref|XP_010662098.1| PREDICTED: V-type proton ATPase subunit H [Vitis vinifera]
Length=452

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL RDIPWETYMTTKLITGT LQLLRRYD ++ES +  LLDDDGPAY+RVF
Sbjct  2    DRAELTTDQVLKRDIPWETYMTTKLITGTCLQLLRRYDNRSESQRAVLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALIDEMLT NPKRA+LFHDKSLA+EDTYEPFLRLLWKGNWFVQ
Sbjct  62   VSILRDIFKEETVEYVLALIDEMLTANPKRAKLFHDKSLANEDTYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  122  EKSCKILALIVSAR  135



>gb|EYU39492.1| hypothetical protein MIMGU_mgv1a006273mg [Erythranthe guttata]
Length=450

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  D  E +TEQVL+RDIPWETYMTTKLITGTGLQLLRRYDKK E+YK QLLDDDGPAY+
Sbjct  1    MAVDQVEFSTEQVLSRDIPWETYMTTKLITGTGLQLLRRYDKKPENYKAQLLDDDGPAYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFVSILRDI KEET+EYVLALIDEML+ NPKRAR+FHDKSL DED YEPFLRLL KG+W
Sbjct  61   RVFVSILRDIFKEETVEYVLALIDEMLSANPKRARIFHDKSLTDEDIYEPFLRLLSKGSW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSLIVS R
Sbjct  121  FIQEKSCKILSLIVSGR  137



>ref|XP_006350112.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum tuberosum]
Length=454

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  ++AELTTEQVL RDIPWETYMTTKLI+GT LQLLRRYDK AESYK+QLLD+DGPAYI
Sbjct  1    MTIENAELTTEQVLRRDIPWETYMTTKLISGTDLQLLRRYDKMAESYKSQLLDNDGPAYI  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
             VFV+ LRD+ KEET+EYVLALIDEMLT NP+RARLFHD SL++EDTYEPFLR LWKGNW
Sbjct  61   HVFVTTLRDVFKEETVEYVLALIDEMLTANPRRARLFHDSSLSNEDTYEPFLRFLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSLIVS R
Sbjct  121  FIQEKSCKILSLIVSAR  137



>ref|XP_004307846.1| PREDICTED: V-type proton ATPase subunit H [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWE YMTTKLITGT LQLLRRYDK++E+Y++QLLDDDGPAY++VF
Sbjct  2    DHAELTTEQVLKRDIPWEQYMTTKLITGTCLQLLRRYDKRSETYRSQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDE+LT NPKRARLFHD SL D+D YEPFLRLLWKGNWF+Q
Sbjct  62   VGILRDIFKEETVEYVLALIDELLTANPKRARLFHDTSLVDKDVYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL LIVS R
Sbjct  122  EKSCKILGLIVSAR  135



>ref|XP_009361140.1| PREDICTED: V-type proton ATPase subunit H [Pyrus x bretschneideri]
Length=452

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ESY++QLLDDDGPAY+++F
Sbjct  2    DHAELTTEQVLNRDIPWETYMTTKLITGTCLQLLRRYDKRSESYRSQLLDDDGPAYVQMF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDE+LT NPKRARLFHD SL D+D YEPFLRLLWK NWF+Q
Sbjct  62   VGILRDIFKEETVEYVLALIDEVLTANPKRARLFHDSSLVDKDIYEPFLRLLWKSNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  122  EKSCKILALIVSAR  135



>ref|XP_004251740.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum lycopersicum]
Length=454

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  ++ ELTTEQVL RDIPWETYMTTKLI+GT LQLLRRYDK AESYK+QLLD+DGPAYI
Sbjct  1    MTIENGELTTEQVLRRDIPWETYMTTKLISGTDLQLLRRYDKMAESYKSQLLDNDGPAYI  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFV+ LRDI K+ET+EYVLALIDEMLT NP+RARLFHD SL++EDTYEPFLR LWKGNW
Sbjct  61   RVFVTTLRDIFKDETVEYVLALIDEMLTANPRRARLFHDSSLSNEDTYEPFLRFLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKILSLIVS R
Sbjct  121  FIQEKSCKILSLIVSAR  137



>ref|XP_008234540.1| PREDICTED: V-type proton ATPase subunit H, partial [Prunus mume]
Length=423

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ES+++QLLDDDGPAY++VF
Sbjct  2    DHAELTTEQVLKRDIPWETYMTTKLITGTCLQLLRRYDKRSESHRSQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDEML  NPKRARLFHD ++ D+D YEPFLRLLWKGNWF+Q
Sbjct  62   VGILRDIFKEETVEYVLALIDEMLAANPKRARLFHDGTIVDKDIYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  122  EKSCKILALIVSAR  135



>ref|XP_010673864.1| PREDICTED: V-type proton ATPase subunit H [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  DHAELTT+QVL RDIPWETYMTTKLITGT LQLLRRYDK+ ES +  LLDDDGP+Y+
Sbjct  1    MTIDHAELTTDQVLKRDIPWETYMTTKLITGTALQLLRRYDKRPESQRASLLDDDGPSYV  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
            RVFVSILRDI KEET+EYVL+LIDEMLT NPKRARLFHD SLA+ED YEPF+RLLWKGNW
Sbjct  61   RVFVSILRDIFKEETVEYVLSLIDEMLTANPKRARLFHDNSLANEDIYEPFVRLLWKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            F+QEKSCKIL++IVS R
Sbjct  121  FIQEKSCKILAVIVSAR  137



>ref|XP_007217990.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
 gb|EMJ19189.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
Length=452

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ES+++QLLDDDGPAY++VF
Sbjct  2    DHAELTTEQVLKRDIPWETYMTTKLITGTCLQLLRRYDKRSESHRSQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDEML  NPKRARLFHD ++ D+D YEPFLRLLWKGNWF+Q
Sbjct  62   VGILRDIFKEETVEYVLALIDEMLAANPKRARLFHDGTIVDKDIYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  122  EKSCKILALIVSAR  135



>ref|XP_011077102.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            MP D  EL+T++VL RDIPWETYMTTKLITGTGLQLLRRYDKK E+YK QLLD DGPAY 
Sbjct  1    MPIDQGELSTDEVLRRDIPWETYMTTKLITGTGLQLLRRYDKKPENYKAQLLDADGPAYA  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNW  483
             VFVSILRDI KEET+EYVLALIDEML+ NPKRARLFHDKSLA+ED YEPFLRLL KGNW
Sbjct  61   HVFVSILRDIFKEETVEYVLALIDEMLSANPKRARLFHDKSLANEDIYEPFLRLLVKGNW  120

Query  484  FVQEKSCKILSLIVSVR  534
            FVQEKSCKILSLIVS R
Sbjct  121  FVQEKSCKILSLIVSER  137



>ref|XP_008791823.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
 ref|XP_008791824.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
Length=452

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLITGT LQLLRRYDK+ ES +  LLDDDGPAY+RVF
Sbjct  2    DIAELTTEQVLKRDIPWETYMSTKLITGTCLQLLRRYDKRPESQRAALLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILRDI KEET+EYVLAL+DEMLT NPKRARLFHDKSLA+EDTY+PFLRLLWKGNWF+Q
Sbjct  62   MNILRDISKEETIEYVLALLDEMLTANPKRARLFHDKSLANEDTYDPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKILSLIVSVR
Sbjct  122  EKSCKILSLIVSVR  135



>ref|XP_010912757.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Elaeis guineensis]
Length=452

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+TEQVL RDIPWETYMTTKLITGT LQLLRRYDK++ES +  LLDDDGPAY+RVF
Sbjct  2    DRAELSTEQVLKRDIPWETYMTTKLITGTCLQLLRRYDKRSESQRAALLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILRDI KEET+EYVLALI+EMLT NPKRARLFHDKSLA+EDTYEPFLRLLW GNWF+Q
Sbjct  62   MNILRDISKEETVEYVLALIEEMLTANPKRARLFHDKSLANEDTYEPFLRLLWIGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKILSLIVSVR
Sbjct  122  EKSCKILSLIVSVR  135



>ref|XP_010930282.1| PREDICTED: probable V-type proton ATPase subunit H [Elaeis guineensis]
Length=452

 Score =   240 bits (613),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLITGT LQLLRRYD ++ES +  LLDDDGPAY+RVF
Sbjct  2    DRAELTTEQVLKRDIPWETYMSTKLITGTCLQLLRRYDNRSESQRAALLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
             +IL DI KEET+EYVLALIDEMLT NPKRARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   ANILLDIAKEETVEYVLALIDEMLTANPKRARLFHDRSLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKILSLIVSVR
Sbjct  122  EKSCKILSLIVSVR  135



>ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Glycine 
max]
Length=452

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELT+EQVL RDIPWETYM+TKLI+GT LQLLRRYD + ES++ QLLDDDGP+Y+RVF
Sbjct  2    DQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRAQLLDDDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V +LRDI KE+T+EYVLALIDEML  NPKRARLFHD +LADEDTYEPFLRLLWKGNWF+Q
Sbjct  62   VRVLRDIFKEDTVEYVLALIDEMLAANPKRARLFHDSALADEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVSVR
Sbjct  122  EKSCKILALIVSVR  135



>ref|XP_004509230.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Cicer 
arietinum]
 ref|XP_004509231.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Cicer 
arietinum]
Length=452

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELT+EQVL+RDIPWETYM+TKLI+GT LQLLRRYD + ES++ QLLDDDGPAY+RVF
Sbjct  2    DQAELTSEQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V +LRDI KE+T+EYVLALIDEMLT NPKRARLFHD +LADEDTYEPFLRLL KGNWFVQ
Sbjct  62   VHVLRDIFKEDTVEYVLALIDEMLTANPKRARLFHDNTLADEDTYEPFLRLLRKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVSVR
Sbjct  122  EKSCKILALIVSVR  135



>ref|XP_011044458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Populus 
euphratica]
Length=452

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            + AELTTEQVL RDIPWETYM TKLI+GT LQLLRRYD + ESY+ QLLDDDGPAY+RVF
Sbjct  2    EQAELTTEQVLKRDIPWETYMMTKLISGTDLQLLRRYDNRPESYRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALIDEML  NPKRARLFHDKSLA++D YE FLRLLWKGNWF+Q
Sbjct  62   VTILRDIFKEETVEYVLALIDEMLAANPKRARLFHDKSLANDDPYESFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  122  EKSCKILALIVSAR  135



>gb|KJB18498.1| hypothetical protein B456_003G056300 [Gossypium raimondii]
Length=463

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 126/145 (87%), Gaps = 11/145 (8%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            + AELTTEQVL RDIPWETYMTTKLI+GTGLQLLRR+D +AES + QLLDDDGPAY++VF
Sbjct  2    ERAELTTEQVLKRDIPWETYMTTKLISGTGLQLLRRFDNRAESVRAQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL-----------  459
            VSILRDI KEET+E+VLALIDEMLT NPKRARLFHDKSLA+EDTYEPFL           
Sbjct  62   VSILRDIFKEETVEHVLALIDEMLTANPKRARLFHDKSLANEDTYEPFLIKLTIHNLSTF  121

Query  460  RLLWKGNWFVQEKSCKILSLIVSVR  534
            RLLWKGNWF+QEKSCKIL+LIVS R
Sbjct  122  RLLWKGNWFIQEKSCKILALIVSAR  146



>ref|XP_006574707.1| PREDICTED: V-type proton ATPase subunit H-like [Glycine max]
Length=452

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +1

Query  136  HAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFV  315
             AELT+EQVL RDIPWETYM+TKLI+GT LQLLRRYD + ES++ QLLDDDGP+Y+RVFV
Sbjct  3    QAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRAQLLDDDGPSYVRVFV  62

Query  316  SILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQE  495
             +LRDI KE+T+EYVLALIDEML  NPKRARLFHD +LADEDTYEPFLRLLWKGNWF+QE
Sbjct  63   RVLRDIFKEDTVEYVLALIDEMLAANPKRARLFHDSALADEDTYEPFLRLLWKGNWFIQE  122

Query  496  KSCKILSLIVSVR  534
            KSCKIL+L+VSVR
Sbjct  123  KSCKILALVVSVR  135



>gb|KHG22602.1| V-type proton ATPase subunit H -like protein [Gossypium arboreum]
Length=494

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 12/146 (8%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+TEQVL RDIPWETYMTTKLI+GTGLQLLRRYD +AES + QLLDDDGPAY++VF
Sbjct  2    DRAELSTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRAESVRAQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR----------  462
            V+ILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA+EDTYEPFL           
Sbjct  62   VNILRDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLANEDTYEPFLSCDLSSKVLVT  121

Query  463  --LLWKGNWFVQEKSCKILSLIVSVR  534
              LLWKGNWF+QEKSCKIL+LIVS R
Sbjct  122  MWLLWKGNWFIQEKSCKILALIVSAR  147



>ref|XP_010526971.1| PREDICTED: V-type proton ATPase subunit H-like [Tarenaya hassleriana]
Length=452

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWE YMTTKLI+GTGLQLLRRYDKK+ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELTTEQVLKRDIPWEAYMTTKLISGTGLQLLRRYDKKSESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NPKRA LFHDKSLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPKRALLFHDKSLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSC IL+ I+S R
Sbjct  122  EKSCVILAWIISAR  135



>gb|ACJ85007.1| unknown [Medicago truncatula]
 gb|AFK33862.1| unknown [Medicago truncatula]
Length=452

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL+RDIPWETYM+TKLI+GT LQLLRRYD ++ES + QLLDDDGPAY+RVF
Sbjct  2    DQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V +LRDI KE+T+EYVLA+ID MLT NPKRARLFHD +LAD+DTYEPFLRLL KGNWFVQ
Sbjct  62   VHVLRDIFKEDTVEYVLAMIDGMLTANPKRARLFHDNALADDDTYEPFLRLLRKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVSVR
Sbjct  122  EKSCKILALIVSVR  135



>ref|XP_010547995.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
 ref|XP_010547996.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
Length=452

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELT +QVL RDIPWE YMTTKLI+GTGLQLLRRYDKK+ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELTIDQVLKRDIPWEAYMTTKLISGTGLQLLRRYDKKSESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NPKRARLFHDKSL +EDTYEPFLRLLWKGNWFVQ
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPKRARLFHDKSLENEDTYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSC+IL+ I+S R
Sbjct  122  EKSCQILAWIISAR  135



>ref|XP_009609770.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Nicotiana 
tomentosiformis]
Length=124

 Score =   220 bits (560),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILK  339
            +L RDIPWETYMTTKLITGT LQLLRRYDKKAES K QLLDDDGPAY+ VFV+IL+DI K
Sbjct  1    ILRRDIPWETYMTTKLITGTSLQLLRRYDKKAESDKAQLLDDDGPAYVSVFVNILQDIFK  60

Query  340  EETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSL  519
            EET+EYVLALIDEMLT NP+RA+LFHD S A+EDTYEPFLRLLWKGNWF+QEKSCKILS+
Sbjct  61   EETVEYVLALIDEMLTANPRRAKLFHDNSFANEDTYEPFLRLLWKGNWFIQEKSCKILSV  120

Query  520  IV  525
            IV
Sbjct  121  IV  122



>ref|XP_006437440.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 ref|XP_006437441.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50680.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50681.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
Length=447

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 5/134 (4%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMTTKLI+GTGLQLLRRYD ++ES++ QLLDDDGP+Y+RVF
Sbjct  2    DHAELTTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRSESHRAQLLDDDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA EDTYEPFL      NWF+Q
Sbjct  62   VSILRDIYKEETVEYVLALIDEMLTANPKRARLFHDKSLASEDTYEPFL-----SNWFIQ  116

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ IVS R
Sbjct  117  EKSCKILASIVSAR  130



>ref|XP_002319248.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
 gb|EEE95171.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
Length=397

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 121/151 (80%), Gaps = 17/151 (11%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            + AELTTEQVL RDIPWETYM TKLI+GT LQLLRRYD + ESY+ QLLDDDGPAY+RVF
Sbjct  2    EQAELTTEQVLKRDIPWETYMMTKLISGTDLQLLRRYDNRPESYRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR----------  462
            V+ILRDI KEET+EYVLALIDEML  NPKRARLFHDKSLA++D YEPFL           
Sbjct  62   VTILRDIFKEETVEYVLALIDEMLAANPKRARLFHDKSLANDDPYEPFLSQLTPQLLVFF  121

Query  463  -------LLWKGNWFVQEKSCKILSLIVSVR  534
                   LLWKGNWF+QEKSCKIL+LIVS R
Sbjct  122  LRVTIMILLWKGNWFIQEKSCKILALIVSAR  152



>emb|CDX69032.1| BnaC01g04210D [Brassica napus]
Length=452

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+TEQVL RDIPWETYMTTKLI+ TGLQLLRRYDKK+ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSTEQVLKRDIPWETYMTTKLISATGLQLLRRYDKKSESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA EDTYEPFLRLL KGNWF+Q
Sbjct  62   VTILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLAHEDTYEPFLRLLSKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|XP_002869169.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45428.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=418

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|XP_009115735.1| PREDICTED: V-type proton ATPase subunit H-like [Brassica rapa]
 gb|AID60130.1| AT3g42050-like protein [Brassica napus]
 emb|CDX75407.1| BnaA01g02950D [Brassica napus]
Length=452

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+TEQVL RDIPWETYMTTKLI+ TGLQLLRRYDKKAES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSTEQVLKRDIPWETYMTTKLISATGLQLLRRYDKKAESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA EDTYEPFLRLL KGNWF+Q
Sbjct  62   VTILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLAHEDTYEPFLRLLSKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKI++ I+S R
Sbjct  122  EKSCKIVAWIISAR  135



>gb|AAK59761.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
Length=441

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|NP_189791.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
 sp|Q9LX65.1|VATH_ARATH RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar H(+)-ATPase subunit H; AltName: 
Full=Vacuolar proton pump subunit H [Arabidopsis thaliana]
 emb|CAB91576.1| vacuolar H(+)-ATPase subunit-like protein [Arabidopsis thaliana]
 gb|AAM10284.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
 gb|AEE77718.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
Length=441

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|XP_010432453.1| PREDICTED: V-type proton ATPase subunit H-like [Camelina sativa]
Length=452

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK+ES + QLLD DGPAY+++F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKSESERAQLLDQDGPAYVQLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLAHEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|XP_006412262.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412263.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412264.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53715.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53716.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53717.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
Length=452

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELT +QVL RDIPWETYMTTKLI+ TGLQLLRRYDKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELTMDQVLKRDIPWETYMTTKLISATGLQLLRRYDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHDKSLA EDTYEPFLRLL KGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDKSLAHEDTYEPFLRLLSKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>gb|KCW59595.1| hypothetical protein EUGRSUZ_H02340 [Eucalyptus grandis]
Length=438

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 119/134 (89%), Gaps = 5/134 (4%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL RDIPWETYMTTKLITGT LQLLRRYDK++ESY+ QLLDDDGPAY RVF
Sbjct  2    DQAELTTDQVLRRDIPWETYMTTKLITGTCLQLLRRYDKRSESYRAQLLDDDGPAYARVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALIDEMLT NPKRARLFHD+SL++EDTYEPFL      NWF+Q
Sbjct  62   VNILRDIFKEETVEYVLALIDEMLTANPKRARLFHDESLSNEDTYEPFL-----SNWFIQ  116

Query  493  EKSCKILSLIVSVR  534
            EK CKILSLIVS R
Sbjct  117  EKCCKILSLIVSAR  130



>ref|XP_010437658.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Camelina 
sativa]
Length=452

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK+ES + QLLD DGPAY+++F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKSESERAQLLDQDGPAYVQLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+  +S R
Sbjct  122  EKSCKILAWTISAR  135



>ref|XP_010447124.1| PREDICTED: V-type proton ATPase subunit H [Camelina sativa]
Length=437

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ E VL RDIPWETYM TKL++  GLQLLRRYDKK+ES + QLLD DGPAY+++F
Sbjct  2    DQAELSIEHVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKSESERAQLLDQDGPAYVQLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|XP_009416984.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  139  AELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVS  318
            AELTTE+VL  DIPWETYMTTKLITGT LQLLRRYDKK+ES +  LLDDDGPAY+ VF++
Sbjct  4    AELTTEEVLKMDIPWETYMTTKLITGTHLQLLRRYDKKSESQRAALLDDDGPAYVAVFIN  63

Query  319  ILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEK  498
            ILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSL++EDTY+PFLR L +GNWF+QEK
Sbjct  64   ILRDISKEETVEYVLALIDEMLTANPKRARLFHDKSLSNEDTYQPFLRWLQEGNWFIQEK  123

Query  499  SCKILSLIVSVR  534
            SCKIL+LIVS R
Sbjct  124  SCKILTLIVSAR  135



>ref|XP_006283723.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
 gb|EOA16621.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
Length=452

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRR+DKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRFDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLAQEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>emb|CBI26482.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 124/165 (75%), Gaps = 31/165 (19%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL RDIPWETYMTTKLITGT LQLLRRYD ++ES +  LLDDDGPAY+RVF
Sbjct  2    DRAELTTDQVLKRDIPWETYMTTKLITGTCLQLLRRYDNRSESQRAVLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL-----------  459
            VSILRDI KEET+EYVLALIDEMLT NPKRA+LFHDKSLA+EDTYEPFL           
Sbjct  62   VSILRDIFKEETVEYVLALIDEMLTANPKRAKLFHDKSLANEDTYEPFLICRVNIWYGVQ  121

Query  460  --------------------RLLWKGNWFVQEKSCKILSLIVSVR  534
                                +LLWKGNWFVQEKSCKIL+LIVS R
Sbjct  122  TFLCCLEAPRPQKVKIMLCKQLLWKGNWFVQEKSCKILALIVSAR  166



>ref|XP_010437659.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Camelina 
sativa]
Length=452

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK+ES + QLLD DGPAY+++F
Sbjct  2    DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKSESERAQLLDQDGPAYVQLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLAHEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+  +S R
Sbjct  122  EKSCKILAWTISAR  135



>ref|XP_009778019.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Nicotiana 
sylvestris]
Length=370

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  160  VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILK  339
            VL RDI W+TYMTTKLIT TGLQLLRRYDKKAES K QLLDDDGPAY+ VFV+ILRDI K
Sbjct  1    VLRRDILWDTYMTTKLITETGLQLLRRYDKKAESDKAQLLDDDGPAYVSVFVTILRDIFK  60

Query  340  EETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSL  519
            EET+EYVLALIDEMLT NP+RA+LFHD S A+EDTYEPFLRLLWKGNWF+QEKSCKILS+
Sbjct  61   EETVEYVLALIDEMLTANPRRAKLFHDNSFANEDTYEPFLRLLWKGNWFIQEKSCKILSV  120

Query  520  IVSVR  534
            IVS R
Sbjct  121  IVSAR  125



>ref|XP_006858816.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
 gb|ERN20283.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
Length=475

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 122/160 (76%), Gaps = 26/160 (16%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTE+VLTRDIPWETYM TKLI+GT LQLLRRY+K++ESY  QLLDDDGPAY+RVF
Sbjct  2    DQAELTTEKVLTRDIPWETYMATKLISGTSLQLLRRYEKRSESYCAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR----------  462
            VSILRDI KEET+EYVLALIDEMLT NPKRARLFHD SLA+ED YEPFL           
Sbjct  62   VSILRDITKEETVEYVLALIDEMLTANPKRARLFHDPSLANEDIYEPFLSFSSGHSSMQL  121

Query  463  ----------------LLWKGNWFVQEKSCKILSLIVSVR  534
                            LLWKGNWF+QEKSCKIL+LI+  R
Sbjct  122  GEKYRETSHSFSFYVGLLWKGNWFIQEKSCKILALIICAR  161



>gb|ABR17502.1| unknown [Picea sitchensis]
Length=458

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWETYMT KLI+GT LQLLRRYD + E+ +  LLDDDGPAYIRVF
Sbjct  7    DHAELTTEQVLKRDIPWETYMTAKLISGTCLQLLRRYDHRPENVQAALLDDDGPAYIRVF  66

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V ILRDI KEET+EYVLALIDEMLT NPKRARLF D SL++ED Y+PFLRLL KGNWF+Q
Sbjct  67   VGILRDISKEETVEYVLALIDEMLTANPKRARLFLDDSLSNEDIYQPFLRLLSKGNWFIQ  126

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LI+S +
Sbjct  127  EKSCKILTLIISAK  140



>gb|KJB26715.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=481

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 123/165 (75%), Gaps = 31/165 (19%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+TEQVL RDIPWETYMTTKLI+GTGLQLLRRYD +AES + QLLDDDGPAY++VF
Sbjct  2    DRAELSTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRAESVRAQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR----------  462
            V+ILRDI KEET+EYVLALIDEML  N KRARLFHDKSLA+EDTYEPFL           
Sbjct  62   VNILRDIFKEETVEYVLALIDEMLAANLKRARLFHDKSLANEDTYEPFLIACFASIFDIM  121

Query  463  ---------------------LLWKGNWFVQEKSCKILSLIVSVR  534
                                 LLWKGNWF+QEKSCKIL+LIVS R
Sbjct  122  LKICTYATGCDLSSKVLVTMWLLWKGNWFIQEKSCKILALIVSAR  166



>ref|XP_003629515.1| V-type proton ATPase subunit H [Medicago truncatula]
Length=448

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 4/134 (3%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL+RDIPWETYM+TKLI+GT LQLLRRYD ++ES + QLLDDDGPAY+RVF
Sbjct  2    DQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V +LRDI KE+T+EYVLA+IDEMLT NPKRARLFHD +LAD+DTYE    LL KGNWFVQ
Sbjct  62   VHVLRDIFKEDTVEYVLAMIDEMLTANPKRARLFHDNALADDDTYE----LLRKGNWFVQ  117

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVSVR
Sbjct  118  EKSCKILALIVSVR  131



>ref|XP_007029673.1| Vacuolar ATP synthase subunit H family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY10175.1| Vacuolar ATP synthase subunit H family protein isoform 3, partial 
[Theobroma cacao]
Length=325

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  193  MTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALI  372
            MTTKLI+GTGLQLLRRYD +AESY+ QLLDDDGPAY+RVFVSILRDI KEET+EYVLALI
Sbjct  1    MTTKLISGTGLQLLRRYDNRAESYRAQLLDDDGPAYVRVFVSILRDIFKEETVEYVLALI  60

Query  373  DEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            DEMLT NPKRARLFHDKSLA+EDTYEPFLRLLWKGNWF+QEKSCKIL+LIVS R
Sbjct  61   DEMLTANPKRARLFHDKSLANEDTYEPFLRLLWKGNWFIQEKSCKILALIVSAR  114



>emb|CDP04144.1| unnamed protein product [Coffea canephora]
Length=136

 Score =   211 bits (536),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M  DHAELTTEQVL RDIPWETYMTTKLITGTGLQLLRRYDKKAE+YK QLLDDDGP+YI
Sbjct  1    MTMDHAELTTEQVLRRDIPWETYMTTKLITGTGLQLLRRYDKKAENYKAQLLDDDGPSYI  60

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR  462
            RVFVSILRDI KEET+EYVLALIDEMLT NPKRARLFHDKSLA ED YEPFLR
Sbjct  61   RVFVSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLASEDAYEPFLR  113



>gb|EPS61013.1| hypothetical protein M569_13786, partial [Genlisea aurea]
Length=442

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  160  VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILK  339
            VL RDIPWETYMT+KLITGTGLQLLRRYDKK E+YK QLLDDDGP+YIRVFV+ILRDI K
Sbjct  1    VLRRDIPWETYMTSKLITGTGLQLLRRYDKKPENYKAQLLDDDGPSYIRVFVNILRDIYK  60

Query  340  EETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSL  519
            +ET+EYVLALIDE+L+ N KRARLFHDKSLADED Y PF+RLLWKGNWF+QEKS KILSL
Sbjct  61   DETVEYVLALIDEILSANAKRARLFHDKSLADEDVYGPFVRLLWKGNWFIQEKSSKILSL  120

Query  520  IVSVR  534
            ++S R
Sbjct  121  VISER  125



>dbj|BAH20255.1| AT3G42050 [Arabidopsis thaliana]
Length=436

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  145  LTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSIL  324
            L+ EQVL RDIPWETYM TKL++  GLQLLRRYDKK ES + QLLD+DGPAY+ +FVSIL
Sbjct  1    LSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLFVSIL  60

Query  325  RDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSC  504
            RDI KEET+EYVLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+QEKSC
Sbjct  61   RDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQEKSC  120

Query  505  KILSLIVSVR  534
            KIL+ I+S R
Sbjct  121  KILAWIISAR  130



>ref|XP_011044454.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044455.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
Length=483

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 121/165 (73%), Gaps = 31/165 (19%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDD---------  285
            + AELTTEQVL RDIPWETYM TKLI+GT LQLLRRYD + ESY+ QLLDD         
Sbjct  2    EQAELTTEQVLKRDIPWETYMMTKLISGTDLQLLRRYDNRPESYRAQLLDDVFKPNYSVL  61

Query  286  ----------------------DGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPK  399
                                  DGPAY+RVFV+ILRDI KEET+EYVLALIDEML  NPK
Sbjct  62   FCVFLFGLEIFLTLSFIFKPWQDGPAYVRVFVTILRDIFKEETVEYVLALIDEMLAANPK  121

Query  400  RARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            RARLFHDKSLA++D YE FLRLLWKGNWF+QEKSCKIL+LIVS R
Sbjct  122  RARLFHDKSLANDDPYESFLRLLWKGNWFIQEKSCKILALIVSAR  166



>ref|NP_001146965.1| vacuolar ATPase subunit H protein [Zea mays]
 gb|ACG24799.1| vacuolar ATPase subunit H protein [Zea mays]
Length=468

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 125/156 (80%), Gaps = 7/156 (4%)
 Frame = +1

Query  67   SPSALRSIDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD  246
             P+  R +D     RP+     D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD
Sbjct  3    GPARGRCLDCP---RPVM----DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYD  55

Query  247  KKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKS  426
             K ES +  LL++DGPAYIRVF++ILR I KEET+EYVLALIDEML  NPKRA LF+D+S
Sbjct  56   HKPESQRAPLLEEDGPAYIRVFLNILRSISKEETVEYVLALIDEMLATNPKRAALFYDQS  115

Query  427  LADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            L+ ED YEPFLRLLWKGNWFVQEKSCKIL++I+S R
Sbjct  116  LSGEDIYEPFLRLLWKGNWFVQEKSCKILTVIISAR  151



>emb|CDY49280.1| BnaA03g50930D [Brassica napus]
Length=450

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYMTTKLI+ TGLQLLRR+DKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSMEQVLKRDIPWETYMTTKLISATGLQLLRRFDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALI EML+ NP RARLFHD++L  EDTYEPFLRLL KGNWF+Q
Sbjct  62   VTILRDIFKEETVEYVLALIYEMLSANPTRARLFHDETLEHEDTYEPFLRLLSKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>emb|CDX72455.1| BnaC07g44770D [Brassica napus]
Length=450

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYMTTKLI+ TGLQLLRR+DKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSMEQVLKRDIPWETYMTTKLISATGLQLLRRFDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALI EML+ NP RARLFHD++L  EDTYEPFLRLL KGNWF+Q
Sbjct  62   VTILRDIFKEETVEYVLALIYEMLSANPTRARLFHDETLEHEDTYEPFLRLLSKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>ref|XP_009138267.1| PREDICTED: V-type proton ATPase subunit H [Brassica rapa]
Length=451

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+ EQVL RDIPWETYMTTKLI+ TGLQLLRR+DKK ES + QLLD+DGPAY+ +F
Sbjct  2    DQAELSMEQVLKRDIPWETYMTTKLISATGLQLLRRFDKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ILRDI KEET+EYVLALI EML+ NP RARLFHD++L  EDTYEPFLRLL KGNWF+Q
Sbjct  62   VTILRDIFKEETVEYVLALIYEMLSANPTRARLFHDETLEHEDTYEPFLRLLSKGNWFIQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILAWIISAR  135



>gb|ACF84665.1| unknown [Zea mays]
 gb|ACL54657.1| unknown [Zea mays]
Length=452

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++DGPAYIRVF
Sbjct  2    DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEDGPAYIRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR I KEET+EYVLALIDEML  NPKRA LF+D+SL+ ED YEPFLRLLWKGNWFVQ
Sbjct  62   LNILRSISKEETVEYVLALIDEMLATNPKRAALFYDQSLSGEDIYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL++I+S R
Sbjct  122  EKSCKILTVIISAR  135



>ref|XP_002877351.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=130

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELT EQVL RDIPWETYMTTKLI+ T LQ LRRY KK ES + QLLD+DGPAY+ +F
Sbjct  2    DHAELTLEQVLKRDIPWETYMTTKLISATSLQRLRRYGKKPESARAQLLDEDGPAYVHLF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALI EML  NP RARLFHDKSL  EDTYEPFLRLLWKGNWF+Q
Sbjct  62   VSILRDIFKEETVEYVLALIYEMLLENPTRARLFHDKSLVHEDTYEPFLRLLWKGNWFIQ  121

Query  493  EKSCKIL  513
            EK+ + L
Sbjct  122  EKAARSL  128



>ref|XP_002453051.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
 gb|EES06027.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
Length=452

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++DGPAY+RVF
Sbjct  2    DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR I KEET+EYVLALIDEML+ NPKRA LF+D+SL+ ED YEPFLRLLWKGNWFVQ
Sbjct  62   LNILRSISKEETVEYVLALIDEMLSANPKRAALFYDQSLSGEDIYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILTDIISAR  135



>gb|AET03991.2| vacuolar H+-ATPase subunit H, putative [Medicago truncatula]
Length=486

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 123/168 (73%), Gaps = 34/168 (20%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTT+QVL+RDIPWETYM+TKLI+GT LQLLRRYD ++ES + QLLDDDGPAY+RVF
Sbjct  2    DQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLW-------  471
            V +LRDI KE+T+EYVLA+IDEMLT NPKRARLFHD +LAD+DTYEPFL  L+       
Sbjct  62   VHVLRDIFKEDTVEYVLAMIDEMLTANPKRARLFHDNALADDDTYEPFLIFLYQFIIIKH  121

Query  472  ---------------------------KGNWFVQEKSCKILSLIVSVR  534
                                       KGNWFVQEKSCKIL+LIVSVR
Sbjct  122  IKPYSQFKVSFSSLHINVANMIILLLRKGNWFVQEKSCKILALIVSVR  169



>ref|XP_007156009.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
 gb|ESW28003.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
Length=491

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 123/173 (71%), Gaps = 39/173 (23%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL+RDIPWETYM+TKLI+ T LQLLRRYD ++ES++ QLLDDDGP+Y+RVF
Sbjct  2    DQAELTTEQVLSRDIPWETYMSTKLISSTSLQLLRRYDHRSESHRAQLLDDDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL-----------  459
            V +LRDI KE+T+EYVLALIDEML  NPKR RLFHD +LADEDTYEPFL           
Sbjct  62   VRVLRDIFKEDTVEYVLALIDEMLAANPKRGRLFHDSTLADEDTYEPFLSETRHTHMTGF  121

Query  460  ----------------------------RLLWKGNWFVQEKSCKILSLIVSVR  534
                                        +LLWKGNWF+QEKSCKIL+LIVSVR
Sbjct  122  CIEYPVICFSNWVLNKLNTLVYVHSDSYQLLWKGNWFIQEKSCKILALIVSVR  174



>ref|XP_006657814.1| PREDICTED: probable V-type proton ATPase subunit H-like [Oryza 
brachyantha]
Length=452

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWE+YM  KLI+GT LQLLRRYD K ES +  LLD+DGP+Y+RVF
Sbjct  2    DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR+I KEET+EYVLALIDEML  NPKRA LF+DKSL+ ED Y+PFLRLL KGNWFVQ
Sbjct  62   LNILRNISKEETVEYVLALIDEMLAANPKRAALFYDKSLSGEDIYDPFLRLLLKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILTQIISAR  135



>ref|XP_002460834.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
 gb|EER97355.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
Length=452

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++DGPAY+RVF
Sbjct  2    DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR I KEET+EYVLALIDEMLT NPKRA LF+++SL+ ED YEPFLRLLWKGNWFVQ
Sbjct  62   LNILRSISKEETVEYVLALIDEMLTTNPKRAALFYEQSLSGEDIYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILTDIISAR  135



>gb|EEC82241.1| hypothetical protein OsI_26411 [Oryza sativa Indica Group]
 gb|EEE67371.1| hypothetical protein OsJ_24664 [Oryza sativa Japonica Group]
Length=495

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   PSALRSIDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDK  249
            P  L     G+   P+     DHAELTTEQVL RDIPWE+YM  KLI+GT LQLLRRYD 
Sbjct  28   PPPLYPAGGGLFGHPVM----DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDH  83

Query  250  KAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSL  429
            K ES +  LLD+DGP+Y+RVF++ILR+I KE+T+EYVLALIDEML VNPKRA LF+D SL
Sbjct  84   KPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSL  143

Query  430  ADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            + ED Y+PFLRLL KGNWFVQEKSCKIL+ I+S R
Sbjct  144  SGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISAR  178



>gb|ABF47532.1| At3g42050-S [Arabidopsis lyrata subsp. petraea]
 gb|ABF47533.1| At3g42050-S [Arabidopsis lyrata subsp. petraea]
 gb|ABF47534.1| At3g42050-S [Arabidopsis lyrata subsp. petraea]
Length=138

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  178  PWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEY  357
            PWETYM TKL++  GLQLLRRYDKK ES + QLLD+DGPAY+ +FVSILRDI KEET+EY
Sbjct  1    PWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLFVSILRDIFKEETVEY  60

Query  358  VLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            VLALI EML+ NP RARLFHD+SLA+EDTYEPFLRLLWKGNWF+QEKSCKIL+ I+S R
Sbjct  61   VLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQEKSCKILAWIISAR  119



>gb|KDP39537.1| hypothetical protein JCGZ_02557 [Jatropha curcas]
Length=439

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 112/134 (84%), Gaps = 13/134 (10%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM TKLI+GT LQLLRRYD ++ESY+ QLLDDDGPAY+RVF
Sbjct  2    DQAELTTEQVLKRDIPWETYMVTKLISGTDLQLLRRYDNRSESYRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            VSILRDI KEET+EYVLALIDEMLT NPKRARLFHDK             LLWKGNW+VQ
Sbjct  62   VSILRDIFKEETVEYVLALIDEMLTANPKRARLFHDK-------------LLWKGNWYVQ  108

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  109  EKSCKILALIVSAR  122



>sp|Q84ZC0.1|VATH_ORYSJ RecName: Full=Probable V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit 
H [Oryza sativa Japonica Group]
 dbj|BAC57732.1| putative vacuolar ATP synthase subunit H [Oryza sativa Japonica 
Group]
 dbj|BAG90555.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWE+YM  KLI+GT LQLLRRYD K ES +  LLD+DGP+Y+RVF
Sbjct  2    DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR+I KE+T+EYVLALIDEML VNPKRA LF+D SL+ ED Y+PFLRLL KGNWFVQ
Sbjct  62   LNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILTQIISAR  135



>ref|NP_001288363.1| uncharacterized protein LOC103647744 [Zea mays]
 gb|ACN33576.1| unknown [Zea mays]
 tpg|DAA41089.1| TPA: vacuolar ATPase subunit H protein [Zea mays]
Length=452

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++DGPAY+RVF
Sbjct  2    DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++IL  I KEET+EYVLALIDEML  NPKRA LF+D+SL+ ED YEPFLRLLWKGNWFVQ
Sbjct  62   LNILWSISKEETVEYVLALIDEMLATNPKRAALFYDQSLSGEDIYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILTAIISAR  135



>gb|ABF47535.1| At3g42050-L [Arabidopsis lyrata subsp. petraea]
Length=149

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +1

Query  178  PWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEY  357
            PWETYMTTKLI+ TGLQ LRRYDKK ES + QLLD+DGPAY+ +FVSILRDI KEET+EY
Sbjct  1    PWETYMTTKLISATGLQHLRRYDKKPESARAQLLDEDGPAYVHLFVSILRDIFKEETVEY  60

Query  358  VLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            VLALI EML+ NP RARLFHDKSLA EDTYEPFLRLLWKGNWF+QEKSCKIL+ I+  R
Sbjct  61   VLALIYEMLSENPTRARLFHDKSLAHEDTYEPFLRLLWKGNWFIQEKSCKILAWIIRAR  119



>gb|ABF47536.1| At3g42050-L [Arabidopsis lyrata subsp. petraea]
Length=149

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  178  PWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEY  357
            PWETYMTTKLI+ TGLQ LRRYDKK ES + QLLD+DGPAY+ +FVSILRDI KEET+EY
Sbjct  1    PWETYMTTKLISATGLQHLRRYDKKPESARAQLLDEDGPAYVHLFVSILRDIFKEETVEY  60

Query  358  VLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            VLALI EML  NP RARLFHDKSLA EDTYEPFLRLLWKGNWF+QEKSCKIL+ I+  R
Sbjct  61   VLALIYEMLLANPTRARLFHDKSLAHEDTYEPFLRLLWKGNWFIQEKSCKILAWIIRAR  119



>ref|XP_002325805.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
 gb|EEF00187.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
Length=447

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 5/134 (4%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            + AELTT QVL RDIPWETYM TKLI+GT LQLLRRYD + ESY+ QLLDDDGPAY++VF
Sbjct  2    EQAELTTVQVLKRDIPWETYMVTKLISGTDLQLLRRYDNRPESYRAQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+IL DI KEET+EYVLALIDEMLT NPKRARLFHDKSLA++ +YEPFL      NWF+Q
Sbjct  62   VTILIDIFKEETVEYVLALIDEMLTANPKRARLFHDKSLANDGSYEPFL-----SNWFIQ  116

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+LIVS R
Sbjct  117  EKSCKILALIVSAR  130



>ref|XP_004957961.1| PREDICTED: probable V-type proton ATPase subunit H-like [Setaria 
italica]
Length=452

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++DGPAY+RVF
Sbjct  2    DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++IL  I KEET+EYVLALIDEML  NPKRA LF+D+SL+ ED YEPFLRLLWKGNWFVQ
Sbjct  62   LNILGSISKEETVEYVLALIDEMLATNPKRAALFYDQSLSGEDIYEPFLRLLWKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ I+S R
Sbjct  122  EKSCKILTDIISAR  135



>emb|CDX76266.1| BnaA08g11340D [Brassica napus]
Length=468

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  115  IFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGP  294
            I T   D  EL+T+QVL R+IPWETYM TKLI+ T LQLLR YDKK E+ + QLLD+DGP
Sbjct  35   IRTSYMDQGELSTKQVLQREIPWETYMVTKLISATDLQLLRHYDKKPENTRAQLLDEDGP  94

Query  295  AYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWK  474
            AY+++FV+ILRDI KEET+EYVLAL+ EML+ NP RARLFHD+SLA EDTYEPFLRLL K
Sbjct  95   AYVQLFVTILRDIFKEETVEYVLALVYEMLSANPTRARLFHDQSLAHEDTYEPFLRLLLK  154

Query  475  GNWFVQEKSCKILSLIVSVR  534
            GNWF+QEKSCKIL  I+S R
Sbjct  155  GNWFIQEKSCKILGWIISYR  174



>gb|ABF47538.1| At3g42050-L [Arabidopsis lyrata subsp. petraea]
Length=149

 Score =   200 bits (509),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +1

Query  178  PWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEY  357
            PWETYMTTKLI+ TGLQLLRRYDKK ES + QLL +DGPAY+ +FVSILRDI KEET+EY
Sbjct  1    PWETYMTTKLISATGLQLLRRYDKKPESARAQLLVEDGPAYVHLFVSILRDIFKEETVEY  60

Query  358  VLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            VLALI EML+ NP RARLFHDKSLA EDTYE FLRLLWKGNWF+QEKSCKIL+ I+S R
Sbjct  61   VLALIYEMLSENPTRARLFHDKSLAHEDTYELFLRLLWKGNWFIQEKSCKILAWIISAR  119



>gb|ABG75917.1| vacuolar proton ATPase subunit H [Triticum aestivum]
Length=452

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLIT T LQLLRRYD K ES +  LLD+DGP+Y+RVF
Sbjct  2    DRAELTTEQVLKRDIPWETYMSTKLITSTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR I KEET+EYVLALIDEML  NPKRA LF+D SL+ ED Y+PFLRLL KGNWFVQ
Sbjct  62   LNILRSISKEETVEYVLALIDEMLAANPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ ++S R
Sbjct  122  EKSCKILTHLISAR  135



>dbj|BAJ84958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLIT T LQLLRRYD K ES +  LLD+DGP+Y+ VF
Sbjct  2    DRAELTTEQVLKRDIPWETYMSTKLITSTCLQLLRRYDHKPESQRGPLLDEDGPSYVHVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR I KEET+EYVLALIDEML  NPKRA LF+DKSL+ ED Y+PFLRLL KGNWFVQ
Sbjct  62   LNILRSISKEETVEYVLALIDEMLAANPKRAALFYDKSLSGEDIYDPFLRLLLKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ ++S R
Sbjct  122  EKSCKILTHLISAR  135



>ref|XP_010237225.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
 ref|XP_010237228.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
Length=452

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLI+ T LQLLRRYD K ES +  LLD+DGP+Y+R+F
Sbjct  2    DRAELTTEQVLKRDIPWETYMSTKLISSTCLQLLRRYDHKPESERGPLLDEDGPSYVRIF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILR I KEET+EYVLALIDEML VNPKRA LF+D+SL+ ED Y+PFLRLL KGNWFVQ
Sbjct  62   LNILRSISKEETVEYVLALIDEMLAVNPKRAALFYDESLSGEDIYDPFLRLLLKGNWFVQ  121

Query  493  EKSCKILSLIVSVR  534
            EKSCKIL+ ++S R
Sbjct  122  EKSCKILTHLISAR  135



>gb|ABF47537.1| At3g42050-L [Arabidopsis lyrata subsp. petraea]
Length=149

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  178  PWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEY  357
            PWETYMTTKLI+ TGLQ LRRYDKK ES + QLLD+DGPAY+ +FV ILRDI KEET+EY
Sbjct  1    PWETYMTTKLISATGLQHLRRYDKKPESARAQLLDEDGPAYVHLFVIILRDIFKEETVEY  60

Query  358  VLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            VLALI EML  NP RARLFHDKSL  EDTYEPFLRLLWKGNWF+QEKSCKIL+ I+S R
Sbjct  61   VLALIYEMLLENPTRARLFHDKSLPHEDTYEPFLRLLWKGNWFIQEKSCKILAWIISAR  119



>ref|XP_008791825.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Phoenix dactylifera]
Length=431

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +1

Query  193  MTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALI  372
            M+TKLITGT LQLLRRYDK+ ES +  LLDDDGPAY+RVF++ILRDI KEET+EYVLAL+
Sbjct  1    MSTKLITGTCLQLLRRYDKRPESQRAALLDDDGPAYVRVFMNILRDISKEETIEYVLALL  60

Query  373  DEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            DEMLT NPKRARLFHDKSLA+EDTY+PFLRLLWKGNWF+QEKSCKILSLIVSVR
Sbjct  61   DEMLTANPKRARLFHDKSLANEDTYDPFLRLLWKGNWFIQEKSCKILSLIVSVR  114



>ref|XP_010912758.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Elaeis guineensis]
Length=431

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +1

Query  193  MTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALI  372
            MTTKLITGT LQLLRRYDK++ES +  LLDDDGPAY+RVF++ILRDI KEET+EYVLALI
Sbjct  1    MTTKLITGTCLQLLRRYDKRSESQRAALLDDDGPAYVRVFMNILRDISKEETVEYVLALI  60

Query  373  DEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            +EMLT NPKRARLFHDKSLA+EDTYEPFLRLLW GNWF+QEKSCKILSLIVSVR
Sbjct  61   EEMLTANPKRARLFHDKSLANEDTYEPFLRLLWIGNWFIQEKSCKILSLIVSVR  114



>ref|XP_001756205.1| predicted protein [Physcomitrella patens]
 gb|EDQ79071.1| predicted protein [Physcomitrella patens]
Length=448

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  142  ELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSI  321
            ELT E+VL RDIPWETYMT KLI  TGLQLLRRYD + ++ +  LLD++G AY++VFV I
Sbjct  4    ELTREEVLKRDIPWETYMTAKLINSTGLQLLRRYDHRPDNVQAALLDENGVAYVKVFVGI  63

Query  322  LRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEK  498
            LRDI K+ET+EY+LA++DEMLT NP RARLFHDKS  D ED Y PF+RLL K NWF+QEK
Sbjct  64   LRDISKQETVEYMLAMVDEMLTANPTRARLFHDKSFQDNEDVYRPFVRLLSKKNWFIQEK  123

Query  499  SCKILSLIVSVR  534
            SCKIL+LI+S R
Sbjct  124  SCKILTLIISAR  135



>gb|AFK35511.1| unknown [Lotus japonicus]
Length=429

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  193  MTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALI  372
            M+TKLI+GT LQLLRRYD ++ES K QLLDDDGPAY+ VFV +LRDI KEET+EYVLALI
Sbjct  1    MSTKLISGTSLQLLRRYDHRSESQKAQLLDDDGPAYVGVFVRVLRDIFKEETVEYVLALI  60

Query  373  DEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            DE+L  NPKRARLFHD +LADEDTYEPFLRLL KGNWF+QEKSCKIL LI S R
Sbjct  61   DELLAANPKRARLFHDTTLADEDTYEPFLRLLQKGNWFIQEKSCKILGLIASAR  114



>gb|KHN44512.1| V-type proton ATPase subunit H [Glycine soja]
Length=428

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +1

Query  193  MTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALI  372
            M+TKLI+GT LQLLRRYD + ES++ QLLDDDGP+Y+RVFV +LRDI KE+T+EYVLALI
Sbjct  1    MSTKLISGTSLQLLRRYDHRPESHRAQLLDDDGPSYVRVFVRVLRDIFKEDTVEYVLALI  60

Query  373  DEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIVSVR  534
            DEML  NPKRARLFHD +LADEDTYEP   LLWKGNWF+QEKSCKIL+LIVSVR
Sbjct  61   DEMLAANPKRARLFHDSALADEDTYEP---LLWKGNWFIQEKSCKILALIVSVR  111



>ref|XP_001761877.1| predicted protein [Physcomitrella patens]
 gb|EDQ73318.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 3/139 (2%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            M TD  ELT E+VL RDIPWE YMT KLI  TGLQLLRRYD + ES +  LL+++G AY+
Sbjct  1    MTTD-TELTREEVLKRDIPWEMYMTAKLINSTGLQLLRRYDHRPESVQAALLEENGVAYV  59

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADE--DTYEPFLRLLWKG  477
            RVFV IL DI K+ET+EYVLA++DEMLT NPKRARLF DKS  D+  D Y PF+RLL K 
Sbjct  60   RVFVGILADISKQETIEYVLAMVDEMLTANPKRARLFLDKSFQDKDIDVYRPFIRLLSKK  119

Query  478  NWFVQEKSCKILSLIVSVR  534
            NWF+QEKSCKIL+LI+S R
Sbjct  120  NWFIQEKSCKILTLIISAR  138



>ref|XP_009415033.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D A++TTE+VL RDIPWETYM+ KLIT T LQLLRRYDKK+ S +  LLD+DGPA+++VF
Sbjct  2    DRADVTTEEVLKRDIPWETYMSAKLITETHLQLLRRYDKKSASQRAALLDEDGPAFVQVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++IL D+ KEET+EYVLALIDEML  N K+ARLFHD SL+ EDTY+PFLR L +GN F+Q
Sbjct  62   MNILSDVSKEETVEYVLALIDEMLAANLKQARLFHDNSLSSEDTYQPFLRWLQEGNLFIQ  121

Query  493  EKSCKILSLIVSVR  534
            +KS KIL+LIVS  
Sbjct  122  DKSSKILTLIVSAH  135



>gb|KHN00570.1| Protein DA1-related 1 [Glycine soja]
Length=1212

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 2/120 (2%)
 Frame = +1

Query  106  LRPIFTMPTD--HAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLL  279
            LRP+   PT    AELT+EQVL RDIPWETYM+TKLI+GT LQLLRRYD + ES++ QLL
Sbjct  581  LRPVLGFPTAMYQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRAQLL  640

Query  280  DDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL  459
            DDDGP+Y+RVFV +LRDI KE+T+EYVLALIDEML  NPKRARLFHD +LADEDTYEPFL
Sbjct  641  DDDGPSYVRVFVRVLRDIFKEDTVEYVLALIDEMLAANPKRARLFHDSALADEDTYEPFL  700


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  463  LLWKGNWFVQEKSCKILSLIVSVR  534
            LLWKGNWF+QEKSCKIL+L+VSVR
Sbjct  872  LLWKGNWFIQEKSCKILALVVSVR  895



>emb|CDY57740.1| BnaC03g77060D [Brassica napus]
Length=459

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 111/142 (78%), Gaps = 9/142 (6%)
 Frame = +1

Query  115  IFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGP  294
            I T   D AEL+TEQVL RDIPWETYMTTKLI+ T LQLLRRYDKK ES + QLLD+  P
Sbjct  31   IRTSSMDQAELSTEQVLQRDIPWETYMTTKLISATDLQLLRRYDKKTESARAQLLDEPQP  90

Query  295  -AYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLW  471
              Y+++FV+ILRDI KEET+EYVLALI EML+ NP RARLFHD+SLA EDTYEPFLRLL 
Sbjct  91   QTYVQLFVTILRDIFKEETVEYVLALIYEMLSANPARARLFHDQSLAHEDTYEPFLRLLS  150

Query  472  KGNWFVQEKSC-KILSLIVSVR  534
            KGN       C KIL+ I+S R
Sbjct  151  KGN-------CRKILAWIISYR  165



>ref|XP_002520072.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
 gb|EEF42396.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
Length=446

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 106/138 (77%), Gaps = 14/138 (10%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM TKLI+GT LQLLRRYD ++ES + QLLDDDGPAY+RVF
Sbjct  2    DQAELTTEQVLKRDIPWETYMMTKLISGTDLQLLRRYDNRSESQRAQLLDDDGPAYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL----RLLWKGN  480
            V+ILRDI K+ET+EYVLALIDEML V   + R             +P +    RLLWKGN
Sbjct  62   VNILRDIFKDETVEYVLALIDEMLAVCFIKTRKLK----------QPIIWSTSRLLWKGN  111

Query  481  WFVQEKSCKILSLIVSVR  534
            W++QEKSCKIL+LI+S R
Sbjct  112  WYIQEKSCKILALIISDR  129



>ref|NP_001175249.1| Os07g0549700 [Oryza sativa Japonica Group]
 dbj|BAH93977.1| Os07g0549700 [Oryza sativa Japonica Group]
Length=113

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            DHAELTTEQVL RDIPWE+YM  KLI+GT LQLLRRYD K ES +  LLD+DGP+Y+RVF
Sbjct  2    DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR  462
            ++ILR+I KE+T+EYVLALIDEML VNPKRA LF+D SL+ ED Y+PFL 
Sbjct  62   LNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLN  111



>gb|KDO49207.1| hypothetical protein CISIN_1g0474482mg, partial [Citrus sinensis]
Length=183

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 5/101 (5%)
 Frame = +1

Query  223  LQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKR  402
            LQLLRRYD ++ES++ QLLDDDGP+Y+RVFVSILRDI KEET+EYVLALIDEMLT NPKR
Sbjct  1    LQLLRRYDNRSESHRAQLLDDDGPSYVRVFVSILRDIYKEETVEYVLALIDEMLTANPKR  60

Query  403  ARLFHDKSLADEDTYEPFLRLLWKGNWFVQEKSCKILSLIV  525
            ARLFHDKSLA EDTYEPFL      NWF+QEKSCKIL+ IV
Sbjct  61   ARLFHDKSLASEDTYEPFL-----SNWFIQEKSCKILASIV  96



>gb|EMT32310.1| Putative V-type proton ATPase subunit H [Aegilops tauschii]
Length=436

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AELTTEQVL RDIPWETYM+TKLIT T LQLLRRYD K ES +  LLD+DGP+Y+RVF
Sbjct  2    DRAELTTEQVLKRDIPWETYMSTKLITSTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVF  61

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR  462
            ++ILR I KEET+EYVLALIDEML  NPKRA LF+D SL+ ED Y+PFLR
Sbjct  62   LNILRSISKEETVEYVLALIDEMLAANPKRAALFYDNSLSGEDIYDPFLR  111



>ref|XP_002980222.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
 gb|EFJ18482.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
Length=451

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +1

Query  142  ELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSI  321
            +LT +QVLTRDIPWE Y+  KLI+ T LQLLRRYD K E  +  +L+++G AY+RVF+ +
Sbjct  6    DLTRDQVLTRDIPWENYLNAKLISSTDLQLLRRYDHKPEDAQIAMLEENGVAYVRVFLRL  65

Query  322  LRDILKEETLEYVLALIDEMLTVNP-KRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEK  498
            L +I KEET+EYV+AL+DEML+V+P K A LFHD+  + E+ Y PFL LL + NWF+QEK
Sbjct  66   LDNITKEETVEYVVALVDEMLSVDPIKHAALFHDEEFSPEEIYRPFLSLLSRKNWFLQEK  125

Query  499  SCKILSLIVSVR  534
            +CKIL++++S R
Sbjct  126  ACKILTVLISAR  137



>ref|XP_002963102.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
 gb|EFJ36565.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
Length=451

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +1

Query  142  ELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSI  321
            +LT +QVLTRDIPWE Y+  KLI+ T LQLLRRYD K E  +  +L+++G AY+RVF+ +
Sbjct  6    DLTRDQVLTRDIPWENYLNAKLISSTDLQLLRRYDHKPEDAQIAMLEENGVAYVRVFLRL  65

Query  322  LRDILKEETLEYVLALIDEMLTVNP-KRARLFHDKSLADEDTYEPFLRLLWKGNWFVQEK  498
            L +I KEET+EYV+AL+DEML+V+P K A LFHD+  + E+ Y PFL LL + NWF+QEK
Sbjct  66   LDNITKEETVEYVVALVDEMLSVDPIKHAALFHDEEFSPEEIYRPFLSLLSRKNWFLQEK  125

Query  499  SCKILSLIVSVR  534
            +CKIL++++S R
Sbjct  126  ACKILTVLISAR  137



>gb|EMS54494.1| putative V-type proton ATPase subunit H [Triticum urartu]
Length=450

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  QVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDIL  336
            QVL RDIPWETYM+TKLIT T LQLLRRYD K ES +  LLD+DGP+Y+RVF++ILR I 
Sbjct  24   QVLKRDIPWETYMSTKLITSTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRSIS  83

Query  337  KEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLR  462
            KEET+EYVLALIDEML  NPKRA LF+D SL+DED Y+PFLR
Sbjct  84   KEETVEYVLALIDEMLAANPKRAALFYDNSLSDEDIYDPFLR  125



>gb|ABF47531.1| At3g42050 [Turritis glabra]
Length=88

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  178  PWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEY  357
            PWETYM TKL++  GLQLLRRYDKK+ES + QLLD+DGPAY+ +FVSILRDI KEET+EY
Sbjct  1    PWETYMNTKLVSAKGLQLLRRYDKKSESARAQLLDEDGPAYVHLFVSILRDIFKEETVEY  60

Query  358  VLALIDEMLTVNPKRARLFHDKSLADED  441
            VLALI EML+ NP RARLFHD+SLA ED
Sbjct  61   VLALIYEMLSANPTRARLFHDESLAHED  88



>ref|XP_010912760.1| PREDICTED: probable V-type proton ATPase subunit H isoform X3 
[Elaeis guineensis]
Length=391

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            ++ILRDI KEET+EYVLALI+EMLT NPKRARLFHDKSLA+EDTYEPFLRLLW GNWF+Q
Sbjct  1    MNILRDISKEETVEYVLALIEEMLTANPKRARLFHDKSLANEDTYEPFLRLLWIGNWFIQ  60

Query  493  EKSCKILSLIVSVR  534
            EKSCKILSLIVSVR
Sbjct  61   EKSCKILSLIVSVR  74



>ref|XP_005845340.1| hypothetical protein CHLNCDRAFT_32265 [Chlorella variabilis]
 gb|EFN53238.1| hypothetical protein CHLNCDRAFT_32265 [Chlorella variabilis]
Length=477

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = +1

Query  160  VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILK  339
            VL RDIPW+ Y T +LIT   LQLLRR+DKK  +++ +LL++ GP+Y+  F+++L+++ K
Sbjct  16   VLRRDIPWDIYQTARLITDRDLQLLRRFDKKDAAFQAKLLEESGPSYVEAFLAVLKNVTK  75

Query  340  EETLEYVLALIDEMLTVNPKRARLFHDKSLADE----DTYEPFLRLLWKGNWFVQEKSCK  507
            +ET++YVLA+++EML  +P RA+LFH  S        D Y+  LRLL + +WF QEK+C 
Sbjct  76   DETVQYVLAMVEEMLAEDPARAKLFHVLSSTGPGGPLDAYQILLRLLHRNDWFTQEKACL  135

Query  508  ILSLIVSVR  534
            +L+ +++ R
Sbjct  136  LLTEVLASR  144



>ref|XP_005646211.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
 gb|EIE21667.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
Length=465

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 92/138 (67%), Gaps = 4/138 (3%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            + +ELTT  VL R+I W+TY+T +LIT   LQL+RRYDKK    +  LL ++GPAY   F
Sbjct  7    ESSELTTASVLKRNIAWDTYLTARLITDHDLQLIRRYDKKNPEIQQDLLQEEGPAYAEAF  66

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKS----LADEDTYEPFLRLLWKGN  480
             ++LR + KE+T++YVLA++DEM+  +PKRA  FH +S     +  D Y    R+L + +
Sbjct  67   FNVLRSVTKEDTVQYVLAILDEMVAGDPKRAAYFHQQSNPQKPSPPDPYTQLTRMLQRTD  126

Query  481  WFVQEKSCKILSLIVSVR  534
            WF QEK+  +L+ I++ R
Sbjct  127  WFTQEKAATMLTAILAAR  144



>gb|KIZ02492.1| V-type H+-transporting ATPase 54 kD subunit [Monoraphidium neglectum]
Length=394

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  160  VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILK  339
            +L+RDI WETY+T +LI+   +QLLRRYDK++E  ++ LLD++GP Y+  F+S+LR++ K
Sbjct  25   ILSRDIHWETYLTARLISDRDVQLLRRYDKRSEELQSSLLDENGPMYVDAFLSVLRNVTK  84

Query  340  EETLEYVLALIDEMLTVNPKRARLFHD-KSLADEDTYEPFLRLLWKGNWFVQEKSCKILS  516
            EET++YVLAL+ +ML  NP RA+LFH        D Y  FLRLL + +WF Q+K+C++LS
Sbjct  85   EETVQYVLALLAQMLAANPARAQLFHQLPEGHSADPYTVFLRLLQRQDWFTQDKACRVLS  144

Query  517  LIVSVR  534
             I++ R
Sbjct  145  QIIAAR  150



>gb|KJB26714.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=351

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            D AEL+TEQVL RDIPWETYMTTKLI+GTGLQLLRRYD +AES + QLLDDDGPAY++VF
Sbjct  2    DRAELSTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRAESVRAQLLDDDGPAYVQVF  61

Query  313  VSILRDILKEET  348
            V+ILRDI KEET
Sbjct  62   VNILRDIFKEET  73



>ref|XP_001689562.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
 gb|EDP09300.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
Length=463

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 93/130 (72%), Gaps = 5/130 (4%)
 Frame = +1

Query  160  VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILK  339
            +L R+IPWETY T +L+T   LQL+RRYDK++   K  +LD+ GPAY+  F+++L+++ K
Sbjct  21   ILAREIPWETYATARLVTDKDLQLIRRYDKRSSELKNSMLDESGPAYVEAFMTVLKNVTK  80

Query  340  EETLEYVLALIDEMLTVNPKRARLFH---DKSLADE-DTYEPFLRLLWK-GNWFVQEKSC  504
             ET++YVLA++ +ML  NP RARLFH   D+ L+ + D Y    RLL +  +W+ Q+K+C
Sbjct  81   PETVQYVLAVLIQMLQENPSRARLFHQQSDQHLSSQPDPYTVLERLLQRQDDWWSQDKAC  140

Query  505  KILSLIVSVR  534
            K+L++++  R
Sbjct  141  KLLTIVIESR  150



>ref|XP_002955475.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
 gb|EFJ43546.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
Length=477

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +1

Query  169  RDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEET  348
            RDI W+TY T +LIT   L+L+RRYDK++   K+ +LD+ GPAY+  F+++L+++ + +T
Sbjct  24   RDIQWDTYATARLITDKDLELIRRYDKRSPELKSSMLDESGPAYVEAFMTVLKNVTQPDT  83

Query  349  LEYVLALIDEMLTVNPKRARLFHDKS----LADEDTYEPFLRLLWK-GNWFVQEKSCKIL  513
            ++YVLAL+ +ML  NP RARLFH  S     A  D Y    RLL +  +W+ Q+K+CK+L
Sbjct  84   VQYVLALLIQMLQENPSRARLFHQPSDQHLSAQPDPYTVLERLLQRQDDWWSQDKACKLL  143

Query  514  SLIVSVR  534
            ++ +  R
Sbjct  144  TISIESR  150



>ref|XP_011398291.1| putative V-type proton ATPase subunit H [Auxenochlorella protothecoides]
 gb|KFM25396.1| putative V-type proton ATPase subunit H [Auxenochlorella protothecoides]
Length=471

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 91/136 (67%), Gaps = 8/136 (6%)
 Frame = +1

Query  145  LTTEQVL-TRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLD---DDGPAYIRVF  312
            L T  +L TRDIPW+ YMT +LI+   LQ LRRYDKK  +Y+T+LL    + G  Y   F
Sbjct  14   LNTPTILRTRDIPWDIYMTARLISDRELQFLRRYDKKEPTYQTKLLKEARNGGKLYTNAF  73

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTY-EPF---LRLLWKGN  480
            +++L+++ K+ETL+YVLALID++L V+P    LF      ++  Y EP+   LRLL + +
Sbjct  74   LTVLKNVTKDETLQYVLALIDDLLDVDPSHVALFLPPGAEEDQPYVEPYPILLRLLQRPD  133

Query  481  WFVQEKSCKILSLIVS  528
            WF QEK+ ++L+ I++
Sbjct  134  WFTQEKAARLLTAILA  149



>ref|XP_006855970.1| hypothetical protein AMTR_s00037p00233270 [Amborella trichopoda]
 gb|ERN17437.1| hypothetical protein AMTR_s00037p00233270 [Amborella trichopoda]
Length=78

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  157  QVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDIL  336
            +VLTRDIPWE YM TKLI+G  LQLLRRYD ++ESY+ QLLDDDGPAYIRVFVSI   + 
Sbjct  15   KVLTRDIPWEAYMATKLISGKSLQLLRRYDNRSESYRAQLLDDDGPAYIRVFVSICGTLP  74

Query  337  KEE  345
            + E
Sbjct  75   RTE  77



>gb|KDD73222.1| hypothetical protein H632_c2410p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=113

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = +1

Query  118  FTMPTDHAEL----TTEQVL-TRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLD  282
            FT+P +  E     +T  +L TRDIPW+ YMT +LI+   LQLLRRYD K    + +LL 
Sbjct  4    FTLPEETPESQLGPSTASILRTRDIPWDIYMTARLISDKDLQLLRRYDNKNPGTQARLLA  63

Query  283  DDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKR  402
            ++G A    F+++L+++ K+ET++Y LAL+D+ L+ +P+R
Sbjct  64   ENGAACFATFLTVLKNVTKDETVQYALALLDDALSADPRR  103



>ref|XP_004365301.1| vacuolar proton pump subunit H [Capsaspora owczarzaki ATCC 30864]
 gb|KJE88854.1| vacuolar proton pump subunit H [Capsaspora owczarzaki ATCC 30864]
Length=453

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = +1

Query  124  MPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYI  303
            +P    E    QV  R I W+ +     IT   L ++RRYD K  + + +LL   G  Y 
Sbjct  6    VPLSWLEDAARQVRGRQIAWDGHQRAGFITEEELDMIRRYDNKGAATQNELLATQGQKYG  65

Query  304  RVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT--YEPFLRLLWKG  477
             +F+ +L  I  ++T++Y++ L+D++L+ +  RA+LFH  + A +    Y PFL LL   
Sbjct  66   ALFLHLLGKITADQTVQYLILLVDDLLSESRDRAKLFHACNTASDGVLPYAPFLSLLRSR  125

Query  478  NWFVQEKSCKILSLIVS  528
            + + +  S KILS+++S
Sbjct  126  DAYTRYASNKILSVLLS  142



>tpg|DAA63056.1| TPA: hypothetical protein ZEAMMB73_267119 [Zea mays]
Length=379

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDD  285
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++
Sbjct  2    DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEE  52



>tpg|DAA41086.1| TPA: hypothetical protein ZEAMMB73_371057, partial [Zea mays]
Length=607

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  133  DHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDD  285
            D AELTTEQVL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++
Sbjct  229  DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEE  279



>gb|KIM32034.1| hypothetical protein M408DRAFT_327392 [Serendipita vermifera 
MAFF 305830]
Length=438

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = +1

Query  157  QVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDIL  336
            ++ ++ +PWE Y    LITG  L L++R D++  +    +L  DGP Y  +++++L+ I 
Sbjct  18   KIRSKPVPWEGYQRAGLITGDELALIKRVDRQPRAKIESILVTDGPQYALLYLTLLKKIE  77

Query  337  KEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEKSCKIL  513
            + +T++ +L L+ + L+ + +R  LF D +  D E  Y PFL+ L   + +VQ K+C+I+
Sbjct  78   RVDTMQNILVLMGDALSDHDERIPLFLDTAKIDPELPYTPFLKTLESTDEWVQLKACQIM  137

Query  514  SLIVS  528
            +  +S
Sbjct  138  TTFMS  142



>ref|XP_002500993.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO62251.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=504

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 14/140 (10%)
 Frame = +1

Query  157  QVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDIL  336
            +VL R   W   +T++L+T   LQ ++RY+ + E  +  ++D++G A  R F+++L D+ 
Sbjct  10   EVLERGARWNALLTSRLVTDEDLQAIQRYELRDEDARADMMDEEGDACARAFLNVLGDVS  69

Query  337  KEETLEYVLALIDEMLTVNPKRARLF--------------HDKSLADEDTYEPFLRLLWK  474
            + E ++YVLAL+  ML+ +  RA  F                      + Y  FLRLL  
Sbjct  70   QTEYVQYVLALVARMLSDDKTRAAHFLAVEKKDDDDKGQGGGGGGGGGEAYAVFLRLLAA  129

Query  475  GNWFVQEKSCKILSLIVSVR  534
             +WF +EK+   L+ ++  R
Sbjct  130  PDWFTREKAMFCLTRLIDQR  149



>ref|XP_007267525.1| ATPase, V1 complex, subunit H [Fomitiporia mediterranea MF3/22]
 gb|EJD02109.1| ATPase, V1 complex, subunit H [Fomitiporia mediterranea MF3/22]
Length=437

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 76/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  148  TTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILR  327
            T+ ++ ++ +PWE Y    L+T   L L+++ D++  S    LL  DG  Y R+++ +L+
Sbjct  14   TSAKIRSKPVPWEAYQRAGLVTPDELALIKKVDRQPRSKTESLLQSDGQTYARLYLGLLK  73

Query  328  DILKEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEKSC  504
             + + +T++++L LI + L  + +R +LF   +  D E  Y P LR L   + F+Q K+ 
Sbjct  74   KLNRVDTMQWILVLITDALADHDERIQLFTKAAEKDPELPYGPLLRSLDSQDEFLQLKTA  133

Query  505  KILSLIVS  528
            +IL++++S
Sbjct  134  QILTVLLS  141



>gb|EJT97397.1| ATPase V1 complex subunit H [Dacryopinax sp. DJM-731 SS1]
Length=434

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  142  ELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSI  321
            E ++ +V ++ IPWE Y    LIT   L  +++ D++  S    +L ++G  Y  +++S+
Sbjct  10   EESSSKVRSKPIPWEGYQRAGLITPAELAAIKKVDRQPRSRIESILVNEGAQYAALYLSL  69

Query  322  LRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEK  498
            L+ +++ + L+Y+L LI + L  + +R  L+   +  D E  Y P LR L   + FVQ K
Sbjct  70   LKKLVRVDVLQYILVLIGDSLIDHEERIGLYTGAAHDDPELPYGPLLRSLDTPDEFVQLK  129

Query  499  SCKILSLI  522
            +C++LS++
Sbjct  130  ACQVLSIL  137



>emb|CEJ00193.1| hypothetical protein RMCBS344292_14258 [Rhizopus microsporus]
Length=446

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = +1

Query  112  PIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDG  291
            P+  +   + E   + V  R I WE Y    L++   + L++  DKK+ +    +L+D G
Sbjct  9    PLVFISNAYLEKKAQSVEQRSILWEGYQRASLVSQEEVDLIKAIDKKSATEIQNVLNDKG  68

Query  292  P-AYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADED-TYEPFLRL  465
               Y+ +   +L+++ + +T++YV    DE+L+ N   A+ FH+ +  D    +EPFL+L
Sbjct  69   AETYVSLIFYLLKNLSRPDTIQYVCLKTDEILSANETNAQHFHNAASKDSSLPFEPFLKL  128

Query  466  LWKGNWFVQEKSCKILSLIV  525
            L   + F+  ++ K+L+L+ 
Sbjct  129  LDNEDEFIALEASKVLTLLA  148



>emb|CEI94961.1| hypothetical protein RMCBS344292_09162 [Rhizopus microsporus]
Length=446

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = +1

Query  112  PIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDG  291
            P+  +   + E   + V  R I WE Y    L++   + L++  +KK+ +    +L+D G
Sbjct  9    PLVFISNAYLEKKAQSVEQRSILWEGYQRASLVSQEEVDLIKAIEKKSATEIQNVLNDKG  68

Query  292  -PAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADED-TYEPFLRL  465
              AY+ +   +L+++ + +T++YV    DE+L+ N   A+ FH+ +  D    +EPFL+L
Sbjct  69   VEAYVSLIFYLLKNLSRPDTIQYVCLKTDEILSANETNAQHFHNAASKDSSLPFEPFLKL  128

Query  466  LWKGNWFVQEKSCKILSLIV  525
            L   + F+  ++ K+L+L+ 
Sbjct  129  LDNEDEFIALEASKVLTLLA  148



>ref|XP_009510674.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Phalacrocorax 
carbo]
Length=182

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_010203038.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Colius 
striatus]
Length=193

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_007863478.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58239.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
Length=437

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 73/128 (57%), Gaps = 1/128 (1%)
 Frame = +1

Query  151  TEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRD  330
            T ++ ++ +PWE Y    L+T   L L+++ D++  +    +L  DGP Y  +++ +L+ 
Sbjct  15   TAKIRSKPVPWEGYQRAGLVTPEELVLIKKVDRQPRAKAESILLSDGPTYASLYLGLLKK  74

Query  331  ILKEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEKSCK  507
            + + +T++ +L LI + L  + +R  LF      D E  Y P LR+L   + FVQ K+ +
Sbjct  75   LQRPDTMQCILILIGDALADHDERIPLFTRAGETDTELPYGPLLRILNTPDDFVQLKTAQ  134

Query  508  ILSLIVSV  531
            IL++++S 
Sbjct  135  ILAVLLSA  142



>gb|ESA21230.1| hypothetical protein GLOINDRAFT_343254 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71256.1| Vma13p [Rhizophagus irregularis DAOM 197198w]
Length=446

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 78/147 (53%), Gaps = 1/147 (1%)
 Frame = +1

Query  88   IDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYK  267
            ID  +   P+  +   + +  T  + +R IPW+ Y T  LIT   L LL++ DK++    
Sbjct  5    IDETVPDVPLAFVSNSYLDELTSGIRSRPIPWDGYKTADLITKDELDLLKKVDKQSPEQL  64

Query  268  TQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDT  444
              +L  +   Y  ++ ++L  + + +T++Y+L L+++ML+ N +R   FH  S  D E  
Sbjct  65   RIVLQREEEKYTELYANLLEKLNRVDTVQYILVLVNDMLSDNEQRVTFFHKLSEKDVELP  124

Query  445  YEPFLRLLWKGNWFVQEKSCKILSLIV  525
            Y  FL L    + FV   S KIL+L++
Sbjct  125  YRIFLNLFKVEDEFVPLMSSKILTLLI  151



>emb|CCA75096.1| related to vacuolar ATP synthase subunit H [Piriformospora indica 
DSM 11827]
Length=438

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +1

Query  157  QVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDIL  336
            ++ ++ +PWE Y   +LIT   L L++R D++  +    +L  DGP Y  +++++L+ I 
Sbjct  18   KIRSKPVPWEGYQRAELITSDELTLIKRVDRQPRAKIESILVTDGPQYALLYLTLLKKIE  77

Query  337  KEETLEYVLALIDEMLTVNPKRARLF-HDKSLADEDTYEPFLRLLWKGNWFVQEKSCKIL  513
            + +T++ +L LI + L  + +R  LF   K +  E  Y PFL+     + +VQ K+C+I+
Sbjct  78   RVDTMQNILVLIGDSLLDHDERIPLFLATKKIDTELPYTPFLKTFESSDEWVQLKACQIV  137

Query  514  SLIVSV  531
            + ++S 
Sbjct  138  TTLMSA  143



>ref|XP_005301264.1| PREDICTED: V-type proton ATPase subunit H [Chrysemys picta bellii]
 ref|XP_005301265.1| PREDICTED: V-type proton ATPase subunit H [Chrysemys picta bellii]
Length=480

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R++ K++   K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRSPEEKQELLQAEGSQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L +ID+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMIDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_009078245.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Acanthisitta 
chloris]
Length=480

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++RY++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRYEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFP72436.1| V-type proton ATPase subunit H, partial [Acanthisitta chloris]
Length=476

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++RY++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRYEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_009078254.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Acanthisitta 
chloris]
Length=462

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++RY++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRYEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_783560.3| PREDICTED: V-type proton ATPase subunit H isoform 3 [Strongylocentrotus 
purpuratus]
 ref|XP_003730078.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Strongylocentrotus 
purpuratus]
 ref|XP_003730079.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Strongylocentrotus 
purpuratus]
Length=475

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 81/167 (49%), Gaps = 2/167 (1%)
 Frame = +1

Query  31   VPPLLRPPYISFSPSALRSIDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLI  210
            +P  +   Y   SP   ++   G+   P    P +  E    +V    + W++Y+  ++I
Sbjct  1    MPQNMTSLYTQLSPDGPKA-GGGLVGGPADLPPLNLFEREANEVRNHRVNWQSYLQGQMI  59

Query  211  TGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTV  390
            +      ++ YD      + QL+   GP   +  V ++  I KE T+ Y+L L+D+ML  
Sbjct  60   SQEDFAFIKDYDLAGPERRDQLIQALGPLCAKTLVRLMGRIAKEMTVRYILTLVDDMLKE  119

Query  391  NPKRARLFHDKSLADEDT-YEPFLRLLWKGNWFVQEKSCKILSLIVS  528
             P+R  +F ++    + + + PFL LL + + F   +SC+I++ + +
Sbjct  120  KPERVTVFAEQGRKSKTSPWVPFLTLLNREDQFATTQSCRIVAKLAT  166



>ref|XP_006112246.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pelodiscus 
sinensis]
Length=462

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R++ K++   K ++L  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRSPEEKQEMLQTEGSQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L +ID+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMIDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDHFTVHMAARIIAKLAA  147



>ref|XP_003759824.1| PREDICTED: V-type proton ATPase subunit H [Sarcophilus harrisii]
Length=483

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R++ K++   K ++L ++G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEMKRSPEEKQEMLQNEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L L+D+ML  N +R  +F D +   + T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTLVDDMLQENHQRVSIFFDYAKRSKTTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|EDM11582.1| vacuolar ATPase subunit H, isoform CRA_b [Rattus norvegicus]
Length=197

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 76/138 (55%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K+    K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRCSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_006112245.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pelodiscus 
sinensis]
Length=480

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R++ K++   K ++L  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRSPEEKQEMLQTEGSQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L +ID+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMIDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDHFTVHMAARIIAKLAA  147



>ref|NP_998784.1| V-type proton ATPase subunit H isoform 2 [Homo sapiens]
 ref|XP_003256005.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Nomascus 
leucogenys]
 ref|XP_003823297.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pan paniscus]
 ref|XP_004047055.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_006716518.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Homo sapiens]
 ref|XP_008975100.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pan paniscus]
 gb|AAG39293.1|AF113222_1 MSTP042 [Homo sapiens]
 gb|EAW86728.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform 
CRA_b [Homo sapiens]
 gb|EAW86729.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform 
CRA_b [Homo sapiens]
Length=465

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_007396061.1| hypothetical protein PHACADRAFT_121574 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55742.1| hypothetical protein PHACADRAFT_121574 [Phanerochaete carnosa 
HHB-10118-sp]
Length=436

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 71/129 (55%), Gaps = 1/129 (1%)
 Frame = +1

Query  148  TTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILR  327
             + ++  + +PWE Y    LIT   L LL++ D++  +    L   DG AY  +++ +L+
Sbjct  14   NSNKIRAKPVPWEGYQRANLITAEELALLKKVDRQPRAKVESLYLSDGQAYAILYLRLLK  73

Query  328  DILKEETLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEKSC  504
             + + +T   +L LI + L+ + +R  LF   S  D E  Y P LR+L   + FVQ K+ 
Sbjct  74   KLQRVDTQSNILVLIADALSDHEERIALFARASETDAESPYTPLLRMLESQDDFVQLKAT  133

Query  505  KILSLIVSV  531
            +IL++++S 
Sbjct  134  QILTVLLSA  142



>ref|NP_998785.1| V-type proton ATPase subunit H isoform 1 [Homo sapiens]
 ref|NP_057025.2| V-type proton ATPase subunit H isoform 1 [Homo sapiens]
 ref|XP_003256004.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Nomascus 
leucogenys]
 ref|XP_003256006.1| PREDICTED: V-type proton ATPase subunit H isoform 3 [Nomascus 
leucogenys]
 ref|XP_003823296.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pan paniscus]
 ref|XP_003823298.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pan paniscus]
 ref|XP_004047054.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004047056.1| PREDICTED: V-type proton ATPase subunit H isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_009242082.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pongo abelii]
 sp|Q9UI12.1|VATH_HUMAN RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Nef-binding protein 1; Short=NBP1; 
AltName: Full=Protein VMA13 homolog; AltName: Full=V-ATPase 
50/57 kDa subunits; AltName: Full=Vacuolar proton pump subunit 
H; AltName: Full=Vacuolar proton pump subunit SFD [Homo sapiens]
 gb|AAF17192.1|AF112204_1 Vacuolar proton pump subunit SFD alpha isoform [Homo sapiens]
 gb|AAG22809.1| vacuolar ATPase subunit H [Homo sapiens]
 gb|AAH25275.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H [Homo 
sapiens]
 gb|EAW86727.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform 
CRA_a [Homo sapiens]
 gb|EAW86731.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform 
CRA_a [Homo sapiens]
 gb|EAW86732.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform 
CRA_a [Homo sapiens]
 gb|EAW86733.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform 
CRA_a [Homo sapiens]
 dbj|BAG51072.1| unnamed protein product [Homo sapiens]
 gb|AIC51534.1| ATP6V1H, partial [synthetic construct]
Length=483

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>dbj|BAG53609.1| unnamed protein product [Homo sapiens]
Length=483

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>gb|KFP03790.1| V-type proton ATPase subunit H, partial [Calypte anna]
Length=426

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L +ID+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMIDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_005152605.1| PREDICTED: V-type proton ATPase subunit H [Melopsittacus undulatus]
Length=480

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R++ K++   K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRSPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_008495780.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Calypte 
anna]
Length=480

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L +ID+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMIDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|NP_001126091.1| V-type proton ATPase subunit H [Pongo abelii]
 emb|CAH91883.1| hypothetical protein [Pongo abelii]
Length=465

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVDWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>gb|AAD27720.1|AF132945_1 CGI-11 protein [Homo sapiens]
Length=483

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPILNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_008495781.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Calypte 
anna]
Length=462

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L +ID+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMIDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>emb|CBQ69911.1| related to vacuolar ATP synthase subunit H [Sporisorium reilianum 
SRZ2]
Length=587

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/134 (31%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = +1

Query  151  TEQVLTRDIPWETYMTTKLITGTGLQLLRRYDK----KAESYKTQLLDDDGPAYIRVFVS  318
            T+++  R IPWE Y    L++   L++++  D     +  S    LLD+ GP Y+ +++ 
Sbjct  36   TQRIRARPIPWEGYHRADLLSADELKMIKSVDAIVIGQNRSKLDPLLDEHGPDYVSLYLR  95

Query  319  ILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-----YEPFLRLLWKGNW  483
            +L  + + +TL+ +L LID+ML+    R  LF      +E       ++PF++LL   + 
Sbjct  96   LLSKLSRTDTLQQILVLIDDMLSDRDDRLELFLSLDGQEEQDGIGFPWKPFVKLLDVPDD  155

Query  484  FVQEKSCKILSLIV  525
            FVQ KS + L+L++
Sbjct  156  FVQMKSAQFLTLLL  169



>ref|NP_001089309.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H [Xenopus 
laevis]
 gb|AAH91718.1| MGC85130 protein [Xenopus laevis]
Length=479

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 76/137 (55%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAY  300
             +PT+       +V    + W++Y+  ++I+G   + ++R++K     K  +L  +G   
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEKSLPDDKQVILTKEGNQC  69

Query  301  IRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWKG  477
             + F++++  I KE+T++Y+L L+D+ML  N +R  +F D +   ++T +  FL +L + 
Sbjct  70   AKTFINLMTHISKEQTVQYILTLVDDMLQENHQRVSIFFDYARRGKNTAWSYFLPMLNRQ  129

Query  478  NWFVQEKSCKILSLIVS  528
            + F    + +I++ + +
Sbjct  130  DLFTVHMAARIIAKLAA  146



>gb|KFO84025.1| V-type proton ATPase subunit H, partial [Buceros rhinoceros silvestris]
Length=425

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  12   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  71

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  72   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  131

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  132  QDLFTVHMAARIIAKLAA  149



>gb|KFQ23695.1| V-type proton ATPase subunit H, partial [Mesitornis unicolor]
Length=426

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_009870253.1| PREDICTED: V-type proton ATPase subunit H, partial [Apaloderma 
vittatum]
Length=346

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFP72776.1| V-type proton ATPase subunit H, partial [Apaloderma vittatum]
Length=347

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  11   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  70

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  71   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  130

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  131  QDLFTVHMAARIIAKLAA  148



>ref|XP_007428279.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Python 
bivittatus]
 ref|XP_007428280.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Python 
bivittatus]
 ref|XP_007428281.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Python 
bivittatus]
Length=476

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W+ Y+   +I+G   + ++R++ K++   K +L+  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQLYLQGLMISGEDCEFIQRFEQKRSPEEKQELIQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F+S++  I KE+T++Y+L +ID+ML  N +R  +F D +  D++T +  FL +L +
Sbjct  70   CAKTFISLMTHISKEQTVQYILTMIDDMLQENHQRVCIFFDYAKRDKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_003291419.1| hypothetical protein DICPUDRAFT_156018 [Dictyostelium purpureum]
 gb|EGC32065.1| hypothetical protein DICPUDRAFT_156018 [Dictyostelium purpureum]
Length=446

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 68/131 (52%), Gaps = 2/131 (2%)
 Frame = +1

Query  139  AELTTEQ--VLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVF  312
            AE T  Q  VL R+IPW  + ++  IT +   L+ +YDK +++ K +    +   Y+  F
Sbjct  15   AESTFRQKVVLAREIPWNGFASSNSITASEYDLISKYDKHSDNEKKEKFIGNSQKYVSFF  74

Query  313  VSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFLRLLWKGNWFVQ  492
            V+ +      E ++Y+L LI+E++ ++P+ A  F   S      Y  F RLL + + ++ 
Sbjct  75   VNFIHSTSNSEIIQYLLTLINEIIEIDPRAASAFSRGSTDPTYPYSVFFRLLSRDDAYIN  134

Query  493  EKSCKILSLIV  525
              +   L+ I+
Sbjct  135  LHASIALAQIM  145



>ref|XP_010141561.1| PREDICTED: V-type proton ATPase subunit H, partial [Buceros rhinoceros 
silvestris]
Length=460

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_010185105.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mesitornis 
unicolor]
Length=480

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|NP_001184255.1| V-type proton ATPase subunit H [Gallus gallus]
 ref|XP_008938693.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Merops 
nubicus]
 ref|XP_009887484.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Charadrius 
vociferus]
Length=480

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KGL96621.1| V-type proton ATPase subunit H, partial [Charadrius vociferus]
Length=476

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFQ29813.1| V-type proton ATPase subunit H, partial [Merops nubicus]
Length=477

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_002197593.1| PREDICTED: V-type proton ATPase subunit H [Taeniopygia guttata]
Length=480

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>dbj|BAE30587.1| unnamed protein product [Mus musculus]
Length=132

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEDKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL  459
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P+ 
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYF  126



>ref|XP_010185106.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mesitornis 
unicolor]
Length=462

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_008938694.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Merops 
nubicus]
 ref|XP_009887485.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Charadrius 
vociferus]
Length=462

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|ACQ57864.1| Vacuolar proton pump subunit H [Anoplopoma fimbria]
Length=148

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/145 (23%), Positives = 77/145 (53%), Gaps = 9/145 (6%)
 Frame = +1

Query  82   RSIDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAES  261
            R++D+ +        PT+       +V    + W++Y+ +++I+    + +++++     
Sbjct  5    RAVDAAV--------PTNIIAAKAAEVRANQVNWQSYLQSQMISAEDCEFIKKFEVANSE  56

Query  262  YKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADED  441
             K  +L ++G    + F+S++  I KE+T++Y+L LID+ L  N +R  +F D +   ++
Sbjct  57   EKQVILTNEGHQCAKTFLSLMAHISKEQTVQYILTLIDDTLQENHQRVSIFFDYAKKTKN  116

Query  442  T-YEPFLRLLWKGNWFVQEKSCKIL  513
            T +  FL +L + + F    + +I+
Sbjct  117  TAWSYFLPMLNRQDLFTVHMAARII  141



>gb|ETE73254.1| V-type proton ATPase subunit H [Ophiophagus hannah]
Length=476

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W+ Y+   +I+G   + ++R++ K+    K +L+  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQLYLQGLMISGEDCEFIQRFEQKRTPEEKQELIQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F+S++  I KE+T++Y+L ++D+ML  N +R  +F D +  D++T +  FL +L +
Sbjct  70   CAKTFISLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKKDKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFP46271.1| V-type proton ATPase subunit H, partial [Cathartes aura]
Length=392

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFV18096.1| V-type proton ATPase subunit H, partial [Tauraco erythrolophus]
Length=426

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQAEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFW04373.1| V-type proton ATPase subunit H, partial [Fulmarus glacialis]
Length=426

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_011357460.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Pteropus 
vampyrus]
Length=449

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L ++G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQNEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_004580845.1| PREDICTED: V-type proton ATPase subunit H [Ochotona princeps]
Length=510

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIVAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>gb|KFP17284.1| V-type proton ATPase subunit H, partial [Egretta garzetta]
Length=476

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNLEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFO55130.1| V-type proton ATPase subunit H, partial [Corvus brachyrhynchos]
Length=483

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_009671845.1| PREDICTED: V-type proton ATPase subunit H [Struthio camelus australis]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQAEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_009575443.1| PREDICTED: V-type proton ATPase subunit H, partial [Fulmarus 
glacialis]
Length=460

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_006924026.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
alecto]
 ref|XP_011357458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
vampyrus]
 ref|XP_011357459.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
vampyrus]
Length=465

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L ++G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQNEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_009925475.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Haliaeetus 
albicilla]
 ref|XP_010581257.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Haliaeetus 
leucocephalus]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_009568732.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cuculus 
canorus]
Length=479

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_006924025.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
alecto]
 ref|XP_011357456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
vampyrus]
 ref|XP_011357457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
vampyrus]
Length=483

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L ++G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQNEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_010707226.1| PREDICTED: V-type proton ATPase subunit H [Meleagris gallopavo]
 ref|XP_010707227.1| PREDICTED: V-type proton ATPase subunit H [Meleagris gallopavo]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|ELK02307.1| V-type proton ATPase subunit H [Pteropus alecto]
Length=443

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L ++G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQNEGSQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_009984629.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Tauraco 
erythrolophus]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQAEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|AFM90690.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Callorhinchus 
milii]
Length=482

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 75/137 (55%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAY  300
             +PT+       +V    + W++Y+  ++I+    + +++++      K  +LD++G  Y
Sbjct  15   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISHEDCEFIKKFEAARSDDKQTILDEEGHQY  74

Query  301  IRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWKG  477
             + F++++  I KE+T++Y+L +ID+ML  N +R   F D +   + T +  FL +L + 
Sbjct  75   AKTFLNLMAHISKEQTVQYILTMIDDMLQENHQRVNTFFDYAKKTKSTAWSYFLPMLNRQ  134

Query  478  NWFVQEKSCKILSLIVS  528
            + F    + +I++ + +
Sbjct  135  DLFTVHMAARIIAKLAA  151



>ref|XP_009638644.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Egretta 
garzetta]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNLEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_005240812.1| PREDICTED: V-type proton ATPase subunit H [Falco peregrinus]
 ref|XP_005443290.1| PREDICTED: V-type proton ATPase subunit H [Falco cherrug]
 ref|XP_010005108.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Chaetura 
pelagica]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_005418370.1| PREDICTED: V-type proton ATPase subunit H [Geospiza fortis]
 ref|XP_009083520.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Serinus 
canaria]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_005042123.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ficedula 
albicollis]
 ref|XP_005042124.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ficedula 
albicollis]
 ref|XP_005517222.1| PREDICTED: V-type proton ATPase subunit H [Pseudopodoces humilis]
Length=480

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_005479350.1| PREDICTED: V-type proton ATPase subunit H [Zonotrichia albicollis]
Length=477

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFR06255.1| V-type proton ATPase subunit H, partial [Nipponia nippon]
Length=476

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_010169924.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Caprimulgus 
carolinensis]
Length=480

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|EOA97074.1| Vacuolar proton pump subunit H, partial [Anas platyrhynchos]
Length=459

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  11   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  70

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  71   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  130

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  131  QDLFTVHMAARIIAKLAA  148



>ref|XP_009287620.1| PREDICTED: V-type proton ATPase subunit H [Aptenodytes forsteri]
 ref|XP_009330329.1| PREDICTED: V-type proton ATPase subunit H [Pygoscelis adeliae]
 ref|XP_009471349.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Nipponia 
nippon]
 ref|XP_010073894.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pterocles 
gutturalis]
Length=480

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFM01728.1| V-type proton ATPase subunit H, partial [Aptenodytes forsteri]
Length=480

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_005506565.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Columba 
livia]
Length=480

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_008643145.1| PREDICTED: V-type proton ATPase subunit H [Corvus brachyrhynchos]
 ref|XP_010399478.1| PREDICTED: V-type proton ATPase subunit H [Corvus cornix cornix]
Length=480

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFU96510.1| V-type proton ATPase subunit H, partial [Chaetura pelagica]
Length=476

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_009984630.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Tauraco 
erythrolophus]
Length=462

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQAEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFW72760.1| V-type proton ATPase subunit H, partial [Pygoscelis adeliae]
Length=476

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_005025557.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Anas platyrhynchos]
 ref|XP_005506566.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Columba 
livia]
 ref|XP_009083527.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Serinus 
canaria]
 ref|XP_009471350.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Nipponia 
nippon]
 ref|XP_009568733.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cuculus 
canorus]
 ref|XP_010005109.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Chaetura 
pelagica]
 ref|XP_010169925.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Caprimulgus 
carolinensis]
 ref|XP_010073895.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pterocles 
gutturalis]
Length=462

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|EMC87078.1| V-type proton ATPase subunit H, partial [Columba livia]
Length=483

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>tpg|DAA60696.1| TPA: putative ribosomal protein S4 (RPS4A) family protein [Zea 
mays]
Length=169

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  154  EQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDD  285
            E+VL RDIPWE YM+TKLI+GT LQLLRRYD K ES +  LL++
Sbjct  49   EEVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEE  92



>ref|XP_009925483.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Haliaeetus 
albicilla]
 ref|XP_010581258.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Haliaeetus 
leucocephalus]
Length=465

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_005025556.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Anas platyrhynchos]
Length=477

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>gb|KFV08719.1| V-type proton ATPase subunit H, partial [Pterocles gutturalis]
Length=483

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFO70823.1| V-type proton ATPase subunit H, partial [Cuculus canorus]
Length=475

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFV80563.1| V-type proton ATPase subunit H, partial [Struthio camelus australis]
Length=481

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQAEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|KFP92999.1| V-type proton ATPase subunit H, partial [Haliaeetus albicilla]
Length=486

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNPEEKQELLQTEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|ADI40573.1| lysosomal H+-transporting ATPase V1 subunit H [Cynopterus sphinx]
Length=265

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K+    K ++L  +G  
Sbjct  7    AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRTPEEKQEMLQTEGSQ  66

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  67   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  126

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  127  QDLFTVHMAARIIAKLAA  144



>ref|XP_009638645.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Egretta 
garzetta]
Length=462

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAE-SYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+G   + ++R+++K     K +LL  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIQRFEQKRNLEEKQELLQTEGNQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRGKNTAWSYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDLFTVHMAARIIAKLAA  147



>ref|XP_004887507.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Heterocephalus 
glaber]
 ref|XP_004887508.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Heterocephalus 
glaber]
 ref|XP_004837569.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Heterocephalus 
glaber]
 ref|XP_004837570.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Heterocephalus 
glaber]
 gb|EHB04729.1| V-type proton ATPase subunit H [Heterocephalus glaber]
Length=483

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNVIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQAEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_006994248.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Peromyscus 
maniculatus bairdii]
Length=483

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++RY+ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRYEMKRSSEEKQEMLQSEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F + +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFEYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_004887509.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Heterocephalus 
glaber]
 ref|XP_004837571.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Heterocephalus 
glaber]
Length=465

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNVIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQAEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_006994249.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Peromyscus 
maniculatus bairdii]
Length=465

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++RY+ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRYEMKRSSEEKQEMLQSEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F + +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFEYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_006140948.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Tupaia 
chinensis]
Length=483

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYARRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>emb|CEP16084.1| hypothetical protein [Parasitella parasitica]
Length=397

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 71/139 (51%), Gaps = 1/139 (1%)
 Frame = +1

Query  112  PIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDG  291
            P+  +   + E     +  + I WE Y    L+T   ++L++  DKK        +D  G
Sbjct  9    PLVLVSNPYLEKKAANIRQKPILWEGYERASLLTHEQVELIKAIDKKPAQAIQDAMDQKG  68

Query  292  PAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADED-TYEPFLRLL  468
              Y  + + +L+++ + +T++YV  + D++L+ N   AR FH  S  D    + PF+R+L
Sbjct  69   QTYASLILYLLQNLSRPDTIQYVCLMTDDILSANDDNARYFHATSQEDASFPFAPFIRIL  128

Query  469  WKGNWFVQEKSCKILSLIV  525
               + F+  ++ K+L+++ 
Sbjct  129  QSDDEFMALEASKVLTILA  147



>ref|XP_002758941.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Callithrix 
jacchus]
Length=483

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYARRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_003940899.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Saimiri 
boliviensis boliviensis]
Length=483

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYARRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_008253747.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Oryctolagus 
cuniculus]
Length=483

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_003734984.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Callithrix 
jacchus]
 ref|XP_003940900.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Saimiri 
boliviensis boliviensis]
 ref|XP_006140949.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Tupaia 
chinensis]
Length=465

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYARRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_003506606.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cricetulus 
griseus]
Length=483

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|NP_001270161.1| uncharacterized protein LOC101926423 [Macaca fascicularis]
 ref|XP_003902803.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Papio anubis]
 ref|XP_007998822.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_010386313.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Rhinopithecus 
roxellana]
 dbj|BAE91538.1| unnamed protein product [Macaca fascicularis]
Length=465

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 65/114 (57%), Gaps = 1/114 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEPFL  459
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P+ 
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARRSKNTAWPYF  126



>ref|XP_008253748.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Oryctolagus 
cuniculus]
Length=465

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|NP_001013951.1| V-type proton ATPase subunit H [Rattus norvegicus]
 gb|AAH83669.1| ATPase, H+ transporting, lysosomal V1 subunit H [Rattus norvegicus]
Length=441

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 76/138 (55%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K+    K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRCSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_005362304.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Microtus 
ochrogaster]
 ref|XP_007632664.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cricetulus 
griseus]
 gb|ERE85968.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=483

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_003902802.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Papio anubis]
 ref|XP_005563371.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Macaca 
fascicularis]
 ref|XP_007998821.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_010386312.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Rhinopithecus 
roxellana]
 gb|EHH64165.1| V-type proton ATPase subunit H [Macaca fascicularis]
Length=483

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T  P FL +L +
Sbjct  73   CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARRSKNTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVYMAARIIAKLAA  150



>ref|XP_003428501.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ornithorhynchus 
anatinus]
Length=483

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L ++G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISSEDCEFIQRFELKRSPEEKQEMLQNEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|NP_001016182.1| V-type proton ATPase subunit H [Xenopus (Silurana) tropicalis]
 gb|AAI70670.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Xenopus (Silurana) 
tropicalis]
 gb|AAI70668.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Xenopus (Silurana) 
tropicalis]
Length=479

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 76/137 (55%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAY  300
             +PT+       +V    + W++Y+  ++I+G   + ++R++      K  +L ++G   
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIKRFETSLPEDKQIILTNEGNQC  69

Query  301  IRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWKG  477
             + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L + 
Sbjct  70   AKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYARRGKNTAWSYFLPMLNRQ  129

Query  478  NWFVQEKSCKILSLIVS  528
            + F    + +I++ + +
Sbjct  130  DLFTVHMAARIIAKLAA  146



>ref|XP_007645254.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cricetulus 
griseus]
Length=465

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_002123830.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ciona intestinalis]
Length=481

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 85/152 (56%), Gaps = 9/152 (6%)
 Frame = +1

Query  73   SALRSIDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-K  249
            + + S ++G+   P+++M T+  +     V +  + W++Y+  ++I     ++++ +D  
Sbjct  10   TGMTSTENGL---PVYSMSTNTLKSQAVDVRSHRVNWQSYLQGQMIQQQDFEIIQEFDAS  66

Query  250  KAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSL  429
            ++   +  +LD  G    R F++++  I KE+T+ Y+L  +D++L  +PKR  LF+D + 
Sbjct  67   RSFEARKSVLDRRGEECARTFIALMTRISKEQTVRYILTAVDDLLMEDPKRTELFNDSN-  125

Query  430  ADEDTYEP---FLRLLWKGNWFVQEKSCKILS  516
             ++    P   F+ +L + + F+  ++ +I++
Sbjct  126  -NKKRASPWIGFMNMLNRNDRFIVHQASRIIA  156



>ref|XP_005857374.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Myotis 
brandtii]
 ref|XP_006085328.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Myotis 
lucifugus]
 ref|XP_006085329.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Myotis 
lucifugus]
Length=483

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQSEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_005362305.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Microtus 
ochrogaster]
 ref|XP_007632665.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cricetulus 
griseus]
 gb|ERE85969.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=465

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_001515221.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ornithorhynchus 
anatinus]
Length=465

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L ++G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISSEDCEFIQRFELKRSPEEKQEMLQNEGNQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_009860941.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ciona intestinalis]
Length=466

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/152 (22%), Positives = 85/152 (56%), Gaps = 5/152 (3%)
 Frame = +1

Query  67   SPSALRSIDSGINLRPIFTMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD  246
            + + + S ++G+   P+++M T+  +     V +  + W++Y+  ++I     ++++ +D
Sbjct  8    NNTGMTSTENGL---PVYSMSTNTLKSQAVDVRSHRVNWQSYLQGQMIQQQDFEIIQEFD  64

Query  247  -KKAESYKTQLLDDDGPAYIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDK  423
              ++   +  +LD  G    R F++++  I KE+T+ Y+L  +D++L  +PKR  LF+D 
Sbjct  65   ASRSFEARKSVLDRRGEECARTFIALMTRISKEQTVRYILTAVDDLLMEDPKRTELFNDS  124

Query  424  SLADEDT-YEPFLRLLWKGNWFVQEKSCKILS  516
            +     + +  F+ +L + + F+  ++ +I++
Sbjct  125  NNKKRASPWIGFMNMLNRNDRFIVHQASRIIA  156



>ref|XP_005857375.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Myotis 
brandtii]
 ref|XP_006085330.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Myotis 
lucifugus]
Length=465

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQSEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRGKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_007516038.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Erinaceus 
europaeus]
Length=483

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V +  + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRSNKVNWQSYLQGQMISADDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|EGW09777.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=473

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  10   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEEKQEMLQTEGSQ  69

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  70   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  129

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  130  QDPFTVHMAARIIAKLAA  147



>ref|XP_006237863.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Rattus 
norvegicus]
 ref|XP_006237864.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Rattus 
norvegicus]
 gb|EDM11581.1| vacuolar ATPase subunit H, isoform CRA_a [Rattus norvegicus]
Length=483

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 76/138 (55%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K+    K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRCSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_011235919.1| PREDICTED: V-type proton ATPase subunit H [Ailuropoda melanoleuca]
 ref|XP_011235920.1| PREDICTED: V-type proton ATPase subunit H [Ailuropoda melanoleuca]
 gb|EFB21930.1| hypothetical protein PANDA_019837 [Ailuropoda melanoleuca]
Length=392

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>gb|ERE85970.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=476

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>ref|XP_007516039.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Erinaceus 
europaeus]
Length=465

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V +  + W++Y+  ++I+    + ++R++ K++   K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRSNKVNWQSYLQGQMISADDCEFIQRFEMKRSPEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDT-YEPFLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   ++T +  FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDLFTVHMAARIIAKLAA  150



>ref|XP_006237866.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Rattus 
norvegicus]
Length=465

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 76/138 (55%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  TMPTDHAELTTEQVLTRDIPWETYMTTKLITGTGLQLLRRYD-KKAESYKTQLLDDDGPA  297
             +PT+       +V    + W++Y+  ++I+    + ++R++ K+    K ++L  +G  
Sbjct  13   AVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRCSEEKQEMLQTEGSQ  72

Query  298  YIRVFVSILRDILKEETLEYVLALIDEMLTVNPKRARLFHDKSLADEDTYEP-FLRLLWK  474
              + F++++  I KE+T++Y+L ++D+ML  N +R  +F D +   + T  P FL +L +
Sbjct  73   CAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNR  132

Query  475  GNWFVQEKSCKILSLIVS  528
             + F    + +I++ + +
Sbjct  133  QDPFTVHMAARIIAKLAA  150



>gb|KDQ60593.1| hypothetical protein JAAARDRAFT_31557 [Jaapia argillacea MUCL 
33604]
Length=437

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = +1

Query  166  TRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKTQLLDDDGPAYIRVFVSILRDILKEE  345
            ++ +PWE Y    L+T   L L+++ D++  +    LL  DG +Y  ++V +L+ + + +
Sbjct  20   SKPVPWEGYQRAGLVTSEELSLIKKVDRQPRARTESLLLSDGQSYALLYVRLLKKLQRVD  79

Query  346  TLEYVLALIDEMLTVNPKRARLFHDKSLAD-EDTYEPFLRLLWKGNWFVQEKSCKILSLI  522
            T++ +L LI + L  + +R  LF   +  D E  Y P LR L   + FVQ K+ +IL+L+
Sbjct  80   TMQCILVLIGDALIDHEERIPLFLKAAETDPELPYGPLLRTLDTQDDFVQLKATQILTLM  139

Query  523  VS  528
            +S
Sbjct  140  LS  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000