BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016P24

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO44766.1|  hypothetical protein CISIN_1g025092mg                   249   2e-80   Citrus sinensis [apfelsine]
gb|KDO44762.1|  hypothetical protein CISIN_1g025092mg                   248   2e-79   Citrus sinensis [apfelsine]
gb|KDO44763.1|  hypothetical protein CISIN_1g025092mg                   249   2e-79   Citrus sinensis [apfelsine]
ref|XP_006437083.1|  hypothetical protein CICLE_v10032502mg             248   8e-79   Citrus clementina [clementine]
emb|CAA41713.1|  photosystem II 23 kDa polypeptide                      243   2e-77   Nicotiana tabacum [American tobacco]
ref|XP_009618672.1|  PREDICTED: oxygen-evolving enhancer protein ...    243   6e-77   Nicotiana tomentosiformis
ref|XP_009407699.1|  PREDICTED: oxygen-evolving enhancer protein ...    243   6e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009765610.1|  PREDICTED: oxygen-evolving enhancer protein ...    243   9e-77   Nicotiana sylvestris
ref|XP_010247826.1|  PREDICTED: oxygen-evolving enhancer protein ...    239   2e-75   Nelumbo nucifera [Indian lotus]
gb|AGZ95659.1|  photosystem II extrinsic subunit                        239   3e-75   Nicotiana benthamiana
gb|AFH58003.1|  chloroplast PsbP3 precursor                             239   3e-75   Nicotiana benthamiana
emb|CAA45699.1|  23 kDa polypeptide of water-oxidizing complex of...    239   3e-75   Nicotiana tabacum [American tobacco]
ref|XP_011085433.1|  PREDICTED: oxygen-evolving enhancer protein ...    238   3e-75   Sesamum indicum [beniseed]
ref|XP_003532074.1|  PREDICTED: oxygen-evolving enhancer protein ...    238   6e-75   Glycine max [soybeans]
emb|CAA44292.1|  23-kDa ploypeptide of photosystem II oxygen-evol...    238   7e-75   Nicotiana tabacum [American tobacco]
ref|WP_039310993.1|  hypothetical protein                               237   2e-74   Paenibacillus sp. IHB B 3415
ref|XP_009769223.1|  PREDICTED: oxygen-evolving enhancer protein ...    236   2e-74   Nicotiana sylvestris
ref|XP_008809743.1|  PREDICTED: oxygen-evolving enhancer protein ...    236   3e-74   Phoenix dactylifera
sp|P12302.1|PSBP_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    235   5e-74   Spinacia oleracea
gb|AFK47979.1|  unknown                                                 234   8e-74   Lotus japonicus
gb|AFH58002.1|  chloroplast PsbP2 precursor                             235   9e-74   Nicotiana benthamiana
gb|AFK44592.1|  unknown                                                 234   9e-74   Lotus japonicus
sp|O49080.1|PSBP_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    234   1e-73   Fritillaria agrestis
ref|XP_010093189.1|  Oxygen-evolving enhancer protein 2                 234   1e-73   Morus notabilis
ref|NP_001274949.1|  oxygen-evolving enhancer protein 2, chloropl...    234   2e-73   Solanum tuberosum [potatoes]
emb|CAA41712.1|  photosystem II 23 kDa polypeptide                      234   2e-73   Nicotiana tabacum [American tobacco]
gb|AFH58001.1|  chloroplast PsbP1 precursor                             234   2e-73   Nicotiana benthamiana
ref|XP_011100486.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    233   3e-73   Sesamum indicum [beniseed]
gb|AFK45562.1|  unknown                                                 231   5e-73   Lotus japonicus
ref|XP_009419010.1|  PREDICTED: oxygen-evolving enhancer protein ...    233   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP17859.1|  unnamed protein product                                233   6e-73   Coffea canephora [robusta coffee]
gb|KHN28540.1|  Oxygen-evolving enhancer protein 2, chloroplastic       232   8e-73   Glycine soja [wild soybean]
gb|AFK39738.1|  unknown                                                 232   9e-73   Lotus japonicus
ref|NP_001234109.1|  oxygen-evolving enhancer protein 2, chloropl...    232   1e-72   
ref|XP_002283048.1|  PREDICTED: oxygen-evolving enhancer protein ...    231   2e-72   Vitis vinifera
ref|XP_011026206.1|  PREDICTED: oxygen-evolving enhancer protein ...    231   2e-72   Populus euphratica
ref|XP_010680144.1|  PREDICTED: oxygen-evolving enhancer protein ...    231   2e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB75386.1|  hypothetical protein B456_012G039400                    231   3e-72   Gossypium raimondii
ref|XP_003545316.1|  PREDICTED: oxygen-evolving enhancer protein ...    231   3e-72   Glycine max [soybeans]
ref|XP_007048926.1|  Photosystem II subunit P-1                         230   7e-72   
ref|XP_009619867.1|  PREDICTED: oxygen-evolving enhancer protein ...    230   9e-72   Nicotiana tomentosiformis
ref|XP_002300858.1|  photosystem II oxygen-evolving complex prote...    229   1e-71   Populus trichocarpa [western balsam poplar]
gb|KCW89790.1|  hypothetical protein EUGRSUZ_A02039                     226   1e-71   Eucalyptus grandis [rose gum]
ref|XP_011032754.1|  PREDICTED: oxygen-evolving enhancer protein ...    229   2e-71   Populus euphratica
sp|P16059.1|PSBP_PEA  RecName: Full=Oxygen-evolving enhancer prot...    229   2e-71   Pisum sativum [garden pea]
ref|XP_010906959.1|  PREDICTED: oxygen-evolving enhancer protein ...    229   2e-71   Elaeis guineensis
ref|XP_002307570.1|  photosystem II oxygen-evolving complex prote...    228   2e-71   Populus trichocarpa [western balsam poplar]
ref|NP_001276136.1|  oxygen-evolving enhancer protein 2, chloropl...    228   3e-71   Glycine max [soybeans]
ref|XP_007215827.1|  hypothetical protein PRUPE_ppa010093mg             228   4e-71   Prunus persica
gb|ACU23674.1|  unknown                                                 228   4e-71   Glycine max [soybeans]
ref|XP_010054080.1|  PREDICTED: oxygen-evolving enhancer protein ...    228   4e-71   Eucalyptus grandis [rose gum]
ref|XP_003519527.1|  PREDICTED: oxygen-evolving enhancer protein ...    228   4e-71   Glycine max [soybeans]
gb|KHG22094.1|  Oxygen-evolving enhancer 2-1, chloroplastic             228   5e-71   Gossypium arboreum [tree cotton]
ref|XP_008229592.1|  PREDICTED: oxygen-evolving enhancer protein ...    227   7e-71   Prunus mume [ume]
gb|KJB71514.1|  hypothetical protein B456_011G126200                    228   1e-70   Gossypium raimondii
gb|ABQ41911.1|  23kDa polypeptide of the oxygen evolving complex ...    224   8e-70   Sonneratia ovata
gb|ABQ41909.1|  23kDa polypeptide of the oxygen evolving complex ...    223   1e-69   Sonneratia alba
gb|ABQ41910.1|  23kDa polypeptide of the oxygen evolving complex ...    223   2e-69   Sonneratia caseolaris
gb|KDP36279.1|  hypothetical protein JCGZ_10289                         224   2e-69   Jatropha curcas
gb|KHG20721.1|  Oxygen-evolving enhancer 2-3, chloroplastic             224   2e-69   Gossypium arboreum [tree cotton]
gb|ACJ84745.1|  unknown                                                 223   2e-69   Medicago truncatula
ref|XP_004147746.1|  PREDICTED: oxygen-evolving enhancer protein ...    223   2e-69   Cucumis sativus [cucumbers]
ref|XP_004499534.1|  PREDICTED: oxygen-evolving enhancer protein ...    223   3e-69   
ref|XP_008380167.1|  PREDICTED: oxygen-evolving enhancer protein ...    223   3e-69   Malus domestica [apple tree]
gb|ACS68649.1|  23 kDa polypeptide of the oxygen evolving complex...    221   5e-69   Sonneratia alba
ref|XP_008451840.1|  PREDICTED: oxygen-evolving enhancer protein ...    223   6e-69   
gb|KDO44764.1|  hypothetical protein CISIN_1g025092mg                   221   6e-69   Citrus sinensis [apfelsine]
gb|AAX53162.1|  chloroplast photosynthetic oxygen-evolving protei...    222   7e-69   Nicotiana benthamiana
gb|AFK45301.1|  unknown                                                 222   8e-69   Medicago truncatula
ref|XP_006437084.1|  hypothetical protein CICLE_v10032502mg             219   1e-68   
gb|ABQ41912.1|  23kDa polypeptide of the oxygen evolving complex ...    219   5e-68   Sonneratia apetala
dbj|BAE71271.1|  putative PSII-P protein                                219   7e-68   Trifolium pratense [peavine clover]
dbj|BAG70022.1|  23 kDa precursor protein of the oxygen-evolving ...    219   9e-68   Salicornia europaea [chicken-claws]
ref|XP_002521576.1|  Oxygen-evolving enhancer protein 2, chloropl...    219   1e-67   Ricinus communis
ref|NP_172153.1|  photosystem II subunit P-1                            219   2e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CAA44291.1|  23-dDa polypeptide of Photosystem II oxygen-evol...    215   2e-67   Nicotiana tabacum [American tobacco]
ref|XP_002889614.1|  oxygen-evolving enhancer protein 2                 218   2e-67   
ref|XP_006303580.1|  hypothetical protein CARUB_v10011102mg             218   2e-67   Capsella rubella
ref|XP_009356583.1|  PREDICTED: oxygen-evolving enhancer protein ...    218   5e-67   Pyrus x bretschneideri [bai li]
gb|EYU43166.1|  hypothetical protein MIMGU_mgv1a011987mg                218   5e-67   Erythranthe guttata [common monkey flower]
ref|XP_010486454.1|  PREDICTED: oxygen-evolving enhancer protein ...    217   8e-67   Camelina sativa [gold-of-pleasure]
emb|CDY06657.1|  BnaA10g04360D                                          215   4e-66   
ref|XP_008342330.1|  PREDICTED: oxygen-evolving enhancer protein ...    215   4e-66   Malus domestica [apple tree]
ref|XP_006417893.1|  hypothetical protein EUTSA_v10008504mg             214   8e-66   
emb|CDY10216.1|  BnaC05g04590D                                          214   1e-65   Brassica napus [oilseed rape]
ref|XP_006417894.1|  hypothetical protein EUTSA_v10008504mg             214   1e-65   Eutrema salsugineum [saltwater cress]
ref|XP_009119039.1|  PREDICTED: oxygen-evolving enhancer protein ...    214   2e-65   Brassica rapa
ref|XP_006296023.1|  hypothetical protein CARUB_v10025169mg             213   2e-65   Capsella rubella
ref|XP_009376988.1|  PREDICTED: oxygen-evolving enhancer protein ...    213   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_006354308.1|  PREDICTED: oxygen-evolving enhancer protein ...    212   4e-65   
ref|XP_008793536.1|  PREDICTED: oxygen-evolving enhancer protein ...    215   6e-65   Phoenix dactylifera
ref|XP_002881132.1|  oxygen-evolving enhancer protein 2                 212   7e-65   Arabidopsis lyrata subsp. lyrata
gb|AAN77240.1|  PsbP                                                    211   7e-65   Xerophyta humilis
ref|XP_004303902.1|  PREDICTED: oxygen-evolving enhancer protein ...    211   1e-64   Fragaria vesca subsp. vesca
ref|XP_010414217.1|  PREDICTED: oxygen-evolving enhancer protein ...    211   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009118485.1|  PREDICTED: oxygen-evolving enhancer protein ...    210   3e-64   Brassica rapa
emb|CDY06222.1|  BnaA09g49810D                                          210   3e-64   
gb|AGV54458.1|  oxygen-evolving enhancer protein 2 chloroplastic-...    210   4e-64   Phaseolus vulgaris [French bean]
gb|AGV54655.1|  oxygen-evolving enhancer protein 2-2 chloroplast ...    209   5e-64   Phaseolus vulgaris [French bean]
ref|XP_007141448.1|  hypothetical protein PHAVU_008G196500g             209   6e-64   Phaseolus vulgaris [French bean]
ref|XP_004491279.1|  PREDICTED: oxygen-evolving enhancer protein ...    209   8e-64   Cicer arietinum [garbanzo]
ref|XP_010469798.1|  PREDICTED: oxygen-evolving enhancer protein ...    209   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009144275.1|  PREDICTED: oxygen-evolving enhancer protein ...    209   9e-64   Brassica rapa
ref|XP_006410179.1|  hypothetical protein EUTSA_v10017096mg             209   9e-64   Eutrema salsugineum [saltwater cress]
emb|CDY09962.1|  BnaC08g44890D                                          209   1e-63   Brassica napus [oilseed rape]
sp|P11594.2|PSBP_SINAL  RecName: Full=Oxygen-evolving enhancer pr...    208   2e-63   Sinapis alba [bai jie]
ref|XP_009110976.1|  PREDICTED: oxygen-evolving enhancer protein ...    208   2e-63   Brassica rapa
emb|CDX86515.1|  BnaC08g01880D                                          207   3e-63   
sp|Q96334.1|PSBP_BRAJU  RecName: Full=Oxygen-evolving enhancer pr...    206   4e-63   Brassica juncea [brown mustard]
emb|CAA68801.1|  23 kD subunit                                          207   4e-63   Sinapis alba [bai jie]
ref|XP_010522048.1|  PREDICTED: oxygen-evolving enhancer protein ...    207   6e-63   Tarenaya hassleriana [spider flower]
emb|CDY15587.1|  BnaA08g28710D                                          206   9e-63   Brassica napus [oilseed rape]
gb|EPS69373.1|  hypothetical protein M569_05393                         205   2e-62   Genlisea aurea
emb|CAA45700.1|  23 kDa polypeptide of water-oxidizing complex of...    202   6e-62   Nicotiana tabacum [American tobacco]
sp|Q40407.1|PSBP_NARPS  RecName: Full=Oxygen-evolving enhancer pr...    204   7e-62   Narcissus pseudonarcissus
gb|KFK42985.1|  hypothetical protein AALP_AA1G064500                    204   8e-62   Arabis alpina [alpine rockcress]
sp|P85189.1|PSBP_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    204   9e-62   Helianthus annuus
gb|KFK31259.1|  hypothetical protein AALP_AA6G089000                    203   2e-61   Arabis alpina [alpine rockcress]
ref|XP_010557156.1|  PREDICTED: oxygen-evolving enhancer protein ...    202   4e-61   Tarenaya hassleriana [spider flower]
gb|KEH33650.1|  oxygen-evolving enhancer protein 2-1                    201   7e-61   Medicago truncatula
ref|XP_006843560.1|  hypothetical protein AMTR_s00007p00081670          199   1e-59   Amborella trichopoda
gb|ADQ00373.1|  oxygen-evolving enhancer protein 2                      198   1e-59   Sequoia sempervirens [California redwood]
gb|ABQ85433.1|  23 kDa OEC protein                                      194   8e-59   Salicornia veneta
emb|CDY47118.1|  BnaC04g13750D                                          204   5e-58   Brassica napus [oilseed rape]
ref|XP_010543054.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    190   4e-56   
emb|CBI22068.3|  unnamed protein product                                187   1e-55   Vitis vinifera
gb|ABS84824.1|  chloroplast oxygen-evolving enhancer protein 2          188   1e-55   Limonium bicolor
ref|XP_003617328.1|  Oxygen-evolving enhancer protein                   187   4e-55   Medicago truncatula
ref|XP_004965800.1|  PREDICTED: oxygen-evolving enhancer protein ...    187   4e-55   Setaria italica
gb|EYU42856.1|  hypothetical protein MIMGU_mgv1a011103mg                186   2e-54   Erythranthe guttata [common monkey flower]
gb|AAB82135.1|  23kDa polypeptide of photosystem II                     182   2e-53   Oryza sativa Indica Group [Indian rice]
gb|AAC02750.1|  photosystem II oxygen-evolving complex 23K protei...    181   7e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDO44761.1|  hypothetical protein CISIN_1g025092mg                   179   1e-52   Citrus sinensis [apfelsine]
pdb|2VU4|A  Chain A, Structure Of Psbp Protein From Spinacia Oler...    177   3e-52   Spinacia oleracea
pdb|4RTI|A  Chain A, The Crystal Structure Of Psbp From Spinacia ...    176   4e-52   Spinacia oleracea
gb|EAZ02734.1|  hypothetical protein OsI_24852                          172   2e-50   Oryza sativa Indica Group [Indian rice]
gb|ABR16937.1|  unknown                                                 174   3e-50   Picea sitchensis
ref|XP_003557629.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   3e-50   Brachypodium distachyon [annual false brome]
gb|ABK22374.1|  unknown                                                 174   5e-50   Picea sitchensis
gb|AGZ95660.1|  photosystem II extrinsic subunit (chloroplast)          173   5e-50   Oryza sativa [red rice]
ref|NP_001058863.1|  Os07g0141400                                       173   5e-50   
ref|XP_002992976.1|  hypothetical protein SELMODRAFT_136349             172   1e-49   
ref|XP_008652004.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   1e-49   
tpg|DAA59516.1|  TPA: hypothetical protein ZEAMMB73_927356              174   2e-49   
ref|XP_002991817.1|  hypothetical protein SELMODRAFT_134339             170   4e-49   
gb|ABK26108.1|  unknown                                                 172   4e-49   Picea sitchensis
gb|ABY52939.1|  chloroplast 23 kDa polypeptide of photosystem II        169   5e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ABK21284.1|  unknown                                                 171   1e-48   Picea sitchensis
ref|XP_006366632.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   2e-48   Solanum tuberosum [potatoes]
ref|XP_002461438.1|  hypothetical protein SORBIDRAFT_02g002690          169   4e-48   Sorghum bicolor [broomcorn]
pdb|4RTH|A  Chain A, The Crystal Structure Of Psbp From Zea Mays        165   1e-47   Zea mays [maize]
ref|NP_001117239.1|  photosystem II subunit P-1                         166   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457809.1|  PREDICTED: putative oxygen-evolving enhancer...    165   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010486460.1|  PREDICTED: putative oxygen-evolving enhancer...    165   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006658268.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   5e-47   
ref|XP_007155967.1|  hypothetical protein PHAVU_003G2476001g            162   3e-46   Phaseolus vulgaris [French bean]
dbj|BAA96364.1|  oxygen evolving enhancer protein 2                     160   6e-46   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_001763729.1|  predicted protein                                  162   1e-45   
ref|XP_001771262.1|  predicted protein                                  162   1e-45   
dbj|BAA08564.1|  23 kDa polypeptide of photosystem II                   161   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010657103.1|  PREDICTED: putative oxygen-evolving enhancer...    160   4e-45   Vitis vinifera
sp|Q00434.1|PSBP_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    159   1e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009118486.1|  PREDICTED: putative oxygen-evolving enhancer...    157   5e-44   Brassica rapa
pdb|1V2B|A  Chain A, Crystal Structure Of Psbp Protein In The Oxy...    155   6e-44   Nicotiana tabacum [American tobacco]
ref|XP_001765395.1|  predicted protein                                  155   6e-43   
tpg|DAA42743.1|  TPA: hypothetical protein ZEAMMB73_321092              154   1e-42   
ref|XP_001753947.1|  predicted protein                                  152   5e-42   
gb|EMS54608.1|  Oxygen-evolving enhancer protein 2, chloroplastic       152   8e-42   Triticum urartu
gb|EMT29894.1|  Oxygen-evolving enhancer protein 2, chloroplastic       150   1e-40   
gb|ABK55671.1|  chloroplast photosystem II oxygen-evolving comple...    142   3e-39   Cucumis sativus [cucumbers]
sp|P11471.1|PSBP_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    141   1e-37   Chlamydomonas reinhardtii
gb|ACD10926.1|  photosystem II oxygen evolving system 23 kDa subunit    137   2e-37   Lemna minor
ref|XP_001694126.1|  oxygen-evolving enhancer protein 2 of photos...    140   5e-37   Chlamydomonas reinhardtii
ref|XP_002956365.1|  oxygen-evolving enhancer protein 2                 141   1e-34   Volvox carteri f. nagariensis
emb|CCM44238.1|  photosystem II subunit P                               132   4e-34   Chlamydomonas raudensis
gb|KIY95992.1|  hypothetical protein MNEG_11971                         124   3e-29   Monoraphidium neglectum
ref|XP_005649549.1|  photosystem II oxygen evolving complex prote...    118   6e-29   Coccomyxa subellipsoidea C-169
ref|XP_001763489.1|  predicted protein                                  116   1e-28   
emb|CEG02166.1|  Mog1/PsbP, alpha/beta/alpha sandwich                   117   2e-28   Ostreococcus tauri
ref|XP_001422601.1|  oxygen evolving enhancer 2 of Photosystem II       115   8e-28   Ostreococcus lucimarinus CCE9901
ref|XP_005649550.1|  oxygen evolving enhancer 2 of photosystem II       112   9e-27   Coccomyxa subellipsoidea C-169
ref|XP_002505689.1|  photosystem II oxygen-evolving complex 23 kD...    112   1e-26   Micromonas commoda
ref|XP_003060004.1|  photosystem II oxygen-evolving complex 23 kD...    112   1e-26   Micromonas pusilla CCMP1545
ref|XP_007509854.1|  predicted protein                                  106   3e-24   Bathycoccus prasinos
ref|XP_011396200.1|  Oxygen-evolving enhancer protein 2, chloropl...  99.0    1e-21   Auxenochlorella protothecoides
gb|KIZ07080.1|  hypothetical protein MNEG_0869                        97.1    4e-21   Monoraphidium neglectum
gb|ACF24545.1|  photosystem II oxygen evolving enhancer protein 2     91.3    9e-19   Gymnochlora stellata
gb|AAP79210.1|  photosystem II protein PsbP                           90.1    3e-18   Bigelowiella natans
gb|ABS71999.1|  putative chloroplast photosystem II 23kDa protein     84.3    1e-17   Olea europaea
gb|ADJ67185.1|  oxygen-evolving enhancer protein 2                    84.3    2e-17   Jatropha curcas
gb|ABV57471.1|  chloroplast PsbP                                      75.5    5e-14   Phyllostachys edulis [kikko-chiku]
emb|CCC15105.1|  oxygen-evolving enhancer protein 2                   75.9    1e-13   Lepidodinium chlorophorum
dbj|BAH57265.1|  AT1G06680                                            54.7    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155968.1|  hypothetical protein PHAVU_003G2476000g          70.1    2e-12   Phaseolus vulgaris [French bean]
ref|XP_005844169.1|  hypothetical protein CHLNCDRAFT_139312           68.9    3e-11   Chlorella variabilis
ref|NP_180637.3|  photosystem II subunit P-2                          67.4    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAT09057.1|  oxygen-evolving complex                               57.4    5e-08   Beta vulgaris [beet]
gb|KDO67747.1|  hypothetical protein CISIN_1g026701mg                 51.2    3e-05   Citrus sinensis [apfelsine]
ref|XP_007009492.1|  PsbP-like protein 2                              50.4    2e-04   
gb|KJB76059.1|  hypothetical protein B456_012G069100                  48.9    7e-04   Gossypium raimondii
gb|KJB76058.1|  hypothetical protein B456_012G069100                  48.5    7e-04   Gossypium raimondii
gb|KHG00113.1|  PsbP-like protein 2, chloroplastic                    48.5    7e-04   Gossypium arboreum [tree cotton]



>gb|KDO44766.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=179

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++VDYLLGKQAYSGKT
Sbjct  116  REFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKT  173



>gb|KDO44762.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=246

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++VDYLLGKQAYSGKT
Sbjct  116  REFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKT  173



>gb|KDO44763.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=258

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++VDYLLGKQAYSGKT
Sbjct  116  REFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKT  173



>ref|XP_006437083.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
 ref|XP_006485001.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Citrus sinensis]
 gb|ESR50323.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
Length=258

 Score =   248 bits (632),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++VDYLLGKQAYSGKT
Sbjct  116  REFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKT  173



>emb|CAA41713.1| photosystem II 23 kDa polypeptide [Nicotiana tabacum]
Length=229

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 142/181 (78%), Gaps = 5/181 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + +      SS RYV  LKPNQLVCRAQKQS+   +D  +  V+ 
Sbjct  1    MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL QVD+LLGKQAY GK
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGK  178

Query  567  T  569
            T
Sbjct  179  T  179



>ref|XP_009618672.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q7DM39.2|PSBP1_TOBAC RecName: Full=Oxygen-evolving enhancer protein 2-1, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
Length=268

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 142/181 (78%), Gaps = 5/181 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + +      SS RYV  LKPNQLVCRAQKQS+   +D  +  V+ 
Sbjct  1    MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL QVD+LLGKQAY GK
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGK  178

Query  567  T  569
            T
Sbjct  179  T  179



>ref|XP_009407699.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=264

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LHHPA SA A  +S  R VP +K NQL CRAQ++ A + +D+  + V+    
Sbjct  1    MASTACF-LHHPAPSAAASRTSRPRLVPSVKANQLACRAQQKQAVSADDENGAVVSRRLA  59

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            L  TVLIGAAA+GSKVSPADAAYGEAANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  60   L--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKTNTDFLPYKGDGFKLSIPSKWNPSKE  117

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V+VTPT K SITDYGSPEEFL+QVDYLLGKQAYSGKT
Sbjct  118  VEYPGQVLRYEDNFDTTSNVAVMVTPTSKSSITDYGSPEEFLSQVDYLLGKQAYSGKT  175



>ref|XP_009765610.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
[Nicotiana sylvestris]
 gb|AFH58004.1| chloroplast PsbP4 precursor [Nicotiana benthamiana]
Length=268

 Score =   243 bits (619),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 144/181 (80%), Gaps = 5/181 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + +      SS RYV  LKPNQLVCRAQKQS++  +D  + +V+ 
Sbjct  1    MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAAVGSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAVGSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QVD+LLGKQAY GK
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQVDFLLGKQAYFGK  178

Query  567  T  569
            T
Sbjct  179  T  179



>ref|XP_010247826.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Nelumbo nucifera]
Length=260

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 139/178 (78%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     S   R+V  +KP Q+VCRAQKQ+     + A S       
Sbjct  1    MASTSCFLHHHALSTPTRSSS--QRHVFNIKPTQVVCRAQKQAVDDEANVAVSRRLAL--  56

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVG+KVSPADAAYGEAANVFGKPKTNT+FLP+TGDGFKL VPSKWNPSKE
Sbjct  57   ---TVLIGAAAVGTKVSPADAAYGEAANVFGKPKTNTDFLPVTGDGFKLLVPSKWNPSKE  113

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            +E+PGQVLRYEDNFD  SN+ V+VTPTDKKSITD+G+PEEFL++VDYLLGKQAY GKT
Sbjct  114  IEYPGQVLRYEDNFDANSNVAVMVTPTDKKSITDFGAPEEFLSKVDYLLGKQAYFGKT  171



>gb|AGZ95659.1| photosystem II extrinsic subunit (chloroplast) [Nicotiana benthamiana]
Length=268

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + ++     SS RYV  LKP+QLVCRAQKQS++  +D  + +++ 
Sbjct  1    MASTQCFLHQHALSSSTASTTFSVSSQRYVSSLKPSQLVCRAQKQSSAQEDDGHSVAISR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+F+   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKQNTDFMAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QVD+LLGKQAY GK
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQVDFLLGKQAYFGK  178

Query  567  T  569
            T
Sbjct  179  T  179



>gb|AFH58003.1| chloroplast PsbP3 precursor [Nicotiana benthamiana]
Length=268

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + ++     SS RYV  LKP+QLVCRAQKQS++  +D  + +++ 
Sbjct  1    MASTQCFLHQHALSSSTASTTFSVSSQRYVSSLKPSQLVCRAQKQSSAQEDDGNSVAISR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+F+   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKQNTDFMAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QVD+LLGKQAY GK
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQVDFLLGKQAYFGK  178

Query  567  T  569
            T
Sbjct  179  T  179



>emb|CAA45699.1| 23 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=268

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + +      SS RYV  LKPNQLVCRAQKQS+   +D  +  V+ 
Sbjct  1    MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKKNTDFLAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAY  557
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL QVD+LLGKQAY
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAY  175



>ref|XP_011085433.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH A+S PA  +SS R VP LKP+QL+CRAQKQ+ +   D AA+ V+    
Sbjct  1    MASTACFLHHHAAISTPAARTSSGRNVPSLKPSQLICRAQKQAEAQESDSAAAVVSRRLA  60

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            L  TVLIGAAAVGSKVSPADAAYGE+AN+FGKPKTNT+F P +G+GFKL +PSKWNPS E
Sbjct  61   L--TVLIGAAAVGSKVSPADAAYGESANIFGKPKTNTDFKPYSGEGFKLSIPSKWNPSNE  118

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VEFPGQVLRYEDNFD TS + V + PTDKKSITDYGSPE+FL++VDYLLGKQAY GKT
Sbjct  119  VEFPGQVLRYEDNFDATSYLTVTINPTDKKSITDYGSPEDFLSKVDYLLGKQAYFGKT  176



>ref|XP_003532074.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Glycine max]
 gb|KHM99676.1| Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja]
Length=262

 Score =   238 bits (606),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 134/178 (75%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +     S   R V   KPN +VC+AQKQ     ED           
Sbjct  1    MASTQCFLHHHALTTPTRASS--QRLVVSTKPNHIVCKAQKQVVQEGEDTTNIVSRRLAL  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV+PADAAYGEAANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVAPADAAYGEAANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V+VT TDKKSITDYGSPEEFL+QVDYLLGKQA+ G+T
Sbjct  116  VEYPGQVLRYEDNFDSTSNVAVMVTATDKKSITDYGSPEEFLSQVDYLLGKQAFFGQT  173



>emb|CAA44292.1| 23-kDa ploypeptide of photosystem II oxygen-evolving complex 
[Nicotiana tabacum]
Length=266

 Score =   238 bits (606),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  42   STQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsr  212
            STQCF   H    + +      SS RYV  LKPNQLVCRAQKQS++  +D  + +V+   
Sbjct  1    STQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSRRL  60

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
             L  TVLIGAAAVGSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNPSK
Sbjct  61   AL--TVLIGAAAVGSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPAKWNPSK  118

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QVD+LLGKQAY GKT
Sbjct  119  EVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQVDFLLGKQAYFGKT  177



>ref|WP_039310993.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91170.1| hypothetical protein QW71_36210 [Paenibacillus sp. IHB B 3415]
Length=267

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVL----KPNQLVCRAQKQsasaheddaassva  203
            MAST CF  HH   +     S   RYVP      KPN++VC+AQKQ+    +  AA +V+
Sbjct  1    MASTACFLHHHALSNPTRTQS--QRYVPTTTITTKPNRVVCKAQKQAVQEEDGGAADAVS  58

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                L  TVL+GAAA+GSKVSPADAAYGEAAN+FGKPKTNT+FLP  G+GF +Q+P+KWN
Sbjct  59   RRLAL--TVLVGAAAIGSKVSPADAAYGEAANIFGKPKTNTDFLPYIGNGFTVQIPAKWN  116

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PSKEVEFPGQVLRYEDNFD  SN+CV+VTPTDKKSITD+GSPE+FL++VDYLLGKQAYSG
Sbjct  117  PSKEVEFPGQVLRYEDNFDPNSNVCVMVTPTDKKSITDFGSPEDFLSKVDYLLGKQAYSG  176

Query  564  KT  569
            KT
Sbjct  177  KT  178



>ref|XP_009769223.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009769224.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009769225.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009769226.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 sp|P18212.2|PSBP2_TOBAC RecName: Full=Oxygen-evolving enhancer protein 2-2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA39039.1| photosystem II 23kDa polypeptide [Nicotiana tabacum]
Length=265

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 148/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavsr  212
            MASTQCF LHH ALS PAR       VP LKPNQL VCRAQKQSA   ++  + SV+   
Sbjct  1    MASTQCF-LHHHALSTPARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSVSVSRRL  59

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
             L  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+K
Sbjct  60   AL--TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNK  117

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  118  EVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKT  176



>ref|XP_008809743.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=259

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +        +R +P ++P QLVCRAQKQ+    E DA  S  ++  
Sbjct  1    MASTACFLHHHAPSTLRTP----SRPMPSIRPTQLVCRAQKQAGLEAESDAVISRRLAL-  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVL+GAAAVG KVSPADAAYGEAAN+FGKPKT+T+FLPI+GDGFKL +PSKWNPSKE
Sbjct  56   ---TVLVGAAAVGVKVSPADAAYGEAANIFGKPKTDTDFLPISGDGFKLMIPSKWNPSKE  112

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VEFPGQVLR+EDN D  SN+ V+VTPT K SITDYGSPEEFL+QVDYLLGKQAYSGKT
Sbjct  113  VEFPGQVLRFEDNLDSNSNVGVMVTPTTKSSITDYGSPEEFLSQVDYLLGKQAYSGKT  170



>sp|P12302.1|PSBP_SPIOL RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
 emb|CAA29055.1| 23 kDa OEC protein [Spinacia oleracea]
 prf||1307179A luminal protein 23kD
Length=267

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 140/181 (77%), Gaps = 6/181 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsa--parpsssNRYVPV-LKPNQLVCRAQKQsasaheddaassvav  206
            MAST CF  HH A+S+    R S++ RY  V +KPNQ+VC+AQKQ  +      +     
Sbjct  1    MASTACFLHHHAAISSPAAGRGSAAQRYQAVSIKPNQIVCKAQKQDDNEANVLNSGVSRR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
                  TVLIGAAAVGSKVSPADAAYGEAANVFGKPK NTEF+P  GDGFKL VPSKWNP
Sbjct  61   LAL---TVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNP  117

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKE EFPGQVLRYEDNFD TSN+ VLV PTDKKSITD+GSPE+FL+QVDYLLGKQAY GK
Sbjct  118  SKEKEFPGQVLRYEDNFDATSNLSVLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGK  177

Query  567  T  569
            T
Sbjct  178  T  178



>gb|AFK47979.1| unknown [Lotus japonicus]
Length=259

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 8/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +     S   R V  +KPNQ+VCRAQKQ         +  +A+   
Sbjct  1    MASTQCFLHHHALTTPTRTSS--QRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLAL---  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               T+LIGAAAVGSKVSPADAAYGEAANVFGKPK+NT+FLP  GDGFKL +P+KWNPSKE
Sbjct  56   ---TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPAKWNPSKE  112

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ V++T TDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  113  REFPGQVLRYEDNFDATSNVSVIITATDKKSITDYGSPEEFLSKVDYLLGKQAFFGQT  170



>gb|AFH58002.1| chloroplast PsbP2 precursor [Nicotiana benthamiana]
Length=265

 Score =   235 bits (599),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 148/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavsr  212
            MASTQCF LHH ALS PAR       VP LKPNQL VCRAQKQSA   ++  + SV+   
Sbjct  1    MASTQCF-LHHHALSTPARTPLVRGIVPSLKPNQLLVCRAQKQSAPQEDNANSVSVSRRL  59

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
             L  T+LIGAAAVGSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+K
Sbjct  60   AL--TLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNK  117

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  118  EVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKT  176



>gb|AFK44592.1| unknown [Lotus japonicus]
Length=259

 Score =   234 bits (598),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 8/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +     S   R V  +KPNQ+VCRAQKQ         +  +A+   
Sbjct  1    MASTQCFLHHHALTTPTRTSS--QRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLAL---  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               T+LIGAAAVGSKVSPADAAYGEAANVFGKPK+NT+FLP  GDGFKL +P+KWNPSKE
Sbjct  56   ---TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPAKWNPSKE  112

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ V++T TDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  113  REFPGQVLRYEDNFDATSNVSVIITATDKKSITDYGSPEEFLSKVDYLLGKQAFFGQT  170



>sp|O49080.1|PSBP_FRIAG RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04809.1| photosystem II oxygen evolving complex protein 2 precursor [Fritillaria 
agrestis]
Length=264

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpss-sNRYVPVLKPNQLVCRAQKQsasaheddaassvavsr  212
            MAS+ CF LHH   +      + S+R VP +KP+QL+CRAQK S +      A S  ++ 
Sbjct  1    MASSACFLLHHAPSTPATTSRTPSHRLVPTIKPSQLICRAQKSSDTDENSSTAVSRRLAL  60

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                T+LIG+AAVG+K++PA+AAYGEAANVFGK KTNT+FLP TGDGF L +P+KWNPSK
Sbjct  61   ----TILIGSAAVGTKIAPANAAYGEAANVFGKAKTNTDFLPYTGDGFNLLIPAKWNPSK  116

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVEFPGQVLRYEDNFD TSN+ V VTPT KKSITDYG+PEEFL+ VDYLLGKQAYSGKT
Sbjct  117  EVEFPGQVLRYEDNFDVTSNVSVTVTPTSKKSITDYGTPEEFLSTVDYLLGKQAYSGKT  175



>ref|XP_010093189.1| Oxygen-evolving enhancer protein 2 [Morus notabilis]
 gb|EXB53677.1| Oxygen-evolving enhancer protein 2 [Morus notabilis]
Length=264

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 7/180 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPV--LKPNQLVCRAQKQsasaheddaassvavs  209
            MAST CF  HH   +A    SSS++   V  ++P QL+CRAQKQ+ +  +  A S     
Sbjct  1    MASTSCFLHHHALTAAARSSSSSSQRQLVGNVRPAQLICRAQKQAINDEDGSAMSRRLAL  60

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 T+L GAAA+GSKVSPADAAYGE+AN+FGKPKTNT+FLP  GDGFKL +PSKWNPS
Sbjct  61   -----TILFGAAALGSKVSPADAAYGESANIFGKPKTNTDFLPYNGDGFKLSIPSKWNPS  115

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            KEVE+PGQVLRYEDNFD T+N+ VLVTPTDKKSITDYGSPEEFL++VDYLLGKQAYSGKT
Sbjct  116  KEVEYPGQVLRYEDNFDSTTNVAVLVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKT  175



>ref|NP_001274949.1| oxygen-evolving enhancer protein 2, chloroplastic precursor [Solanum 
tuberosum]
 sp|P93566.1|PSBP_SOLTU RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA67696.1| 23 kDa oxygen evolving protein of photosystem II [Solanum tuberosum]
Length=260

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 139/179 (78%), Gaps = 8/179 (4%)
 Frame = +3

Query  33   IMASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsr  212
            + ASTQCF LH       +   +S+  VP  KPNQL+CRAQKQ  + +  +A S      
Sbjct  1    MAASTQCF-LHQYHALRSSPARTSS--VPSPKPNQLICRAQKQDDANNTSNAVSRRLAL-  56

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                T+LIG AA+GSKVSPADAAYGEAANVFGKPK NT+FLP  GDGFKLQ+P+KWNPSK
Sbjct  57   ----TLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQIPAKWNPSK  112

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            E+EFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQAY GKT
Sbjct  113  EIEFPGQVLRYEDNFDSTSNLMVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKT  171



>emb|CAA41712.1| photosystem II 23 kDa polypeptide [Nicotiana tabacum]
Length=261

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV  LKPNQLVCRAQKQS+   +D  +  V+    L  TVLIGAAA+GSKVSPADAAYG
Sbjct  21   RYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSRRLAL--TVLIGAAAIGSKVSPADAAYG  78

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V V
Sbjct  79   EAANVFGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTV  138

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL QVD+LLGKQAY GKT
Sbjct  139  TPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGKT  172



>gb|AFH58001.1| chloroplast PsbP1 precursor [Nicotiana benthamiana]
Length=265

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 148/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavsr  212
            MASTQCF LHH ALS PAR       VP LKPNQL VCRAQKQSA   ++  + S++   
Sbjct  1    MASTQCF-LHHHALSTPARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSLSLSRRL  59

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
             L  T+LIG+AA+GSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+K
Sbjct  60   AL--TLLIGSAAIGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNK  117

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  118  EVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKT  176



>ref|XP_011100486.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
2, chloroplastic-like [Sesamum indicum]
Length=256

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 141/181 (78%), Gaps = 17/181 (9%)
 Frame = +3

Query  36   MASTQCFYLHHpalsa---parpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MAST C++ HH A+S+       SSS RY  +LKPNQL+CRA                 V
Sbjct  1    MASTACYWHHHAAISSPSAARTSSSSQRYALLLKPNQLICRAX--------------TTV  46

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
            S  +ALTVLIGAAAVGSKVSPADAAYGE+AN+FGKPKTNT+F P TGDGFKL +PSKWNP
Sbjct  47   SCPVALTVLIGAAAVGSKVSPADAAYGESANIFGKPKTNTDFKPYTGDGFKLSIPSKWNP  106

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            S EVE+PGQVLRYEDNFD TSN+ V +TPTDKKSITDYGSPE+FL+QVDYLLGKQAY GK
Sbjct  107  SNEVEYPGQVLRYEDNFDATSNLTVTITPTDKKSITDYGSPEDFLSQVDYLLGKQAYFGK  166

Query  567  T  569
            T
Sbjct  167  T  167



>gb|AFK45562.1| unknown [Lotus japonicus]
Length=195

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   S  +      R V   KPNQ+ C+AQKQ+    +D +  S  ++  
Sbjct  1    MASTQCFLYHHALTSRASSI---QRLVVNTKPNQVFCKAQKQATQEEDDASIVSRRLAL-  56

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVS ADAAYGE+ANVFGKPKTNT+FLP  GDGFKL VPSKWNPSKE
Sbjct  57   ---TVLIGAAAVGSKVSRADAAYGESANVFGKPKTNTDFLPYNGDGFKLSVPSKWNPSKE  113

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  114  VEYTGQVLRYEDNFDSTSNVVVTVTPTDKKSITDYGSPEEFLSKVDYLLGKQAFFGET  171



>ref|XP_009419010.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=260

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     S   R VP+ KPN +VC+AQKQ+A      A S       
Sbjct  1    MASTACFLHHHAPSTTNRIQS--TRLVPINKPNLIVCKAQKQAADDENSAAVSRRMAL--  56

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVL+GAAA+G+KV+PADAAYGEAANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  57   ---TVLLGAAALGAKVAPADAAYGEAANVFGKPKTNTDFLPYAGDGFKLMIPSKWNPSKE  113

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD  SN+ V+VTPT K +IT YG+PEEFL+QVDYLLGKQAYSGKT
Sbjct  114  VEYPGQVLRYEDNFDSNSNVTVMVTPTTKSTITGYGTPEEFLSQVDYLLGKQAYSGKT  171



>emb|CDP17859.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   233 bits (593),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     S   RYV  LKPNQLVCRAQKQ+    +D   ++V+    
Sbjct  1    MASTACFLHHHAITTPARTSS--QRYVLPLKPNQLVCRAQKQTVQEEDDSNVAAVSRRLA  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            L  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNT+++P  G GFKL +PSKWNPSKE
Sbjct  59   L--TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDYIPYNGAGFKLSIPSKWNPSKE  116

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VEFPGQVLRYEDNFD  S++ V++ P DKKSITDYG PEEFL++VDYLLGKQ Y+GKT
Sbjct  117  VEFPGQVLRYEDNFDSNSSVSVIIIPCDKKSITDYGPPEEFLSKVDYLLGKQVYAGKT  174



>gb|KHN28540.1| Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja]
Length=265

 Score =   232 bits (592),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +     +   R V   KPN +VC+A ++  +  E +  ++  VSRR
Sbjct  1    MASTQCFLHHHALTTPARAST--QRLVVSTKPNHIVCKAAQKQVTVQEGEDTTTGLVSRR  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            LALTVLIGAAAVGSKV+PADAAYGEAANVFGKPKTNT+FL   G+GFKL +PSKWNPSKE
Sbjct  59   LALTVLIGAAAVGSKVAPADAAYGEAANVFGKPKTNTDFLSYNGNGFKLSIPSKWNPSKE  118

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V+VT TDKKSITDYGSPEEFL+QVDYLLGKQA+ G+T
Sbjct  119  VEYPGQVLRYEDNFDSTSNVAVMVTATDKKSITDYGSPEEFLSQVDYLLGKQAFFGQT  176



>gb|AFK39738.1| unknown [Lotus japonicus]
Length=259

 Score =   232 bits (592),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 8/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +     S   R V  +K NQ+VCRAQKQ         +  +A+   
Sbjct  1    MASTQCFLHHHALTTPTRTSS--QRQVVSIKSNQIVCRAQKQQDVEDVSPVSRRLAL---  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               T+LIGAAAVGSKVSPADAAYGEAANVFGKPK+NT+FLP  GDGFKL +P+KWNPSKE
Sbjct  56   ---TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPAKWNPSKE  112

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ V++T TDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  113  REFPGQVLRYEDNFDATSNVSVIITATDKKSITDYGSPEEFLSKVDYLLGKQAFFGQT  170



>ref|NP_001234109.1| oxygen-evolving enhancer protein 2, chloroplastic [Solanum lycopersicum]
 sp|P29795.1|PSBP_SOLLC RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA44736.1| photosystem II 23 kDa protein [Solanum lycopersicum]
Length=258

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 137/179 (77%), Gaps = 10/179 (6%)
 Frame = +3

Query  33   IMASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsr  212
            + ASTQCF LH       +   +S+   P  KPNQL+CRAQKQ  +++   +        
Sbjct  1    MAASTQCF-LHQYHALRSSPARTSSVSSP--KPNQLICRAQKQDDASNAAVSRRLAL---  54

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                T+LIG AA+GSKVSPADAAYGEAANVFGKPK NT+FLP  GDGFKLQVP+KWNPSK
Sbjct  55   ----TLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQVPAKWNPSK  110

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQAY GKT
Sbjct  111  EVEYPGQVLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKT  169



>ref|XP_002283048.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010657102.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CAN60827.1| hypothetical protein VITISV_001116 [Vitis vinifera]
Length=259

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 137/176 (78%), Gaps = 7/176 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     S   R +P L+P+QLVCRAQKQ+A+  +  A S       
Sbjct  1    MASTACFLHHHALSTPTRVSS--QRQLPSLRPSQLVCRAQKQAANEDDGAAVSRRLAL--  56

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+G+KV+PADAAYGEAANVFGKPKTNT+FLP  G+GFKL +PSKWNPSKE
Sbjct  57   ---TVLIGAAAIGTKVNPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSKE  113

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++VD+LLGKQA+ G
Sbjct  114  REFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDFLLGKQAFFG  169



>ref|XP_011026206.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Populus euphratica]
Length=262

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 134/173 (77%), Gaps = 5/173 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     SSS R V  LKP+QLVCRAQKQ+    ++   S       
Sbjct  1    MASTACFLHHHALATPARSTSSSQRQVVNLKPSQLVCRAQKQAVQEEDEGVVSRRWAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+GSKV+PADAAYGE+AN+FGKPKTNT+FLP  GDGFKL +P+KWNPSKE
Sbjct  59   ---TVLIGAAALGSKVAPADAAYGESANIFGKPKTNTDFLPYNGDGFKLSIPAKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQA  554
             EFPGQVLRYEDNFD TSN+ V+V PTDKKSITDYGSPEEFL++VDYLLGKQ+
Sbjct  116  REFPGQVLRYEDNFDATSNVSVMVIPTDKKSITDYGSPEEFLSKVDYLLGKQS  168



>ref|XP_010680144.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=265

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 148/180 (82%), Gaps = 6/180 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsa-parpsssNRYVPV-LKPNQLVCRAQKQsasaheddaassvavs  209
            MAST CF  HH A+S+  A  +S+ RY  V +KP Q+VC+AQKQ   A+  +A+ S  ++
Sbjct  1    MASTACFLHHHAAISSPAAGRTSAQRYQAVSIKPTQIVCKAQKQDDEANVLNASVSRRLA  60

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNT+FLP  GDGFKL VP+KWNPS
Sbjct  61   L----TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKLLVPAKWNPS  116

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            +EVE+PGQVLR+EDNFD TSN+ V+VTPTDKKSITDYGSPE+FL++V+YLLGKQAY G+T
Sbjct  117  REVEYPGQVLRFEDNFDATSNLTVMVTPTDKKSITDYGSPEKFLSEVNYLLGKQAYFGQT  176



>gb|KJB75386.1| hypothetical protein B456_012G039400 [Gossypium raimondii]
 gb|KJB75387.1| hypothetical protein B456_012G039400 [Gossypium raimondii]
Length=262

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 134/181 (74%), Gaps = 11/181 (6%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPV--LKPNQ-LVCRAQKQsasaheddaassvav  206
            MAS  CF  HH   +     S S     V  +KPNQ +VC+AQKQ           ++  
Sbjct  1    MASAACFLHHHALTTNGRSSSLSPSLRQVSNMKPNQQVVCKAQKQEDDGSLVSRRLAL--  58

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
                  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKT+TEF+P  GDGFKL +PSKWNP
Sbjct  59   ------TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTEFMPYNGDGFKLSIPSKWNP  112

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V++TPTDKKSITDYGSPEEFL+ VDYLLGKQAY GK
Sbjct  113  SKEVEFPGQVLRYEDNFDTTSNLSVMITPTDKKSITDYGSPEEFLSSVDYLLGKQAYFGK  172

Query  567  T  569
            T
Sbjct  173  T  173



>ref|XP_003545316.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic-like 
[Glycine max]
 gb|ACJ61477.1| oxygen-evolving enhancer protein 2 [Glycine max]
 gb|KHN11997.1| Oxygen-evolving enhancer protein 2-2, chloroplastic [Glycine 
soja]
Length=264

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 3/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +  +  S S R +   KPNQLVC+AQKQ     + D +        
Sbjct  1    MASTQCFLHHHALTTPASARSPSLRILVSTKPNQLVCKAQKQQTPQEDIDVSPISRRLAL  60

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV PADAAYGEAANVFGKPKT+T+FLP  GDGFKL +PSKWNPSKE
Sbjct  61   ---TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTDTDFLPYNGDGFKLSIPSKWNPSKE  117

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQV+RYEDNFD T+N+ V +TPTDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  118  VEYTGQVVRYEDNFDSTTNVVVTITPTDKKSITDYGSPEEFLSKVDYLLGKQAFFGET  175



>ref|XP_007048926.1| Photosystem II subunit P-1 [Theobroma cacao]
 gb|EOX93083.1| Photosystem II subunit P-1 [Theobroma cacao]
Length=268

 Score =   230 bits (586),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 139/185 (75%), Gaps = 13/185 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss-------NRYVPVLKPNQLVCRAQKQsasaheddaas  194
            MAST CF LHH AL+   R SS         R V  +KP+QLVCRAQKQ+    +    S
Sbjct  1    MASTACF-LHHRALTTATRSSSPSPSPSPSQRQVANIKPSQLVCRAQKQAVQEDDGSLVS  59

Query  195  svavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPS  374
                      TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNT+FL I GDGFKL +PS
Sbjct  60   RRMAL-----TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLTINGDGFKLSIPS  114

Query  375  KWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQA  554
            KWNPSKEVEFPGQV+RYEDNFD  S + V+VTPTDKKSITD+GSPE+FLA VDYLLGKQA
Sbjct  115  KWNPSKEVEFPGQVVRYEDNFDPNSYVAVMVTPTDKKSITDFGSPEQFLANVDYLLGKQA  174

Query  555  YSGKT  569
            Y+G T
Sbjct  175  YAGVT  179



>ref|XP_009619867.1| PREDICTED: oxygen-evolving enhancer protein 2-3, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q04127.1|PSBP3_TOBAC RecName: Full=Oxygen-evolving enhancer protein 2-3, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA44293.1| 23-kDa polypeptide of photosystem II oxygen-evolving complex 
[Nicotiana tabacum]
Length=266

 Score =   230 bits (586),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 145/179 (81%), Gaps = 3/179 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavsr  212
            MASTQCF LHH ALS PAR S     VP LK NQL VCRAQ + ++  +D+  S     R
Sbjct  1    MASTQCF-LHHHALSTPARTSLVRGIVPSLKSNQLLVCRAQNKQSAPQQDNVNSVSVSRR  59

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                T+LIGAAAVGSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+K
Sbjct  60   LAL-TLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNK  118

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  119  EVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKT  177



>ref|XP_002300858.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
 gb|ABK95552.1| unknown [Populus trichocarpa]
 gb|EEE80131.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
Length=262

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 132/173 (76%), Gaps = 5/173 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     SSS R V  LKP QLVCRAQKQ+    +D   S       
Sbjct  1    MASTACFLHHHALTTPARSTSSSQRQVVNLKPAQLVCRAQKQAVQEEDDGVVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+GSKV+PADAAYGE+AN+FGKPKTNT+FLP  GDGFKL VP+KWNPSKE
Sbjct  59   ---TVLIGAAALGSKVAPADAAYGESANIFGKPKTNTDFLPYNGDGFKLSVPAKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQA  554
             EFPGQVLRYEDNFD TSN+ V+VTPTD KSI DYGSPEEFL++VDYLLGKQ+
Sbjct  116  REFPGQVLRYEDNFDATSNLSVMVTPTDTKSIADYGSPEEFLSKVDYLLGKQS  168



>gb|KCW89790.1| hypothetical protein EUGRSUZ_A02039 [Eucalyptus grandis]
Length=191

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF+ H+   +    PS   R  P  KP Q+ CRAQKQ+A   E  AA        
Sbjct  1    MASTTCFFHHNKLTTPARTPS--QRSAPSFKPAQVACRAQKQAAGEEESGAAEVSRRLAL  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNT+FLP  G+GF L +P+KWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGNGFTLLIPAKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V+VTPTDKK+ITD+GSPE FLA+V+YLLGKQAY GKT
Sbjct  116  VEYPGQVLRYEDNFDTTSNVSVMVTPTDKKAITDFGSPENFLAEVNYLLGKQAYFGKT  173



>ref|XP_011032754.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Populus euphratica]
Length=262

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 134/173 (77%), Gaps = 5/173 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +      SS R V  LKP QLVCRAQKQ+    ++ A S   V   
Sbjct  1    MASTSCFLHHHALTTPARSTPSSQRQVANLKPTQLVCRAQKQAVQEEDNGAVSRRLVL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+GSKV+PADAAYGE+AN+FGKPKT+T+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAALGSKVAPADAAYGESANIFGKPKTDTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQA  554
             EFPGQVLRYEDNFD TSN+ V+V PTDKKSITDYGSPEEFL++VD+LLGKQ+
Sbjct  116  REFPGQVLRYEDNFDATSNVSVMVIPTDKKSITDYGSPEEFLSKVDFLLGKQS  168



>sp|P16059.1|PSBP_PEA RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33557.1| unnamed protein product [Pisum sativum]
 dbj|BAA02553.1| precursor for 23-kDa protein of photosystem II [Pisum sativum]
Length=259

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 131/178 (74%), Gaps = 8/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF LHH         + S R V   KPN +VC+AQKQ        +         
Sbjct  1    MASTQCF-LHHQYAITTPTRTLSQRQVVTTKPNHIVCKAQKQDDVVDAVVSRRLAL----  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               +VLIGAAAVGSKVSPADAAYGEAANVFGK KTNT++LP  GDGFKL VP+KWNPSKE
Sbjct  56   ---SVLIGAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKE  112

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ VLV  TDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  113  REFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQT  170



>ref|XP_010906959.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Elaeis guineensis]
Length=260

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 134/178 (75%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   ++       +R +P  +P QLVCRA KQ+    E +   S  ++  
Sbjct  1    MASTSCFLHHHAPSTSRTPS---SRPMPSTRPTQLVCRAHKQAGQEDESNTVVSRRLAL-  56

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVL+GAAAV  KVSPADAAYGEAAN+FGKPKTNT+FL   GDGFKL VPSKWNPSKE
Sbjct  57   ---TVLVGAAAVSVKVSPADAAYGEAANIFGKPKTNTDFLTYAGDGFKLMVPSKWNPSKE  113

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQV+RYEDNFD  S +CV+VTPT  KSITDYGSPEEFL+QVDYLLGKQAY+GKT
Sbjct  114  VEYPGQVMRYEDNFDSNSYVCVMVTPTSNKSITDYGSPEEFLSQVDYLLGKQAYAGKT  171



>ref|XP_002307570.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
 gb|ABK95873.1| unknown [Populus trichocarpa]
 gb|EEE94566.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
Length=262

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 132/173 (76%), Gaps = 5/173 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +      SS R V  LKP QL CRAQKQ+    ++ A S       
Sbjct  1    MASTSCFLHHHALTTPARSTPSSQRQVANLKPTQLACRAQKQAVQEEDNGAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+GSKV+PADAAYGE+AN+FGKPKT+T+FLP  GDGFKL VPSKWNPSKE
Sbjct  59   ---TVLIGAAALGSKVAPADAAYGESANIFGKPKTDTDFLPYNGDGFKLSVPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQA  554
             EFPGQVLRYEDNFD TSN+ V+V PTDKKSITDYGSPEEFL++VD+LLGKQ+
Sbjct  116  REFPGQVLRYEDNFDATSNVSVMVIPTDKKSITDYGSPEEFLSKVDFLLGKQS  168



>ref|NP_001276136.1| oxygen-evolving enhancer protein 2, chloroplastic-like [Glycine 
max]
 gb|ACU18270.1| unknown [Glycine max]
Length=265

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +     +   R V   KPN +VC+A ++  +  E +  ++  VSRR
Sbjct  1    MASTQCFLHHHALTTPARAST--QRLVVSTKPNHIVCKAVQKQVTVQEGEDTTTGLVSRR  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            LALTVLIGAAAVGSKV+PADAAYGEAANVFGKPKTNT+FL   G+GFK  +PSKWNPSKE
Sbjct  59   LALTVLIGAAAVGSKVAPADAAYGEAANVFGKPKTNTDFLSYNGNGFKPSIPSKWNPSKE  118

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V+VT TDKKSITDYGSPEEFL+QVDYLLGKQA+ G+T
Sbjct  119  VEYPGQVLRYEDNFDSTSNVAVMVTATDKKSITDYGSPEEFLSQVDYLLGKQAFFGQT  176



>ref|XP_007215827.1| hypothetical protein PRUPE_ppa010093mg [Prunus persica]
 gb|EMJ17026.1| hypothetical protein PRUPE_ppa010093mg [Prunus persica]
Length=264

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 141/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLV-CRAQKQsasaheddaassvavsr  212
            MAST CF  HH   +A AR SSS R V  +K NQ+V CRAQKQ+    +     S  ++ 
Sbjct  1    MASTACFLHHHALTTASARSSSSQRQVVNVKQNQIVICRAQKQAVQEEDGAVNVSRRLAL  60

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                TVLIGAAA+GSKVSPADAAYGE+ANVFGKPKTNT+FLP  G+GFKL +P+KWNPSK
Sbjct  61   ----TVLIGAAALGSKVSPADAAYGESANVFGKPKTNTDFLPYVGEGFKLSIPAKWNPSK  116

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLRYEDNFD TSN+ V +TPTDKKSITDYGSPEEFL +VDYLLGKQAY GKT
Sbjct  117  EVEYPGQVLRYEDNFDTTSNVAVTITPTDKKSITDYGSPEEFLTKVDYLLGKQAYFGKT  175



>gb|ACU23674.1| unknown [Glycine max]
Length=264

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 3/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   S  +  S S R +   KPNQLVC+AQKQ     + D +        
Sbjct  1    MASTQCFLHHHALTSPASARSPSLRILVSTKPNQLVCKAQKQQTPQEDIDVSPISRRLAL  60

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV PADAAYGEAANVFGKPKT+T+FLP  GDGFKL +PSKWNPSKE
Sbjct  61   ---TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTDTDFLPYNGDGFKLSIPSKWNPSKE  117

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQV+RYEDNFD T+N+ V +TPTDKKSITDYGS EEFL++VDYLLGKQA+ G+T
Sbjct  118  VEYTGQVVRYEDNFDSTTNVVVTITPTDKKSITDYGSSEEFLSKVDYLLGKQAFFGET  175



>ref|XP_010054080.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Eucalyptus grandis]
 gb|KCW89789.1| hypothetical protein EUGRSUZ_A02039 [Eucalyptus grandis]
Length=262

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF+ H+   +    PS   R  P  KP Q+ CRAQKQ+A   E  AA        
Sbjct  1    MASTTCFFHHNKLTTPARTPS--QRSAPSFKPAQVACRAQKQAAGEEESGAAEVSRRLAL  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNT+FLP  G+GF L +P+KWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGNGFTLLIPAKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V+VTPTDKK+ITD+GSPE FLA+V+YLLGKQAY GKT
Sbjct  116  VEYPGQVLRYEDNFDTTSNVSVMVTPTDKKAITDFGSPENFLAEVNYLLGKQAYFGKT  173



>ref|XP_003519527.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Glycine max]
 gb|KHN38354.1| Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja]
Length=258

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 133/178 (75%), Gaps = 9/178 (5%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +    PS   R +   KPNQLVC+AQKQ        +         
Sbjct  1    MASTQCFLHHHALTTPARSPS--QRIMVSTKPNQLVCKAQKQEDIDVSPISRRLAL----  54

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV PADAAYGEAANVFGKPKT+T+FLP  GDGFKL +PSKWNPSKE
Sbjct  55   ---TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTDTDFLPYNGDGFKLSIPSKWNPSKE  111

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQV+RYEDNFD T+N+ V +TPTDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  112  VEYTGQVVRYEDNFDSTTNVVVTITPTDKKSITDYGSPEEFLSKVDYLLGKQAFFGET  169



>gb|KHG22094.1| Oxygen-evolving enhancer 2-1, chloroplastic [Gossypium arboreum]
Length=262

 Score =   228 bits (580),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 134/181 (74%), Gaps = 11/181 (6%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPV--LKPNQ-LVCRAQKQsasaheddaassvav  206
            MAS  CF  HH   +     S S     V  +KP Q +VC+AQKQ           ++  
Sbjct  1    MASAACFLHHHALTTNGRSSSLSPSLRQVSNMKPTQQVVCKAQKQEDDGSLVSRRLAL--  58

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
                  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKT+T+F+P +GDGFKL +PSKWNP
Sbjct  59   ------TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFMPYSGDGFKLSIPSKWNP  112

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKEVEFPGQVLRYEDNFD TSN+ V++TPTDKKSITDYGSPEEFL+ VDYLLGKQAY GK
Sbjct  113  SKEVEFPGQVLRYEDNFDTTSNLSVMITPTDKKSITDYGSPEEFLSSVDYLLGKQAYFGK  172

Query  567  T  569
            T
Sbjct  173  T  173



>ref|XP_008229592.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Prunus mume]
Length=264

 Score =   227 bits (579),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLV-CRAQKQsasaheddaassvavsr  212
            MAST CF  HH   +A AR SSS R V  +K NQ+V CRAQKQ+A   +     S  ++ 
Sbjct  1    MASTACFLHHHALTTASARSSSSQRQVVNVKQNQIVICRAQKQAAQEEDGAVNVSRRLAL  60

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                TVLIGAAA+GSKVSPADAAYGE+ANVFGKPKTNT+FLP  G+GFKL +P+KWNPSK
Sbjct  61   ----TVLIGAAALGSKVSPADAAYGESANVFGKPKTNTDFLPYVGEGFKLSIPAKWNPSK  116

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVE+PGQVLRYEDNFD TSN+ V +TPTDKK+ITDYGSPEEFL +VDYLLGKQAY GKT
Sbjct  117  EVEYPGQVLRYEDNFDTTSNVAVTITPTDKKAITDYGSPEEFLTKVDYLLGKQAYFGKT  175



>gb|KJB71514.1| hypothetical protein B456_011G126200 [Gossypium raimondii]
Length=295

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query  27   RAIMASTQCFYLHHpalsa----parpsssNRYVPVLKPNQLV-CRAQKQsasaheddaa  191
            RA MAST CF  HH   SA       PS+S R V ++K NQL+ C +QKQ+   ++D  +
Sbjct  22   RAAMASTACFLHHHALTSAPRSSSTPPSTSQRQVAIVKSNQLLACTSQKQAVQENDDSGS  81

Query  192  ssvavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVP  371
            +++   R    T+LIG AAVGSKVSPADAAYGEAANVFGKPKTNTEF+P  G+GFKL +P
Sbjct  82   NALISRRLAL-TLLIGTAAVGSKVSPADAAYGEAANVFGKPKTNTEFIPYNGEGFKLSIP  140

Query  372  SKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQ  551
            SKWNPSKEVE+PGQVLRYEDNFD T+N+ V+VTPTDKKSITD+GSPE FL++VDYLLGKQ
Sbjct  141  SKWNPSKEVEYPGQVLRYEDNFDSTTNVAVMVTPTDKKSITDFGSPENFLSKVDYLLGKQ  200

Query  552  AYSGKT  569
            AYSG T
Sbjct  201  AYSGLT  206



>gb|ABQ41911.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia ovata]
Length=233

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 122/154 (79%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V   +  Q VCRAQKQ++   +    S          TVLIGAAAVGSKVSPADAAYG
Sbjct  16   RHVANSRSTQTVCRAQKQTSGEEDVAVVSRRLAL-----TVLIGAAAVGSKVSPADAAYG  70

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNTEFLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  71   EAANVFGKPKTNTEFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMV  130

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSI DYGSPEEFL +VDYLLGKQAY G T
Sbjct  131  TPTDKKSIADYGSPEEFLLKVDYLLGKQAYFGNT  164



>gb|ABQ41909.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia alba]
Length=234

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 133/170 (78%), Gaps = 6/170 (4%)
 Frame = +3

Query  60   LHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIG  239
            LHH +L+ PAR SS  RYV   +  Q VCRAQKQ++   +    S          TVLIG
Sbjct  1    LHHLSLTTPARTSSP-RYVVNSRSTQTVCRAQKQTSGEEDVAVVSRRLAL-----TVLIG  54

Query  240  AAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVL  419
            AAAVGSKVSPADAAYGEAANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVL
Sbjct  55   AAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKLNIPSKWNPSKEVEYPGQVL  114

Query  420  RYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            RYEDNFD TSN+ V+VTPTDKKSI DYGSPEEFL +VDYLLGKQAY G T
Sbjct  115  RYEDNFDSTSNVAVMVTPTDKKSIADYGSPEEFLLKVDYLLGKQAYFGNT  164



>gb|ABQ41910.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia caseolaris]
Length=233

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 122/154 (79%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV   +  Q VCRAQKQ++   +    S          TVLIGAAAVGSKVSPADAAYG
Sbjct  16   RYVVNSRSTQTVCRAQKQTSGEEDVAVVSRRLAL-----TVLIGAAAVGSKVSPADAAYG  70

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  71   EAANVFGKPKTNTDFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMV  130

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSI DYGSPEEFL +VDYLLGKQAY G T
Sbjct  131  TPTDKKSIADYGSPEEFLLKVDYLLGKQAYFGNT  164



>gb|KDP36279.1| hypothetical protein JCGZ_10289 [Jatropha curcas]
Length=264

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +  +  S S R V   KP QL+CRA  Q   A +D+  S   VSRR
Sbjct  1    MASTSCFLHHHALTNRLSSSSLSQRQVS--KPTQLICRAT-QKQQAAQDEDISLSLVSRR  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            LALTVLIGAAAVGSKV+PADAAYGE+ANVFGKPKTNT+FLP +G+GFK+ +PSKWNPSKE
Sbjct  58   LALTVLIGAAAVGSKVAPADAAYGESANVFGKPKTNTDFLPYSGEGFKVLIPSKWNPSKE  117

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD  SN+ V++ PTDKKSITDYGSPEEFLAQV++LLGKQAY GKT
Sbjct  118  VEYPGQVLRYEDNFDSNSNLSVMIIPTDKKSITDYGSPEEFLAQVNFLLGKQAYFGKT  175



>gb|KHG20721.1| Oxygen-evolving enhancer 2-3, chloroplastic [Gossypium arboreum]
Length=271

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 144/183 (79%), Gaps = 6/183 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsa----parpsssNRYVPVLKPNQLV-CRAQKQsasaheddaassv  200
            MAST CF  HH   SA       PS+S R V ++K NQL+ C +QKQ+   +++  +S+V
Sbjct  1    MASTACFLHHHALTSAPRSSSTPPSTSQRQVAIVKSNQLLACISQKQAVQENDNSRSSAV  60

Query  201  avsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKW  380
               R    T+LIG AAVGSKVSPADAAYGEAANVFGKPKTNTEF+P  G+GFKL +PSKW
Sbjct  61   ISRRLAL-TLLIGPAAVGSKVSPADAAYGEAANVFGKPKTNTEFIPYNGEGFKLSIPSKW  119

Query  381  NPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYS  560
            NPSKEVE+PGQVLRYEDNFD T+N+ V+VTPTDKKSITD+GSPE FL++VDYLLGKQAYS
Sbjct  120  NPSKEVEYPGQVLRYEDNFDSTTNVAVMVTPTDKKSITDFGSPENFLSKVDYLLGKQAYS  179

Query  561  GKT  569
            G T
Sbjct  180  GLT  182



>gb|ACJ84745.1| unknown [Medicago truncatula]
 gb|KEH33649.1| oxygen-evolving enhancer protein 2-1 [Medicago truncatula]
Length=261

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 130/178 (73%), Gaps = 6/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF LH          S S R +   KPN +VC+AQKQ          S       
Sbjct  1    MASTQCF-LHPQYALTTPSRSLSQRQIVTNKPNHIVCKAQKQDVEDVAVSVVSRRLAL--  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               +VL+GAAAVGSKVSPADAAYGEAANVFGK KTNT+FLP  GDGFKL VP+KWNPSKE
Sbjct  58   ---SVLLGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYNGDGFKLLVPAKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ VLV  TDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  115  REFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQT  172



>ref|XP_004147746.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004161551.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Cucumis sativus]
 sp|Q9SLQ8.1|PSBP_CUCSA RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; AltName: 
Full=OEC23; Flags: Precursor [Cucumis sativus]
 dbj|BAA89317.1| 23kDa polypeptide of the oxygen-evolving complex of photosystem 
II [Cucumis sativus]
 gb|KGN53510.1| Oxygen-evolving enhancer protein 2 [Cucumis sativus]
Length=263

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 134/178 (75%), Gaps = 4/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +A    SS  +      P  LVCRAQKQ  +  E+    S  ++  
Sbjct  1    MASTSCFLHHHALTAAARSSSSPRQAALPKSPQLLVCRAQKQQPAQEEEGGVVSRRLAL-  59

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+GSKVSPADAAYGEAANVFGKPK+NT++LP +GDGFKL +PSKWNPSKE
Sbjct  60   ---TVLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPSKWNPSKE  116

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PTDKKSI D+GSPEEFL++VDYLLGKQAY GKT
Sbjct  117  REFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFGSPEEFLSKVDYLLGKQAYFGKT  174



>ref|XP_004499534.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  H  AL+ P    SS R +   KPN +VC+AQK      +DDA S V+    
Sbjct  1    MASTQCFLHHQYALTTPTTRISSQRQIVSTKPNIVVCKAQKHVVQEDDDDAVSFVSRRLA  60

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
            L  +VLIGAAAV SK SPADAAYGEAANVFG+PKTNT+FLP  GDGFKL VPSKWNPSKE
Sbjct  61   L--SVLIGAAAVTSKASPADAAYGEAANVFGRPKTNTDFLPYNGDGFKLLVPSKWNPSKE  118

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ V+VT TDKKSITD+GSPEEFL++VDYLLGKQ+Y G+T
Sbjct  119  REFPGQVLRYEDNFDATSNVSVMVTATDKKSITDFGSPEEFLSKVDYLLGKQSYFGQT  176



>ref|XP_008380167.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Malus domestica]
Length=268

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 139/182 (76%), Gaps = 7/182 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQ----LVCRAQKQsasaheddaassva  203
            MAST CF  HH   +A +  SSS+    V+  N+    ++CRAQKQ+A   E+  A+   
Sbjct  1    MASTACFLHHHALTTAASARSSSSSQRQVVNINKHNQVVICRAQKQAAGQEEESGANVSR  60

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                   TVLIGAAA+GSKVSPADAAYGE+ANVFGKPK+NT+FLP  G+GFKL +P+KWN
Sbjct  61   RLAL---TVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGEGFKLSIPAKWN  117

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PSKEVEFPGQVLRYEDNFD  SN+ V +TPTDKKSI DYGSPEEFLA+VDYLLGKQAY G
Sbjct  118  PSKEVEFPGQVLRYEDNFDSNSNVSVTITPTDKKSIADYGSPEEFLAKVDYLLGKQAYFG  177

Query  564  KT  569
            KT
Sbjct  178  KT  179



>gb|ACS68649.1| 23 kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia alba]
 gb|ACS68719.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II, partial [Sonneratia alba]
Length=214

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 122/154 (79%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV   +  Q VCRAQKQ++   +    S          TVLIGAAAVGSKVSPADAAYG
Sbjct  7    RYVVNSRSTQTVCRAQKQTSGEEDVAVVSRRLAL-----TVLIGAAAVGSKVSPADAAYG  61

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+FLP  GDGFKL +PSKW+PSKEVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  62   EAANVFGKPKTNTDFLPYNGDGFKLNIPSKWSPSKEVEYPGQVLRYEDNFDSTSNVAVMV  121

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSI DYGSPEEFL +VDYLLGKQAY G T
Sbjct  122  TPTDKKSIADYGSPEEFLLKVDYLLGKQAYFGNT  155



>ref|XP_008451840.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Cucumis melo]
Length=263

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +A    SS  +  P      LVCRAQKQ  +  E+    S  ++  
Sbjct  1    MASTSCFLHHHALTAAARSSSSPRQVAPPKSAQLLVCRAQKQQPAQEEEGGVVSRRLAL-  59

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAA+GSKVSPADAAYGEAANVFGKPKTNT++LP  GDGFKL +PSKWNPSKE
Sbjct  60   ---TVLIGAAALGSKVSPADAAYGEAANVFGKPKTNTDYLPYNGDGFKLSIPSKWNPSKE  116

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PTDKK+I D+GSPE+FL++VDYLLGKQAY GKT
Sbjct  117  REFPGQVLRYEDNFDSNSNLSVIINPTDKKTIKDFGSPEDFLSKVDYLLGKQAYFGKT  174



>gb|KDO44764.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
 gb|KDO44765.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=223

 Score =   221 bits (563),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 130/165 (79%), Gaps = 5/165 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQV  530
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++V
Sbjct  116  REFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKV  160



>gb|AAX53162.1| chloroplast photosynthetic oxygen-evolving protein 23 kDa subunit 
[Nicotiana benthamiana]
Length=261

 Score =   222 bits (566),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +3

Query  48   QCFYLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavsrrlal  224
            QCF LH  ALS PAR       VP LKPNQL VCRAQKQSA   ++  + S++    L  
Sbjct  1    QCF-LHQHALSTPARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSLSLSRRLAL--  57

Query  225  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF  404
            T+LIG+AA+GSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+
Sbjct  58   TLLIGSAAIGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEY  117

Query  405  PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  118  PGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKT  172



>gb|AFK45301.1| unknown [Medicago truncatula]
Length=261

 Score =   222 bits (565),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 129/178 (72%), Gaps = 6/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF LH          S S R +   KPN +VC+AQKQ          S       
Sbjct  1    MASTQCF-LHPQYALTTPSRSLSQRQIVTNKPNHIVCKAQKQDVEDVAVSVVSRRLAL--  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               +VL+GAAAVGSKVSPAD AYGEAANVFGK KTNT+FLP  GDGFKL VP+KWNPSKE
Sbjct  58   ---SVLLGAAAVGSKVSPADTAYGEAANVFGKAKTNTDFLPYNGDGFKLLVPAKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ VLV  TDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  115  REFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQT  172



>ref|XP_006437084.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
 gb|ESR50324.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
Length=195

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 130/165 (79%), Gaps = 5/165 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQV  530
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++V
Sbjct  116  REFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKV  160



>gb|ABQ41912.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia apetala]
Length=233

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 121/154 (79%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V   +  Q VC AQKQ++   +    S          TVLIGAAAVGSKVSPADAAYG
Sbjct  16   RHVVNSRSTQTVCWAQKQTSGEEDVAVVSRRLAL-----TVLIGAAAVGSKVSPADAAYG  70

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNTEFLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  71   EAANVFGKPKTNTEFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMV  130

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSI DYGSPEEFL +VDYLLGKQAY G T
Sbjct  131  TPTDKKSIADYGSPEEFLLKVDYLLGKQAYFGNT  164



>dbj|BAE71271.1| putative PSII-P protein [Trifolium pratense]
Length=261

 Score =   219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 130/174 (75%), Gaps = 5/174 (3%)
 Frame = +3

Query  48   QCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalT  227
            QCF LHH         S S R +   KPN +VC+AQKQ        +  S  ++     +
Sbjct  4    QCF-LHHQYALTTPSRSLSQRQIVSTKPNHIVCKAQKQDDDDVAAVSFVSRRLAL----S  58

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            V++GAAAVGSKVSPADAAYGEAANVFGK KTNT+FLP  GDGFKL VP+KWNPSKE EFP
Sbjct  59   VILGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYNGDGFKLLVPAKWNPSKEREFP  118

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            GQVLRYEDNFD TSN+ V+V  TDKKSITDYGSPE+FLAQVDYLLGKQA+ G+T
Sbjct  119  GQVLRYEDNFDATSNVSVIVQTTDKKSITDYGSPEQFLAQVDYLLGKQAFFGQT  172



>dbj|BAG70022.1| 23 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=265

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 140/180 (78%), Gaps = 6/180 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpss-sNRYVPV-LKPNQLVCRAQKQsasaheddaassvavs  209
            MAST CF  HH A+S PA   + + +Y  V +KPNQ+VC+ QKQ   A   +++ S  ++
Sbjct  1    MASTACFLHHHAAISGPASARNPAQKYQAVSMKPNQIVCKVQKQDDEAQALNSSVSRRLA  60

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 TVLIGAAAVGSKVSPADAAYGEAANVFGKPK +TEF    GDGFKL VPSKWN S
Sbjct  61   L----TVLIGAAAVGSKVSPADAAYGEAANVFGKPKKDTEFSSYNGDGFKLLVPSKWNKS  116

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            KEVE+PGQVLR+EDNFD TSN+ V+V+ TDKKSITD+GSPE+FL QVDYLLGKQAY G+T
Sbjct  117  KEVEYPGQVLRFEDNFDATSNLAVMVSSTDKKSITDFGSPEQFLGQVDYLLGKQAYFGQT  176



>ref|XP_002521576.1| Oxygen-evolving enhancer protein 2, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40847.1| Oxygen-evolving enhancer protein 2, chloroplast precursor, putative 
[Ricinus communis]
Length=265

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 139/181 (77%), Gaps = 8/181 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsap--arpsssNRYVP-VLKPNQLVCRAQKQsasaheddaassvav  206
            MA+T CF LHHPAL++      S S R V    KP Q +CRA  +     ED +  S  +
Sbjct  1    MATTGCF-LHHPALTSTPNRLSSVSQRQVSNTTKPTQFICRASTKQPLQEEDLSLVSRRL  59

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
            +     TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNT+F+P  GDGF+L VPSKWNP
Sbjct  60   AL----TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFMPYNGDGFQLSVPSKWNP  115

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            SKE EFPGQVLRYEDNFD  SN+ V++TPTDKKSITD+G+PEEFLA+VDYLLGKQAY GK
Sbjct  116  SKEREFPGQVLRYEDNFDSNSNLSVMITPTDKKSITDFGTPEEFLAKVDYLLGKQAYFGK  175

Query  567  T  569
            T
Sbjct  176  T  176



>ref|NP_172153.1| photosystem II subunit P-1 [Arabidopsis thaliana]
 sp|Q42029.2|PSBP1_ARATH RecName: Full=Oxygen-evolving enhancer protein 2-1, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Short=OEC23; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF24829.1|AC007592_22 F12K11.3 [Arabidopsis thaliana]
 emb|CAA66785.1| 23 kDa polypeptide of oxygen-evolving comlex (OEC) [Arabidopsis 
thaliana]
 gb|AAL08272.1| At1g06680/F4H5_18 [Arabidopsis thaliana]
 gb|AAL49935.1| At1g06680/F4H5_18 [Arabidopsis thaliana]
 gb|AAL67005.1| putative 23 kDa polypeptide of oxygen-evolving comlex protein 
[Arabidopsis thaliana]
 gb|AAM20127.1| putative 23 kDa polypeptide of oxygen-evolving complex (OEC) 
[Arabidopsis thaliana]
 gb|AAM64856.1| 23 kDa polypeptide of oxygen-evolving comlex (OEC) [Arabidopsis 
thaliana]
 gb|AEE28022.1| photosystem II subunit P-1 [Arabidopsis thaliana]
Length=263

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V + KP Q++C+AQ+     +   +            T+L+GAAAVGSKVSPADAAYG
Sbjct  28   RHVSLSKPVQIICKAQQSHEDDNSAVSRRLAL-------TLLVGAAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+FLP  GDGFK+QVP+KWNPSKE+E+PGQVLR+EDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>emb|CAA44291.1| 23-dDa polypeptide of Photosystem II oxygen-evolving complex 
[Nicotiana tabacum]
Length=166

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 131/168 (78%), Gaps = 5/168 (3%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvav  206
            MASTQCF   H    + +      SS RYV  LKPNQLVCRAQKQS++  +D  + +V+ 
Sbjct  1    MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSR  60

Query  207  srrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP  386
               L  TVLIGAAAV SKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct  61   RLAL--TVLIGAAAVVSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPAKWNP  118

Query  387  SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQV  530
            SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QV
Sbjct  119  SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQV  166



>ref|XP_002889614.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65873.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V + KP Q++C+AQ+            + AVSRRLALT+L+GAAAVGSKVSPADAAYG
Sbjct  28   RHVSLSKPVQIMCKAQQ-------PHEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+FLP  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>ref|XP_006303580.1| hypothetical protein CARUB_v10011102mg [Capsella rubella]
 gb|EOA36478.1| hypothetical protein CARUB_v10011102mg [Capsella rubella]
Length=263

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 134/154 (87%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V + KP Q++C+AQ+            + AVSRRLALT+L+GAAAVGSKVSPADAAYG
Sbjct  28   RHVSLSKPVQIMCKAQQ-------PHEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+F+P +GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKTNTDFMPYSGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>ref|XP_009356583.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=268

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 137/182 (75%), Gaps = 7/182 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQ----LVCRAQKQsasaheddaassva  203
            MAST CF  HH   +A +  SSS+    V+  N+    ++CRAQKQ+A   E+  A+   
Sbjct  1    MASTACFLHHHALTTAASARSSSSSQRQVVNINKHNQVVICRAQKQAAGQEEESGANVSR  60

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                   TVLIGAAA+GSKVSPADAAYGE+ANVFGKPK+NT+FLP  G+GFKL +P+KWN
Sbjct  61   RLAL---TVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGEGFKLSIPAKWN  117

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
             SKEVE+PGQVLRYEDNFD  SN+ V +TPTDKKSI DYGSPEEFL +VDYLLGKQAY G
Sbjct  118  RSKEVEYPGQVLRYEDNFDSNSNVAVTITPTDKKSIADYGSPEEFLTKVDYLLGKQAYFG  177

Query  564  KT  569
            KT
Sbjct  178  KT  179



>gb|EYU43166.1| hypothetical protein MIMGU_mgv1a011987mg [Erythranthe guttata]
Length=264

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 7/180 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQ--LVCRAQKQsasaheddaassvavs  209
            MAST CF  HH  LS P   +++N  +  LKPN   L+CRAQKQ   A E   A      
Sbjct  1    MASTSCFLHHHTTLSTPVARTTTN--LLSLKPNNQLLICRAQKQQVEAIESSDAVVSRRL  58

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 T+L+GAAAV +KVSPADAAYGE+AN+FGKPKTNT+F P +G+GFK++VP+KWNPS
Sbjct  59   AL---TLLVGAAAVATKVSPADAAYGESANIFGKPKTNTDFKPYSGEGFKIEVPAKWNPS  115

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             E EFPGQVLRYEDNFD +SN+ V +TPTDKK+ITDYGSPE+FL++VDYLLGKQAY GKT
Sbjct  116  SEKEFPGQVLRYEDNFDASSNLSVTITPTDKKAITDYGSPEDFLSKVDYLLGKQAYFGKT  175



>ref|XP_010486454.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010457808.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010475408.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
isoform X1 [Camelina sativa]
Length=263

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 132/154 (86%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V + KP Q++C+AQ+            + AVSRRLALT+L+GAAAVGS+VSPADAAYG
Sbjct  28   RHVSLSKPVQIICKAQQ-------THEEDNSAVSRRLALTLLVGAAAVGSRVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+F+P  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKANTDFMPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>emb|CDY06657.1| BnaA10g04360D [Brassica napus]
Length=263

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 12/182 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++ A  SSS     RYV + KP Q+VC+AQ+            + A
Sbjct  1    MAYSACF-LHQSALASSAARSSSSSPSQRYVSLSKPVQIVCKAQQ-------PHEDDNSA  52

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
            VSRRLALT+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F P +GDGF++QVP+KWN
Sbjct  53   VSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFTPYSGDGFQVQVPAKWN  112

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct  113  PSREVEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG  172

Query  564  KT  569
            +T
Sbjct  173  ET  174



>ref|XP_008342330.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Malus domestica]
Length=268

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 136/182 (75%), Gaps = 7/182 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQ----LVCRAQKQsasaheddaassva  203
            MAST CF  HH   +A +  SSS+    V+  N+    ++CRAQKQ+A   E+  A+   
Sbjct  1    MASTACFLHHHALTTAASARSSSSSQRQVVNINKHNQVVICRAQKQAAGQEEESGANVSR  60

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                   TVLIGAAA+GSKVSPADAAYGE+ANVFGKPK+NT+FLP  G GFKL +P+KWN
Sbjct  61   RLAL---TVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGKGFKLSIPAKWN  117

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PSKEVE+PGQVLRYEDNFD T+N+ V +TPTDKKSI DYG PE FL QVDYLLGKQAY G
Sbjct  118  PSKEVEYPGQVLRYEDNFDTTTNVAVTITPTDKKSIGDYGPPEGFLTQVDYLLGKQAYFG  177

Query  564  KT  569
            KT
Sbjct  178  KT  179



>ref|XP_006417893.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
 gb|ESQ36246.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
Length=244

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 146/182 (80%), Gaps = 12/182 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++ A  SSS     RYV + KP Q+VC+AQ+            + A
Sbjct  1    MAYSACF-LHQSALASSAARSSSSSSSQRYVSLSKPVQIVCKAQQ-------PHEDDNSA  52

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
            VSRRLALT+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F   +GDGFK+QVP+KWN
Sbjct  53   VSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKANTDFTAYSGDGFKVQVPAKWN  112

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+E+E+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct  113  PSREIEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG  172

Query  564  KT  569
            +T
Sbjct  173  ET  174



>emb|CDY10216.1| BnaC05g04590D [Brassica napus]
Length=263

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 139/182 (76%), Gaps = 12/182 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++ A  SSS     RYV + KP Q+VC+AQ+     +   +     
Sbjct  1    MAYSACF-LHQSALASSAARSSSSSSSQRYVSLSKPVQVVCKAQQSHEDDNPAVSRRLAL  59

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                   T+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F P  GDGF++QVP+KWN
Sbjct  60   -------TLLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFTPYNGDGFQVQVPAKWN  112

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct  113  PSREVEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG  172

Query  564  KT  569
            +T
Sbjct  173  ET  174



>ref|XP_006417894.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
 dbj|BAJ34178.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36247.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
Length=263

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 146/182 (80%), Gaps = 12/182 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++ A  SSS     RYV + KP Q+VC+AQ+            + A
Sbjct  1    MAYSACF-LHQSALASSAARSSSSSSSQRYVSLSKPVQIVCKAQQ-------PHEDDNSA  52

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
            VSRRLALT+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F   +GDGFK+QVP+KWN
Sbjct  53   VSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKANTDFTAYSGDGFKVQVPAKWN  112

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+E+E+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct  113  PSREIEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG  172

Query  564  KT  569
            +T
Sbjct  173  ET  174



>ref|XP_009119039.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Brassica rapa]
Length=263

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 146/182 (80%), Gaps = 12/182 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++ A  SSS     RYV + KP Q+VC+AQ+            + A
Sbjct  1    MAYSACF-LHQSALASSAARSSSSSPSQRYVSLSKPVQIVCKAQQ-------THEDDNSA  52

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
            VSRRLALT+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F P +GDGF++QVP+KWN
Sbjct  53   VSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFTPYSGDGFQVQVPAKWN  112

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEE L+QV+YLLGKQAY G
Sbjct  113  PSREVEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEVLSQVNYLLGKQAYFG  172

Query  564  KT  569
            +T
Sbjct  173  ET  174



>ref|XP_006296023.1| hypothetical protein CARUB_v10025169mg [Capsella rubella]
 gb|EOA28921.1| hypothetical protein CARUB_v10025169mg [Capsella rubella]
Length=263

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 8/155 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLV-CRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAY  284
            R+V + +P  LV CRAQ+     +   +            T+L+GAAAVGSKVSPADAAY
Sbjct  27   RHVSLSRPVHLVVCRAQQSQEDDNSVISRRLAL-------TILVGAAAVGSKVSPADAAY  79

Query  285  GEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVL  464
            GEAANVFGKPK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V+
Sbjct  80   GEAANVFGKPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVM  139

Query  465  VTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            +TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  140  ITPTDKKSITDYGSPEKFLSQVNYLLGKQAYFGET  174



>ref|XP_009376988.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=268

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 135/182 (74%), Gaps = 7/182 (4%)
 Frame = +3

Query  36   MASTQCFYLHHp---alsaparpsssNRYVPVLKPNQLV-CRAQKQsasaheddaassva  203
            MAST CF  HH    A SA    SS  + V + K NQ+V CRAQKQ+A   E+  A    
Sbjct  1    MASTACFLHHHALATAASARPSSSSQRQVVNINKHNQVVICRAQKQAAGQEEESGAIVSR  60

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                   TVLIGAAA+GSKVSPADAAYGE+ANVFGKPK+NT+F P  G GFKL +PSKWN
Sbjct  61   RLAL---TVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFWPYFGKGFKLSIPSKWN  117

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PSKEVE+PGQVLRYEDNFD T+N+ V +TPT+KKS+ DYG PEEFL QVDYLLGKQAY G
Sbjct  118  PSKEVEYPGQVLRYEDNFDTTTNVAVTITPTEKKSVGDYGPPEEFLNQVDYLLGKQAYFG  177

Query  564  KT  569
            KT
Sbjct  178  KT  179



>ref|XP_006354308.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Solanum tuberosum]
Length=254

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 132/178 (74%), Gaps = 6/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MA +  F+LH+  LS     S S   V  LKP QLVC AQK       D    S  ++  
Sbjct  1    MAWSTQFFLHYHPLSKIHLISLSG--VSTLKPYQLVCCAQKDQQDNANDHVFVSRRLAL-  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               T+LIG A++ SKVSPADAAYGE+ANVFGKPK NT+FLP  GDGFKLQ+PSKWNPSKE
Sbjct  58   ---TLLIGVASISSKVSPADAAYGESANVFGKPKKNTDFLPYNGDGFKLQIPSKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD TSN+ V +TPTD KSITDYGSP++FL+QVDYLLGKQAY GKT
Sbjct  115  VEYPGQVLRYEDNFDATSNVVVTITPTDNKSITDYGSPQQFLSQVDYLLGKQAYFGKT  172



>ref|XP_008793536.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=348

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 132/178 (74%), Gaps = 8/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   ++   P    R +P ++P +LVCRAQKQ+    E +   S  ++  
Sbjct  90   MASTACFLHHHAPSTSRTPP----RPMPSIRPTRLVCRAQKQAGQEDESNTVVSRRLAL-  144

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVL+G AA   KVSPADAAYGE AN+FGKPKTNT+F    G+GFKL +PSKWNPSKE
Sbjct  145  ---TVLVGTAATSVKVSPADAAYGETANIFGKPKTNTDFFSYNGNGFKLMIPSKWNPSKE  201

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQV+R+EDNFD  S + V+VTPT KKSITDYGSPEEF++QVDYLLGKQAYSGKT
Sbjct  202  VEYPGQVMRWEDNFDPNSYVAVMVTPTPKKSITDYGSPEEFISQVDYLLGKQAYSGKT  259



>ref|XP_002881132.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57391.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   212 bits (539),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +3

Query  129  PNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFG  308
            P  LVCRAQ+     +   +            T+L+GAAA+GSKVSPADAAYGEAANVFG
Sbjct  34   PVHLVCRAQQSQEDDNSAVSRRLAL-------TLLVGAAAIGSKVSPADAAYGEAANVFG  86

Query  309  KPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKS  488
            KPK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++TPTDKKS
Sbjct  87   KPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMITPTDKKS  146

Query  489  ITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            ITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  147  ITDYGSPEQFLSQVNYLLGKQAYFGET  173



>gb|AAN77240.1| PsbP [Xerophyta humilis]
Length=244

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 129/178 (72%), Gaps = 9/178 (5%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF   H A S     +SS R  P  +  Q+VC+AQ      +   +         
Sbjct  1    MASTACFL--HLAPSTAVSRASSQRLAPSFRTTQVVCKAQNHDDENNAVISRRLTL----  54

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVL+GAAAVG+KV+PADAAYGEAANVFG+PKTNT+FL   GDGFK+ +PSKWN SKE
Sbjct  55   ---TVLVGAAAVGAKVNPADAAYGEAANVFGRPKTNTDFLTYAGDGFKVLIPSKWNFSKE  111

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+PGQVLRYEDNFD  SN+ V+V PTDKKSITD+GSPEEFL++VDYLLGKQAY GKT
Sbjct  112  VEYPGQVLRYEDNFDANSNLAVMVQPTDKKSITDFGSPEEFLSKVDYLLGKQAYFGKT  169



>ref|XP_004303902.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=264

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 137/180 (76%), Gaps = 7/180 (4%)
 Frame = +3

Query  36   MASTQCFYLHHp-alsaparpsssNRYVPVLKPNQLV-CRAQKQsasaheddaassvavs  209
            MAST CF  HH    S  AR SSS R V  +KPNQ+V CRAQKQS    +  A S     
Sbjct  1    MASTACFLHHHALTTSTAARSSSSQRQVVSIKPNQVVICRAQKQSVQEEDGGAISRRLAL  60

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 T+LIG AA+ +KV+PADAAYGE+AN+FGKPKT+T+FLP  G+GFK+ +P+KWNPS
Sbjct  61   -----TLLIGGAALSTKVAPADAAYGESANIFGKPKTSTDFLPYAGEGFKVSIPAKWNPS  115

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            KEVEFPGQVLRYEDNFD TSN+ V + PTDKKSITD+GSPE+FL QVDYLLGKQAY GKT
Sbjct  116  KEVEFPGQVLRYEDNFDVTSNLTVTINPTDKKSITDFGSPEQFLTQVDYLLGKQAYFGKT  175



>ref|XP_010414217.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Camelina sativa]
Length=263

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 8/155 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLV-CRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAY  284
            R+VP+ +P  LV CRAQ+     +   +            T L+GAAAVGSKVSPADAAY
Sbjct  27   RHVPLSRPVYLVVCRAQQSQVDNNSAISRRLAL-------TFLVGAAAVGSKVSPADAAY  79

Query  285  GEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVL  464
            GEAANVFGKPK NT+F+P TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD  SN+ V+
Sbjct  80   GEAANVFGKPKKNTDFMPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDAASNVSVM  139

Query  465  VTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            +TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  140  ITPTDKKSITDYGSPEQFLSQVNYLLGKQAYFGET  174



>ref|XP_009118485.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=263

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R++ + KP Q+VC+AQ+     +   +            T+L+GAAAVGSKVSPADAAYG
Sbjct  28   RHLSLSKPVQIVCKAQQHHEDDNSAVSRRLAL-------TLLVGAAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>emb|CDY06222.1| BnaA09g49810D [Brassica napus]
Length=263

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R++ + KP Q+VC+AQ+     +   +            T+L+GAAAVGSKVSPADAAYG
Sbjct  28   RHLSLSKPVQIVCKAQQHHEDDNSAVSRRLAL-------TLLVGAAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>gb|AGV54458.1| oxygen-evolving enhancer protein 2 chloroplastic-like protein 
[Phaseolus vulgaris]
Length=261

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +    PS   R +   KPNQLVC+AQKQ+    +D    S  ++  
Sbjct  1    MASTQCFLHHHALTTPARSPS--QRIMXSTKPNQLVCKAQKQTTPQEDDVTPISRRLAL-  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV PADAAYGEAANVFGKPKTNT+F P  GDGFKL +PSKWNPSKE
Sbjct  58   ---TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTNTDFQPYNGDGFKLSIPSKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  115  VEYRGQVLRYEDNFDTTSNVVVTVTPTDKKSITDYGSPEEFLSKVDYLLGKQAFFGET  172



>gb|AGV54655.1| oxygen-evolving enhancer protein 2-2 chloroplast precursor (OEE2) 
[Phaseolus vulgaris]
Length=261

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +    PS   R +   KPNQLVC+AQKQ+    +D    S  ++  
Sbjct  1    MASTQCFLHHHALTTPARSPS--QRIMVSTKPNQLVCKAQKQTTPQEDDVTPISRRLAL-  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV PADAAYGEAANVFGKPKTNT+F P  GDGFKL +PSKWNPSKE
Sbjct  58   ---TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTNTDFQPYNGDGFKLSIPSKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  115  VEYRGQVLRYEDNFDTTSNVVVTVTPTDKKSITDYGSPEEFLSKVDYLLGKQAFFGET  172



>ref|XP_007141448.1| hypothetical protein PHAVU_008G196500g [Phaseolus vulgaris]
 gb|ESW13442.1| hypothetical protein PHAVU_008G196500g [Phaseolus vulgaris]
Length=261

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +    PS   R +   KPNQLVC+AQKQ+    +D    S  ++  
Sbjct  1    MASTQCFLHHHALTTPARSPS--QRIMVSTKPNQLVCKAQKQTTPQEDDVTPISRRLAL-  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKV PADAAYGEAANVFGKPKTNT+F P  GDGFKL +PSKWNPSKE
Sbjct  58   ---TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTNTDFQPYNGDGFKLSIPSKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VE+ GQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQA+ G+T
Sbjct  115  VEYRGQVLRYEDNFDTTSNVVVTVTPTDKKSITDYGSPEEFLSKVDYLLGKQAFFGET  172



>ref|XP_004491279.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 136/180 (76%), Gaps = 6/180 (3%)
 Frame = +3

Query  36   MASTQCF-YLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavs  209
            MASTQCF ++     S  +   SS   V   KPNQL VC+A KQ A   +DD+  S  ++
Sbjct  1    MASTQCFLHIPALTTSTTSTKVSSQHQVVNTKPNQLLVCKAWKQVAIHEDDDSIVSRRLA  60

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 TVL G+A V SKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL VPSKWNPS
Sbjct  61   L----TVLFGSAVVASKVSPADAAYGESANVFGKPKTNTDFLPFNGDGFKLSVPSKWNPS  116

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            KEVE+ GQVLRYEDNFD TSN+ V VTPTDKKSI DYGSPEEFL+QV+YLLGKQA+ G+T
Sbjct  117  KEVEYKGQVLRYEDNFDSTSNVVVTVTPTDKKSIIDYGSPEEFLSQVNYLLGKQAFFGET  176



>ref|XP_010469798.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Camelina sativa]
Length=263

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 8/155 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLV-CRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAY  284
            R+V + +P  LV CRAQ+     +   +            T L+GAAAVGSKVSPADAAY
Sbjct  27   RHVSLSRPVHLVVCRAQQSQEHGNSAISRRLAL-------TFLVGAAAVGSKVSPADAAY  79

Query  285  GEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVL  464
            GEAANVFGKPK NT+F+P TG+GFK+ +PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V+
Sbjct  80   GEAANVFGKPKKNTDFMPYTGEGFKILIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVM  139

Query  465  VTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            +TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  140  ITPTDKKSITDYGSPEQFLSQVNYLLGKQAYFGET  174



>ref|XP_009144275.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY10755.1| BnaA05g11810D [Brassica napus]
Length=263

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
             +V   +P  LVCRAQ+           ++ A+SRRLALT L+GAAA+GSKVSPADAAYG
Sbjct  28   HHVSFSRPVHLVCRAQQ-------AQEEANSAISRRLALTFLVGAAALGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+F+P  G+GFK+++PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V++
Sbjct  81   EAANVFGKPKKNTDFMPYNGEGFKIEIPSKWNPSKEVEYPGQVLRYEDNFDATSNVSVMI  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKK+I DYGSPE+FL+QV YLLGKQAY G+T
Sbjct  141  TPTDKKTIADYGSPEQFLSQVSYLLGKQAYFGET  174



>ref|XP_006410179.1| hypothetical protein EUTSA_v10017096mg [Eutrema salsugineum]
 dbj|BAJ34543.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51632.1| hypothetical protein EUTSA_v10017096mg [Eutrema salsugineum]
Length=263

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 122/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
             +V + +P  LVCRAQ+     +   +            T L+GAAAVGSKVSPADAAYG
Sbjct  28   HHVTLSRPLHLVCRAQQSQEDINSAVSRRLAL-------TFLVGAAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            E+ANVFGKPKTNT+F+P  G+ FK+++PSKWNPSKEVE+PGQVLR+EDNFD TSN+ V+V
Sbjct  81   ESANVFGKPKTNTDFMPYNGERFKIEIPSKWNPSKEVEYPGQVLRFEDNFDATSNVSVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKK+ITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKAITDYGSPEQFLSQVNYLLGKQAYFGET  174



>emb|CDY09962.1| BnaC08g44890D [Brassica napus]
Length=263

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R++ + KP Q+VC+AQ+     +   +            T+L+G AAVGSKVSPADAAYG
Sbjct  28   RHLSLSKPVQIVCKAQQHHEDDNSAVSRRLAL-------TLLVGGAAVGSKVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  81   EAANVFGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  141  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  174



>sp|P11594.2|PSBP_SINAL RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Sinapis alba]
 emb|CAA35081.1| oxygen-evolving complex of photosystem II [Sinapis alba]
Length=260

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 141/182 (77%), Gaps = 15/182 (8%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++    SS      RYV + K   LVC+AQ+            +  
Sbjct  1    MAYSACF-LHQSALASSTARSSPSSSSQRYVSISK---LVCKAQQ-------THEEDNST  49

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
            VSRRLALT+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F   +GDGF++QVP+KWN
Sbjct  50   VSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFTAYSGDGFQVQVPAKWN  109

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct  110  PSREVEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG  169

Query  564  KT  569
            +T
Sbjct  170  ET  171



>ref|XP_009110976.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Brassica rapa]
Length=261

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 129/154 (84%), Gaps = 10/154 (6%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV + K   LVC+AQ+            +  VSRRLALT+L+GAAAVGSKVSPADAAYG
Sbjct  29   RYVSLSK---LVCKAQQ-------TQEDDTSTVSRRLALTLLVGAAAVGSKVSPADAAYG  78

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  79   EAANVFGKPKTNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  138

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  139  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  172



>emb|CDX86515.1| BnaC08g01880D [Brassica napus]
Length=261

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 10/154 (6%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV + K   LVC+AQ+            + AVSRRLALT+L+GAAAVGSKVSPADAAYG
Sbjct  29   RYVSLSK---LVCKAQQ-------TQENDTSAVSRRLALTLLVGAAAVGSKVSPADAAYG  78

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+F    GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  79   EAANVFGKPKTNTDFTAYNGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  138

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  139  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  172



>sp|Q96334.1|PSBP_BRAJU RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor, partial [Brassica juncea]
 emb|CAA70099.1| 23kD protein of oxygen evolving system of photosystem II [Brassica 
juncea]
Length=217

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  225  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF  404
            T+L+GAAAVGSKVSPADAAYGEAANVFGKPKTNT+F  I GDGF++QVP+KWNPS+EVE+
Sbjct  14   TLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFTAINGDGFQVQVPAKWNPSREVEY  73

Query  405  PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  74   PGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  128



>emb|CAA68801.1| 23 kD subunit [Sinapis alba]
 prf||1506342A O2 evolving complex 23kD protein
Length=248

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 10/154 (6%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV + K   LVC+AQ+            +  VSRRLALT+L+GAAAVGSKVSPADAAYG
Sbjct  16   RYVSISK---LVCKAQQ-------THEEDNSTVSRRLALTLLVGAAAVGSKVSPADAAYG  65

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPK NT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  66   EAANVFGKPKKNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  125

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  126  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  159



>ref|XP_010522048.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522049.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010522051.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=264

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 7/145 (5%)
 Frame = +3

Query  135  QLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKP  314
            Q+VCRAQ+ S   +   +            T+L+GAAAVGSKVSPADAAYGEAANVFGKP
Sbjct  38   QIVCRAQQSSEEDNSSVSRRLAL-------TLLVGAAAVGSKVSPADAAYGEAANVFGKP  90

Query  315  KTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSIT  494
            K++T+FL  +G+GFKL +PSKWNPSKEVEFPGQVLRYEDNFD TSN+ V+VTPTDKKSIT
Sbjct  91   KSDTDFLAYSGEGFKLVIPSKWNPSKEVEFPGQVLRYEDNFDATSNVSVMVTPTDKKSIT  150

Query  495  DYGSPEEFLAQVDYLLGKQAYSGKT  569
            D+GSPEEFL+QV+YLLGKQ++ GKT
Sbjct  151  DFGSPEEFLSQVNYLLGKQSFFGKT  175



>emb|CDY15587.1| BnaA08g28710D [Brassica napus]
Length=261

 Score =   206 bits (525),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 129/154 (84%), Gaps = 10/154 (6%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            RYV + K   LVC+AQ+            +  VSRRLALT+L+GAAAVGSKVSPA+AAYG
Sbjct  29   RYVSLSK---LVCKAQQ-------TQEDDTSTVSRRLALTLLVGAAAVGSKVSPAEAAYG  78

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKTNT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct  79   EAANVFGKPKTNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV  138

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  139  TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGET  172



>gb|EPS69373.1| hypothetical protein M569_05393, partial [Genlisea aurea]
Length=251

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  225  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF  404
            TVLIGAA + SKVSPADAAYGE+AN+FGKPKTNT+F P TGDGFK+ +PSKWNPS E+EF
Sbjct  48   TVLIGAAGLASKVSPADAAYGESANIFGKPKTNTDFRPYTGDGFKISIPSKWNPSGEIEF  107

Query  405  PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            PGQVLRYEDNFD TSN+ V + PTDKKSITDYGSPE+FL+QVDYLLGKQAYSGKT
Sbjct  108  PGQVLRYEDNFDSTSNLTVTINPTDKKSITDYGSPEDFLSQVDYLLGKQAYSGKT  162



>emb|CAA45700.1| 23 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=205

 Score =   202 bits (515),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +3

Query  225  TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF  404
            T+LIG+AA+GSKVSPADAAYGEAANVFGK KTNT+F    GDGFKLQ+PSKWNP+KEVE+
Sbjct  2    TLLIGSAAIGSKVSPADAAYGEAANVFGKAKTNTDFQTYNGDGFKLQIPSKWNPNKEVEY  61

Query  405  PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  62   PGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKT  116



>sp|Q40407.1|PSBP_NARPS RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Narcissus pseudonarcissus]
 emb|CAA55393.1| OEC 23kd protein [Narcissus pseudonarcissus]
Length=265

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LHH A S      S  R        Q    A+ QS  A       ++   R 
Sbjct  1    MASTACF-LHHHAPSPATSNLSRTRSATNRDEQQQEHSARLQSPEADCATENDALLSRRL  59

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               T+LIG AA+GS+VS ADAAYGE+ANVFGKPKTNT+F  +TGDGFK+ +PSKWNPSKE
Sbjct  60   AL-TILIGGAALGSRVSAADAAYGESANVFGKPKTNTDFQTVTGDGFKILIPSKWNPSKE  118

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VEFPGQVLRYEDNFD TSN+ V+V PTDKKSI DYGSPE+FL+QVDYLLGKQAY GKT
Sbjct  119  VEFPGQVLRYEDNFDTTSNVGVMVNPTDKKSIKDYGSPEQFLSQVDYLLGKQAYFGKT  176



>gb|KFK42985.1| hypothetical protein AALP_AA1G064500 [Arabis alpina]
Length=260

 Score =   204 bits (519),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 136/182 (75%), Gaps = 15/182 (8%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsss----NRYVPVLKPNQLVCRAQKQsasaheddaassva  203
            MA + CF LH  AL++ A  SSS     RYV + KP Q+VC+AQ+     +   +     
Sbjct  1    MAYSACF-LHQSALASSAARSSSSSSSQRYVSLSKPVQIVCKAQQSHEDDNSAVSRRLAL  59

Query  204  vsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN  383
                   T+L+GAAAVGSKVSPADAAY   ANVFGKPK NT+F   TGDGFK+QVP+KWN
Sbjct  60   -------TLLVGAAAVGSKVSPADAAY---ANVFGKPKANTDFTAYTGDGFKVQVPAKWN  109

Query  384  PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            PS+E+E+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPE+FL+QV+YLLGKQAY G
Sbjct  110  PSREIEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEQFLSQVNYLLGKQAYFG  169

Query  564  KT  569
            +T
Sbjct  170  ET  171



>sp|P85189.1|PSBP_HELAN RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=263

 Score =   204 bits (519),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 8/180 (4%)
 Frame = +3

Query  36   MASTQCFY-LHHpalsaparpsssNRYVPV-LKPNQLVCRAQKQsasaheddaassvavs  209
            MA+  CF+ L  PA S+ +   SS+  +P  +KPNQL+ R+QK+  +A  D A S     
Sbjct  1    MAAASCFHALSTPARSSSSSLQSSSSRLPAPIKPNQLIIRSQKREETATNDAAISRRLAL  60

Query  210  rrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPS  389
                 TVLIGAAAVG+KVSPADAAYGEAANVFGK K+ TEF   TG GFKL VP+KWNPS
Sbjct  61   -----TVLIGAAAVGTKVSPADAAYGEAANVFGKQKS-TEFSQYTGPGFKLSVPAKWNPS  114

Query  390  KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            KEVE+PGQVLRYEDNFD TSN+ V+VTPTDKK+ITDYG+PEEFL++VDYLLGKQAY GKT
Sbjct  115  KEVEYPGQVLRYEDNFDTTSNLAVMVTPTDKKAITDYGAPEEFLSKVDYLLGKQAYFGKT  174



>gb|KFK31259.1| hypothetical protein AALP_AA6G089000 [Arabis alpina]
Length=265

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 6/148 (4%)
 Frame = +3

Query  126  KPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVF  305
            +P  LVCRAQ+QS   +    +  +A+      T L+ AAAVG KVSPADAAYGEAANVF
Sbjct  35   RPVHLVCRAQQQSQEDNNSTVSRRLAL------TFLVSAAAVGYKVSPADAAYGEAANVF  88

Query  306  GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK  485
            GKPK NT+FL   G+GFK+++PSKWNPSKEVE+PGQVLR+EDNFD TSN+ V+VTPTDKK
Sbjct  89   GKPKKNTDFLTYNGEGFKIEIPSKWNPSKEVEYPGQVLRFEDNFDATSNVSVMVTPTDKK  148

Query  486  SITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            SITDYGSP++FL+QV+YLLGKQAY G+T
Sbjct  149  SITDYGSPQKFLSQVNYLLGKQAYFGET  176



>ref|XP_010557156.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
[Tarenaya hassleriana]
Length=263

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 122/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
             +V   +  Q+VCRAQ+     +   +            T+L+GAAAVGS+VSPADAAYG
Sbjct  28   HHVAPSRAVQVVCRAQQSPEEDNSAVSRRLAL-------TLLVGAAAVGSRVSPADAAYG  80

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
            EAANVFGKPKT+T+FL  +G+GFKLQ+PSKWNPSKEVE+PGQVLRYEDNFD TS + V+V
Sbjct  81   EAANVFGKPKTDTDFLAYSGEGFKLQIPSKWNPSKEVEYPGQVLRYEDNFDATSYVTVMV  140

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TP+DKKSITDYGSPE+FL+QV+YLLGKQ++ G+T
Sbjct  141  TPSDKKSITDYGSPEQFLSQVNYLLGKQSFFGQT  174



>gb|KEH33650.1| oxygen-evolving enhancer protein 2-1 [Medicago truncatula]
Length=244

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 117/164 (71%), Gaps = 6/164 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF LH          S S R +   KPN +VC+AQKQ          S       
Sbjct  1    MASTQCF-LHPQYALTTPSRSLSQRQIVTNKPNHIVCKAQKQDVEDVAVSVVSRRLAL--  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               +VL+GAAAVGSKVSPADAAYGEAANVFGK KTNT+FLP  GDGFKL VP+KWNPSKE
Sbjct  58   ---SVLLGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYNGDGFKLLVPAKWNPSKE  114

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQ  527
             EFPGQVLRYEDNFD TSN+ VLV  TDKKSITDYGSPEEFL++
Sbjct  115  REFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSK  158



>ref|XP_006843560.1| hypothetical protein AMTR_s00007p00081670 [Amborella trichopoda]
 gb|ERN05235.1| hypothetical protein AMTR_s00007p00081670 [Amborella trichopoda]
Length=276

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 132/179 (74%), Gaps = 8/179 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLV-CRAQKQsasaheddaassvavsr  212
            MAS+   +L HPA SA  R S S+R     K  QLV CRAQKQ  +        S  ++ 
Sbjct  1    MASSTACFLRHPAPSAHPRASPSHRVA--AKVGQLVVCRAQKQQDTEEAQALTVSRRLAL  58

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                TVL+G AAV +KVSPADAAYGEAANVFGKPKTNT+FLP  GDGFKL +P+KWNPSK
Sbjct  59   ----TVLVGTAAVSTKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKLLIPAKWNPSK  114

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EVEFPGQVLRYEDNFD  S + V+VTP  KK+IT+YGSPEEFLAQVDYLLGKQ + GKT
Sbjct  115  EVEFPGQVLRYEDNFDPNSYVSVMVTPNSKKTITEYGSPEEFLAQVDYLLGKQNF-GKT  172



>gb|ADQ00373.1| oxygen-evolving enhancer protein 2 [Sequoia sempervirens]
Length=261

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 6/148 (4%)
 Frame = +3

Query  129  PNQLV-CRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVF  305
            P  LV CRAQKQ+       A +          T+L GAAAV SKV+PADAAYGEAANVF
Sbjct  30   PKLLVTCRAQKQAHEEVLPSAVTRRLAV-----TLLAGAAAVSSKVAPADAAYGEAANVF  84

Query  306  GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK  485
            G PK NT+F+  +G+GFK+ +P+KWNPSKEVE+PGQVLRYEDNFD  SN+ V+VTPTDKK
Sbjct  85   GAPKKNTDFITYSGEGFKILIPAKWNPSKEVEYPGQVLRYEDNFDGNSNVSVMVTPTDKK  144

Query  486  SITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            +ITD+GSP+EFL+QVDYLLGKQAYSGKT
Sbjct  145  NITDFGSPQEFLSQVDYLLGKQAYSGKT  172



>gb|ABQ85433.1| 23 kDa OEC protein, partial [Salicornia veneta]
Length=202

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPG  410
            LIGAAAVGSKVSPADAAYGEAANVFGKPK +TEF    GDGFKL VPSKWN SKEVE+PG
Sbjct  1    LIGAAAVGSKVSPADAAYGEAANVFGKPKKDTEFSSYNGDGFKLLVPSKWNKSKEVEYPG  60

Query  411  QVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            QVLR+EDNFD TSN+ V+V+ TDKKSITD+GSPE+FL QVDYLLGKQAY GKT
Sbjct  61   QVLRFEDNFDATSNLAVMVSSTDKKSITDFGSPEQFLGQVDYLLGKQAYFGKT  113



>emb|CDY47118.1| BnaC04g13750D [Brassica napus]
Length=678

 Score =   204 bits (518),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 11/184 (6%)
 Frame = +3

Query  27   RAIMASTQCFYLHHpalsaparpsssN---RYVPVLKPNQLVCRAQKQsasaheddaass  197
            R  MA + CF LH  ALS+  R  S     R++   +P  +VCRAQ+            +
Sbjct  414  RKRMAYSACF-LHQSALSSTERSPSFPSSLRHMSFSRPVHVVCRAQQ-------VQEDVN  465

Query  198  vavsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSK  377
             AVSRRLALT L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F+P  G+GFK+++PSK
Sbjct  466  SAVSRRLALTFLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFMPYNGEGFKIEIPSK  525

Query  378  WNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAY  557
            WNPSKEVE+PGQVLRYEDNFD TSN+ V++TPTDKK+I DYGSPE+FL+QV YLLGKQAY
Sbjct  526  WNPSKEVEYPGQVLRYEDNFDATSNVSVMITPTDKKTIADYGSPEQFLSQVSYLLGKQAY  585

Query  558  SGKT  569
             G+T
Sbjct  586  FGET  589



>ref|XP_010543054.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
2, chloroplastic, partial [Tarenaya hassleriana]
Length=286

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            ++ GAAAVGSKVSPADAAYGEAANVFGKPKT+++FL   G+GFKLQ+PSKWNPSKEVE+P
Sbjct  84   LIGGAAAVGSKVSPADAAYGEAANVFGKPKTDSDFLAYNGEGFKLQIPSKWNPSKEVEYP  143

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            GQVL YEDNFD T+N+ V+VTP+DKKSI+DYG PEEFL+QV+YLLGKQ++ G+T
Sbjct  144  GQVLNYEDNFDATNNVTVMVTPSDKKSISDYGPPEEFLSQVNYLLGKQSFFGET  197



>emb|CBI22068.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 112/176 (64%), Gaps = 42/176 (24%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF  HH   +     S   R +P L+P+QLV                        
Sbjct  1    MASTACFLHHHALSTPTRVSS--QRQLPSLRPSQLV------------------------  34

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
                            +PADAAYGEAANVFGKPKTNT+FLP  G+GFKL +PSKWNPSKE
Sbjct  35   ----------------NPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSKE  78

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
             EFPGQVLRYEDNFD  SN+ V++TPTDKKSITDYGSPEEFL++VD+LLGKQA+ G
Sbjct  79   REFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDFLLGKQAFFG  134



>gb|ABS84824.1| chloroplast oxygen-evolving enhancer protein 2 [Limonium bicolor]
Length=268

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 126/183 (69%), Gaps = 9/183 (5%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparp----sssNRYVPVLKPNQLV-CRAQKQsasaheddaassv  200
            MAST CF  H+   S+        +S  + +   K   LV C AQKQ   ++     S  
Sbjct  1    MASTACFSHHYALSSSSNSARNSLASQRQGLSTSKSGALVICNAQKQDQISNTAVNESIS  60

Query  201  avsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKW  380
                    T+ +GAAAVGSKV+PADAAYGE+ANVFGK KT T+F    G+GFKLQ+P+KW
Sbjct  61   RRLAL---TLFVGAAAVGSKVNPADAAYGESANVFGKQKT-TDFTAYVGEGFKLQIPAKW  116

Query  381  NPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYS  560
            NPS+E+EFPGQVLR+EDNFD TSN+ V++ PTDKKSITD+G+PEEFL+ V+YL G QAY 
Sbjct  117  NPSREIEFPGQVLRFEDNFDTTSNVSVMINPTDKKSITDFGTPEEFLSTVNYLFGSQAYF  176

Query  561  GKT  569
            GKT
Sbjct  177  GKT  179



>ref|XP_003617328.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|AET00287.1| oxygen-evolving enhancer protein 2-1 [Medicago truncatula]
Length=269

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 132/183 (72%), Gaps = 7/183 (4%)
 Frame = +3

Query  33   IMASTQCFYLHHpals-aparpsssNRYVPVLKPNQ---LVCRAQKQsasaheddaassv  200
            + +STQCF  H    +   +   SS R V  ++      LVC+A+KQ+    + +     
Sbjct  1    MASSTQCFLSHLALSTPTTSTRFSSQRQVVNVRSKAKQFLVCKAKKQAIQEDDGNNIIVS  60

Query  201  avsrrlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKW  380
                    TVLIG A VGSKVSPADAAYG++ANVFGKPKTNT+FLP  GDGFKL VPSKW
Sbjct  61   RRLAL---TVLIGGAVVGSKVSPADAAYGQSANVFGKPKTNTDFLPYDGDGFKLSVPSKW  117

Query  381  NPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYS  560
            NPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDKK+ITDYGSPEEFL+QV+YLLGKQA+ 
Sbjct  118  NPSKEVEYTGQVLRYEDNFDTTSNVVVTVTPTDKKAITDYGSPEEFLSQVNYLLGKQAFF  177

Query  561  GKT  569
            G+T
Sbjct  178  GET  180



>ref|XP_004965800.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Setaria italica]
Length=260

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 132/178 (74%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF L   A    A  S+     P +   QLVC+AQ+Q A+A   DAA+    +  
Sbjct  1    MASTSCFLLQSTARLGAAAASAR----PQVPRAQLVCKAQRQDAAAESGDAAAVTRRAAL  56

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               T+L G AAVG+KVSPA AAYGEAANVFGKPK NT+F+  +GDGFKL +PSKWNPSKE
Sbjct  57   ---TLLAGVAAVGAKVSPAAAAYGEAANVFGKPKANTDFIAYSGDGFKLLIPSKWNPSKE  113

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V+V PT KK+IT++GSPE+FLAQVDYLLGKQAYSGKT
Sbjct  114  REFPGQVLRYEDNFDANSNVSVMVQPTTKKTITEFGSPEQFLAQVDYLLGKQAYSGKT  171



>gb|EYU42856.1| hypothetical protein MIMGU_mgv1a011103mg [Erythranthe guttata]
Length=292

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 138/209 (66%), Gaps = 35/209 (17%)
 Frame = +3

Query  36   MASTQCFYLHHpal--saparpsssNRYVPVLKPNQLVCRA-QKQsasaheddaassvav  206
            MAS  CF  HH A   +  +  S++ RY P +KP+QLVCR+ QKQ       D  S+  V
Sbjct  1    MASIACFLDHHTAAIRTCSSSSSTTRRYAPPVKPSQLVCRSVQKQ----AAADGGSAAVV  56

Query  207  srrlalTVLIGAAAVGSKV------------------SPADAAYG----------EAANV  302
            SRRLA  VLIGAAAVGSK+                   P   +Y           + AN+
Sbjct  57   SRRLATIVLIGAAAVGSKLKLVLCKNAFYNAPQSNIYKPMYTSYNHLVNVELECDKTANI  116

Query  303  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  482
            FGKPKTNT+F P  GDGFK+ +PSKWNPSKE EFPGQVLRYEDNF+ TSN+ V++TPTDK
Sbjct  117  FGKPKTNTDFKPYIGDGFKVSIPSKWNPSKEREFPGQVLRYEDNFNATSNLSVMITPTDK  176

Query  483  KSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            KSITDYGSPE+FL+QVDYLLGKQ+Y GKT
Sbjct  177  KSITDYGSPEDFLSQVDYLLGKQSYFGKT  205



>gb|AAB82135.1| 23kDa polypeptide of photosystem II [Oryza sativa Indica Group]
Length=254

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 123/179 (69%), Gaps = 15/179 (8%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LH       AR +S +   P  + + LVCRAQKQ  +     AA        
Sbjct  1    MASTSCF-LHQSTARVAARVASPS---PATRTHLLVCRAQKQDDADFSRRAAL-------  49

Query  216  lalTVLIGA-AAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                +L G  AAVG  V+P  AAYGEAANVFGKPKTNTEF+P +G+GFKL +PSKWNPSK
Sbjct  50   ---ALLAGTTAAVGVNVAPPAAAYGEAANVFGKPKTNTEFIPYSGEGFKLLIPSKWNPSK  106

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            E EFPGQVLRY++NF   SN+ V++ P  KK++ ++GSP+EFL QVD+LLGKQAYSGKT
Sbjct  107  EREFPGQVLRYKENFHADSNVSVIINPPTKKTVAEFGSPQEFLPQVDFLLGKQAYSGKT  165



>gb|AAC02750.1| photosystem II oxygen-evolving complex 23K protein, putative 
[Arabidopsis thaliana]
Length=257

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 113/154 (73%), Gaps = 14/154 (9%)
 Frame = +3

Query  108  RYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAYG  287
            R+V + +P  LVCRAQ+   + +                T+L+GAAA+GSKVSPA     
Sbjct  29   RHVSLSRPVHLVCRAQQSQENNNSAVFRRLAL-------TLLVGAAAIGSKVSPAPP---  78

Query  288  EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  467
                +   PK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++
Sbjct  79   ----MVKPPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMI  134

Query  468  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  135  TPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGET  168



>gb|KDO44761.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=204

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   + PAR SSS R+V  +KP Q+VCRAQKQ+    +  A S       
Sbjct  1    MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLAL--  58

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
               TVLIGAAAVGSKVSPADAAYGE+ANVFGKPKTNT+FLP  GDGFKL +PSKWNPSKE
Sbjct  59   ---TVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKE  115

Query  396  VEFPGQVLRYEDNFDQTSNI  455
             EFPGQVLRYEDNFD  +NI
Sbjct  116  REFPGQVLRYEDNFDSNTNI  135



>pdb|2VU4|A Chain A, Structure Of Psbp Protein From Spinacia Oleracea At 
1.98 A Resolution
Length=190

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  279  AYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNIC  458
            AYGEAANVFGKPK NTEF+P  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ 
Sbjct  5    AYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLS  64

Query  459  VLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VLV PTDKKSITD+GSPE+FL+QVDYLLGKQAY GKT
Sbjct  65   VLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGKT  101



>pdb|4RTI|A Chain A, The Crystal Structure Of Psbp From Spinacia Oleracea
Length=186

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  279  AYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNIC  458
            AYGEAANVFGKPK NTEF+P  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ 
Sbjct  1    AYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLS  60

Query  459  VLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            VLV PTDKKSITD+GSPE+FL+QVDYLLGKQAY GKT
Sbjct  61   VLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGKT  97



>gb|EAZ02734.1| hypothetical protein OsI_24852 [Oryza sativa Indica Group]
Length=191

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LH       AR +S +   P  + + LVCRAQKQ  +     AA ++     
Sbjct  1    MASTSCF-LHQSTARVAARVASPS---PATRTHLLVCRAQKQDDADVSRRAALALLAGA-  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
                     AAVG KV+PA AAYGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE
Sbjct  56   --------TAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKE  107

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKT
Sbjct  108  REFPGQVLRYEDNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKT  165



>gb|ABR16937.1| unknown [Picea sitchensis]
Length=272

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  255  SKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDN  434
            SKVSPADAAYGEAANVFG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVLRYEDN
Sbjct  79   SKVSPADAAYGEAANVFGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLRYEDN  138

Query  435  FDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             D  SN+ V+V PTDKKSI D+G P++FL+QVD+LLGKQAYSGKT
Sbjct  139  RDTVSNVSVMVIPTDKKSIKDFGPPQQFLSQVDFLLGKQAYSGKT  183



>ref|XP_003557629.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Brachypodium distachyon]
Length=253

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 118/178 (66%), Gaps = 14/178 (8%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LH       A    S     +L     VC+AQ+  +S       +++++   
Sbjct  1    MASTSCF-LHQSTARLAASARPSAARTQIL-----VCKAQQHDSSDAATTRRAALSLLAG  54

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
             A            KVSPA AAYGEAANVFGK K+ TEF+  +GDGFKL +P+KWNPSKE
Sbjct  55   AAAAAS-------LKVSPASAAYGEAANVFGKQKS-TEFVAYSGDGFKLMIPAKWNPSKE  106

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD TSN+ V++TPT KKSITDYGSPEEFL+QV YLLG+Q+Y GKT
Sbjct  107  REFPGQVLRYEDNFDATSNLSVMITPTPKKSITDYGSPEEFLSQVGYLLGQQSYGGKT  164



>gb|ABK22374.1| unknown [Picea sitchensis]
 gb|ABK23860.1| unknown [Picea sitchensis]
 gb|ABR16069.1| unknown [Picea sitchensis]
 gb|ABR17587.1| unknown [Picea sitchensis]
Length=272

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  255  SKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDN  434
            SKVSPADAAYGEAANVFG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVLRYEDN
Sbjct  79   SKVSPADAAYGEAANVFGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLRYEDN  138

Query  435  FDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             D  SN+ V+V PTDKKSI D+G P++FL+QVD+LLGKQAYSGKT
Sbjct  139  GDTVSNVSVMVIPTDKKSIKDFGPPQQFLSQVDFLLGKQAYSGKT  183



>gb|AGZ95660.1| photosystem II extrinsic subunit (chloroplast) (chloroplast) 
[Oryza sativa]
Length=254

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LH       AR +S +   P  + + LVCRAQKQ  +     AA ++     
Sbjct  1    MASTSCF-LHQSTARVAARVASPS---PATRTHLLVCRAQKQDDADVSRRAALALLAGA-  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
                     AAVG KV+PA AAYGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE
Sbjct  56   --------TAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKE  107

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKT
Sbjct  108  REFPGQVLRYEDNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKT  165



>ref|NP_001058863.1| Os07g0141400 [Oryza sativa Japonica Group]
 gb|AAC98778.1| 23 kDa polypeptide of photosystem II [Oryza sativa Japonica Group]
 dbj|BAC21393.1| probable photosystem II oxygen-evolving complex protein 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF20777.1| Os07g0141400 [Oryza sativa Japonica Group]
 gb|EAZ02732.1| hypothetical protein OsI_24850 [Oryza sativa Indica Group]
 gb|EAZ38656.1| hypothetical protein OsJ_23049 [Oryza sativa Japonica Group]
 dbj|BAG89433.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96904.1| unnamed protein product [Oryza sativa Japonica Group]
Length=254

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST CF LH       AR +S +   P  + + LVCRAQKQ  +     AA ++     
Sbjct  1    MASTSCF-LHQSTARVAARVASPS---PATRTHLLVCRAQKQDDADVSRRAALALLAGA-  55

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
                     AAVG KV+PA AAYGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE
Sbjct  56   --------TAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKE  107

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKT
Sbjct  108  REFPGQVLRYEDNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKT  165



>ref|XP_002992976.1| hypothetical protein SELMODRAFT_136349 [Selaginella moellendorffii]
 gb|EFJ05922.1| hypothetical protein SELMODRAFT_136349 [Selaginella moellendorffii]
Length=219

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  258  KVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNF  437
            KVS A AAYGEAANVFG PK  + F  +TGDGFKL VPSKWNPSKE+EFPG +LRYEDNF
Sbjct  27   KVSTASAAYGEAANVFGSPKQQSGFTTLTGDGFKLDVPSKWNPSKELEFPGTLLRYEDNF  86

Query  438  DQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DQ SN+ V+V PTDKKSITDYGSPEEFL+   YLLGKQAY+GKT
Sbjct  87   DQKSNLAVMVIPTDKKSITDYGSPEEFLSAYSYLLGKQAYAGKT  130



>ref|XP_008652004.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Zea mays]
 tpg|DAA59517.1| TPA: hypothetical protein ZEAMMB73_927356 [Zea mays]
Length=303

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST C  LH       A P  +    P      LVC+A+KQ A+A + D +   A++  
Sbjct  44   MASTSCCLLHQSTARLGASPRLAA--APPRSAQLLVCKARKQEAAADQSDVSRRAALALL  101

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
              +T     AA G+KV PA AAYGEAANVFGKPK +TE++  +GDGFKL +PSKWNPSKE
Sbjct  102  AGVT-----AAAGAKVGPAAAAYGEAANVFGKPKASTEYIAYSGDGFKLLIPSKWNPSKE  156

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PT KK+I DYGSPEEFL+QVDYLLG+QAY GKT
Sbjct  157  REFPGQVLRYEDNFDANSNVSVIIQPTSKKTIADYGSPEEFLSQVDYLLGRQAYGGKT  214



>tpg|DAA59516.1| TPA: hypothetical protein ZEAMMB73_927356 [Zea mays]
Length=337

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MAST C  LH       A P  +    P      LVC+A+KQ A+A + D +   A++  
Sbjct  44   MASTSCCLLHQSTARLGASPRLAA--APPRSAQLLVCKARKQEAAADQSDVSRRAALALL  101

Query  216  lalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE  395
              +T     AA G+KV PA AAYGEAANVFGKPK +TE++  +GDGFKL +PSKWNPSKE
Sbjct  102  AGVT-----AAAGAKVGPAAAAYGEAANVFGKPKASTEYIAYSGDGFKLLIPSKWNPSKE  156

Query  396  VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             EFPGQVLRYEDNFD  SN+ V++ PT KK+I DYGSPEEFL+QVDYLLG+QAY GKT
Sbjct  157  REFPGQVLRYEDNFDANSNVSVIIQPTSKKTIADYGSPEEFLSQVDYLLGRQAYGGKT  214



>ref|XP_002991817.1| hypothetical protein SELMODRAFT_134339 [Selaginella moellendorffii]
 gb|EFJ07079.1| hypothetical protein SELMODRAFT_134339 [Selaginella moellendorffii]
Length=219

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  258  KVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNF  437
            KVS A AAYGEAANVFG PK  + F  +TGDGFKL VPSKWNPSKE+EFPG +LRYEDNF
Sbjct  27   KVSTASAAYGEAANVFGSPKQQSGFTTLTGDGFKLDVPSKWNPSKELEFPGTLLRYEDNF  86

Query  438  DQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DQ SN+ V+V PTDKKSITDYGSPE+FL+   YLLGKQAY+GKT
Sbjct  87   DQKSNLAVMVIPTDKKSITDYGSPEDFLSAYSYLLGKQAYAGKT  130



>gb|ABK26108.1| unknown [Picea sitchensis]
Length=272

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  255  SKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDN  434
            SKVSPADAAYGE ANVFG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVLRYEDN
Sbjct  79   SKVSPADAAYGEPANVFGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLRYEDN  138

Query  435  FDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             D  SN+ V+V PTDKKSI D+G P++FL+QVD+LLGKQAYSGKT
Sbjct  139  GDTVSNVSVMVIPTDKKSIKDFGPPQQFLSQVDFLLGKQAYSGKT  183



>gb|ABY52939.1| chloroplast 23 kDa polypeptide of photosystem II [Oryza sativa 
Japonica Group]
Length=185

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  YGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICV  461
            YGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V
Sbjct  1    YGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSV  60

Query  462  LVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            ++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKT
Sbjct  61   IINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKT  96



>gb|ABK21284.1| unknown [Picea sitchensis]
Length=272

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  255  SKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDN  434
            SKVSPADAAYGEAANVFG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVL YEDN
Sbjct  79   SKVSPADAAYGEAANVFGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLIYEDN  138

Query  435  FDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             D  SN+ V+V PTDKKSI D+G P++FL+QVD+LLGKQAYSGKT
Sbjct  139  GDTVSNVSVMVIPTDKKSIKDFGPPQQFLSQVDFLLGKQAYSGKT  183



>ref|XP_006366632.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=221

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPK NT+FLP  GDGFKLQ+P+KWNPSKE+EFPGQVLRYEDNFD TSN+ V VTPT
Sbjct  42   NVFGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFPGQVLRYEDNFDSTSNLMVAVTPT  101

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DKKSITDYGSPEEFL++VDYLLGKQAY GKT
Sbjct  102  DKKSITDYGSPEEFLSKVDYLLGKQAYFGKT  132



>ref|XP_002461438.1| hypothetical protein SORBIDRAFT_02g002690 [Sorghum bicolor]
 gb|EER97959.1| hypothetical protein SORBIDRAFT_02g002690 [Sorghum bicolor]
Length=261

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +  G AAVG+KVSPA AAYGEAANVFGKPKTNTE++   GDGFKL +PSKWNPSKE EFP
Sbjct  59   LFAGVAAVGAKVSPAAAAYGEAANVFGKPKTNTEYIAYNGDGFKLLIPSKWNPSKEREFP  118

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            GQVLRYEDNFD  SN+ V++ PT KK+IT+YGSPEEFL+QVD+LLGKQA+ G T
Sbjct  119  GQVLRYEDNFDANSNVSVIIQPTSKKTITEYGSPEEFLSQVDFLLGKQAFGGST  172



>pdb|4RTH|A Chain A, The Crystal Structure Of Psbp From Zea Mays
 pdb|4RTH|B Chain B, The Crystal Structure Of Psbp From Zea Mays
Length=186

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  279  AYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNIC  458
            AYGEAANVFGK K NT+F+   GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ 
Sbjct  1    AYGEAANVFGKTKKNTDFISYVGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVS  60

Query  459  VLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            V++ PT KK+IT+YGSPEEFL+QVDYLLGKQAY GKT
Sbjct  61   VIIQPTSKKAITEYGSPEEFLSQVDYLLGKQAYGGKT  97



>ref|NP_001117239.1| photosystem II subunit P-1 [Arabidopsis thaliana]
 gb|AEE28023.1| photosystem II subunit P-1 [Arabidopsis thaliana]
Length=219

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPKTNT+FLP  GDGFK+QVP+KWNPSKE+E+PGQVLR+EDNFD TSN+ V+VTPT
Sbjct  40   NVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPT  99

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  100  DKKSITDYGSPEEFLSQVNYLLGKQAYFGET  130



>ref|XP_010457809.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Camelina sativa]
 ref|XP_010475409.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Camelina sativa]
Length=219

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPK NT+F+P  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPT
Sbjct  40   NVFGKPKANTDFMPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPT  99

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  100  DKKSITDYGSPEEFLSQVNYLLGKQAYFGET  130



>ref|XP_010486460.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Camelina sativa]
Length=219

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPK NT+F+P  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPT
Sbjct  40   NVFGKPKANTDFMPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPT  99

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  100  DKKSITDYGSPEEFLSQVNYLLGKQAYFGET  130



>ref|XP_006658268.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=340

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  YGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICV  461
            YGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V
Sbjct  156  YGEAANVFGKPKTNTEFISYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNLSV  215

Query  462  LVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            ++ PT KK+IT++GSPEEFLAQVDYLLGKQAY+GKT
Sbjct  216  MINPTTKKTITEFGSPEEFLAQVDYLLGKQAYAGKT  251



>ref|XP_007155967.1| hypothetical protein PHAVU_003G2476001g, partial [Phaseolus vulgaris]
 gb|ESW27961.1| hypothetical protein PHAVU_003G2476001g, partial [Phaseolus vulgaris]
Length=180

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPKTNT+FLP  G+GFK+ +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VT T
Sbjct  1    NVFGKPKTNTDFLPYNGNGFKISIPSKWNPSKEVEYPGQVLRYEDNFDTTSNVSVMVTAT  60

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DKKSITDYGSPE+FL++VDYLLGKQA+ G+T
Sbjct  61   DKKSITDYGSPEDFLSKVDYLLGKQAFFGQT  91



>dbj|BAA96364.1| oxygen evolving enhancer protein 2 [Bruguiera gymnorhiza]
Length=160

 Score =   160 bits (404),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  306  GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK  485
            GKPK NT+FLP  GDGFKLQ+PSKWNPSKEVEFPGQVLRYEDNFD  S++ V++TPTDKK
Sbjct  1    GKPKENTDFLPYDGDGFKLQIPSKWNPSKEVEFPGQVLRYEDNFDSNSSVSVIITPTDKK  60

Query  486  SITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            SITDYGSPE+FL+QVD+LLGKQAY+GKT
Sbjct  61   SITDYGSPEQFLSQVDFLLGKQAYAGKT  88



>ref|XP_001763729.1| predicted protein [Physcomitrella patens]
 gb|EDQ71371.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            ++ G  A  ++++PA+AAYGE+ANVFG PK +T F P TGDGF L +PSKWNPSKE EFP
Sbjct  66   LVAGVVAASARIAPANAAYGESANVFGAPKQSTGFSPFTGDGFSLDIPSKWNPSKEKEFP  125

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            G VLR+EDNFD T+N+ V +TP  K SIT+YGSPE+FL +V YL GKQAY+GKT
Sbjct  126  GTVLRFEDNFDATNNLFVSITPASKGSITEYGSPEKFLDEVSYLFGKQAYNGKT  179



>ref|XP_001771262.1| predicted protein [Physcomitrella patens]
 gb|EDQ63973.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            ++ G  A G++++PA+AAYGE+ANVFG PK +T F P +G+GF L++PSKWNPSKE EFP
Sbjct  66   LVAGVVAAGARIAPANAAYGESANVFGAPKQSTGFNPYSGNGFSLEIPSKWNPSKEKEFP  125

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            G VLRYEDNFD T+N+ V +TP  K SIT+YG PE+FL +V YL GKQAYSGKT
Sbjct  126  GTVLRYEDNFDSTTNLFVSITPATKGSITEYGPPEKFLDEVSYLFGKQAYSGKT  179



>dbj|BAA08564.1| 23 kDa polypeptide of photosystem II [Oryza sativa (japonica 
cultivar-group)]
Length=252

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  249  VGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYE  428
            VG KV+PA AAYGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYE
Sbjct  58   VGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYE  117

Query  429  DNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DNFD  SN+ V++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKT
Sbjct  118  DNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKT  164



>ref|XP_010657103.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Vitis vinifera]
Length=218

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPKTNT+FLP  G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPT
Sbjct  40   NVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPT  99

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            DKKSITDYGSPEEFL++VD+LLGKQA+ G
Sbjct  100  DKKSITDYGSPEEFLSKVDFLLGKQAFFG  128



>sp|Q00434.1|PSBP_WHEAT RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 emb|CAA40669.1| 23kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=258

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 119/179 (66%), Gaps = 10/179 (6%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQL-VCRAQKQsasaheddaassvavsr  212
            MAST CF LH       A      R  P +   QL VC+AQK   +A +    +S   + 
Sbjct  1    MASTSCF-LHQSTARLAASA----RPAPAVGRTQLFVCKAQKNDEAASDAAVVTSRRAAL  55

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
             L       A     KVSPA AAYGEAANVFGK K NT+F+  +G+GFKL +P+KWNPSK
Sbjct  56   SLLAGAAAIAV----KVSPAAAAYGEAANVFGKAKKNTDFVAYSGEGFKLMIPAKWNPSK  111

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            E EFPGQVLRYEDNFD TSN+ V++ PT KK+ITDYGSPEEFL+QV +LLG+Q+Y GKT
Sbjct  112  EREFPGQVLRYEDNFDATSNLSVIINPTTKKTITDYGSPEEFLSQVGFLLGQQSYGGKT  170



>ref|XP_009118486.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Brassica rapa]
Length=219

 Score =   157 bits (396),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPT
Sbjct  40   NVFGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPT  99

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DKKSITDYGSPEEFL+QV+YLLGKQAY G+T
Sbjct  100  DKKSITDYGSPEEFLSQVNYLLGKQAYFGET  130



>pdb|1V2B|A Chain A, Crystal Structure Of Psbp Protein In The Oxygen-Evolving 
Complex Of Photosystem Ii From Higher Plants
 pdb|1V2B|B Chain B, Crystal Structure Of Psbp Protein In The Oxygen-Evolving 
Complex Of Photosystem Ii From Higher Plants
Length=177

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  306  GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK  485
            GKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDKK
Sbjct  1    GKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKK  60

Query  486  SITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            SITD+GSPE+FL+QVDYLLG+QAYSGKT
Sbjct  61   SITDFGSPEQFLSQVDYLLGRQAYSGKT  88



>ref|XP_001765395.1| predicted protein [Physcomitrella patens]
 gb|EDQ69858.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            ++ G  A G+KV  A+AAYGE+ANVFG PK +T F P  G+GF L VPSKWNPSKE EFP
Sbjct  67   LVAGVLAAGAKVGSANAAYGESANVFGAPKISTGFTPFAGNGFTLDVPSKWNPSKEQEFP  126

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            G V+R+EDNFD T+N+ V +TP  K SIT+YG PE+FL +V +L GKQAYSGKT
Sbjct  127  GTVVRFEDNFDATNNLFVSITPATKGSITEYGPPEKFLDEVSFLFGKQAYSGKT  180



>tpg|DAA42743.1| TPA: hypothetical protein ZEAMMB73_321092 [Zea mays]
Length=258

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGK K NT+F+   GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT
Sbjct  79   NVFGKTKKNTDFISYVGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIIQPT  138

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             KK+IT+YGSPEEFL+QVDYLLGKQAY GKT
Sbjct  139  SKKAITEYGSPEEFLSQVDYLLGKQAYGGKT  169



>ref|XP_001753947.1| predicted protein [Physcomitrella patens]
 gb|EDQ81269.1| predicted protein, partial [Physcomitrella patens]
Length=216

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            ++ G  A G+KV  A+AAYGE+ANVFG PK  T F P  G+GF L VPSKWNPSKE EFP
Sbjct  14   LVAGVIAAGAKVGSANAAYGESANVFGAPKKQTGFTPFIGNGFSLDVPSKWNPSKEKEFP  73

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            G V+R+EDNFD T+N+ V VTP  K SI++YG PE+FL +V +L GKQAY GKT
Sbjct  74   GTVVRFEDNFDATNNLFVSVTPAKKGSISEYGPPEKFLDEVSFLFGKQAYEGKT  127



>gb|EMS54608.1| Oxygen-evolving enhancer protein 2, chloroplastic [Triticum urartu]
Length=238

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 102/179 (57%), Gaps = 31/179 (17%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQ-LVCRAQKQsasaheddaassvavsr  212
            MAST CF LH       A      R  P +   Q  VC+AQK                  
Sbjct  1    MASTSCF-LHQSTARLAASA----RPAPAVGRTQPFVCKAQKND----------------  39

Query  213  rlalTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK  392
                     A            A   A+NVFGK K NT+F+  +G+GFKL +P+KWNPSK
Sbjct  40   ---------APPPPPPTEKQVRASCRASNVFGKAKKNTDFVAYSGEGFKLMIPAKWNPSK  90

Query  393  EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            E EFPGQVLRYEDNFD TSN+ V++ PT KK+ITDYGSPEEFL+QV +LLG+Q+Y GKT
Sbjct  91   EREFPGQVLRYEDNFDATSNLSVIINPTTKKTITDYGSPEEFLSQVGFLLGQQSYGGKT  149



>gb|EMT29894.1| Oxygen-evolving enhancer protein 2, chloroplastic [Aegilops tauschii]
Length=300

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  297  NVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  476
            NVFGK K NT+F+  +G+GFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++ PT
Sbjct  113  NVFGKAKKNTDFVAYSGEGFKLMIPAKWNPSKEREFPGQVLRYEDNFDATSNLSVIINPT  172

Query  477  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             KK+ITDYGSPEEFL+QV +LLG+Q+Y GKT
Sbjct  173  TKKTITDYGSPEEFLSQVGFLLGQQSYGGKT  203



>gb|ABK55671.1| chloroplast photosystem II oxygen-evolving complex 23 kDa polypeptide 
[Cucumis sativus]
Length=150

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  324  TEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  503
            T++LP +GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PTDKKSI D+G
Sbjct  1    TDYLPYSGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFG  60

Query  504  SPEEFLAQVDYLLGKQAYSGKT  569
            SPEEFL++VDYLLGKQAY GKT
Sbjct  61   SPEEFLSKVDYLLGKQAYFGKT  82



>sp|P11471.1|PSBP_CHLRE RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAA33088.1| oxygen-evolving enhancer protein 2 [Chlamydomonas reinhardtii]
Length=245

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  264  SPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQ  443
            SPA+AAYG++ANVFGK    + F+P  GDGF L +P+KWNPSKE +FPG +LRYEDNFD 
Sbjct  53   SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVILRYEDNFDA  112

Query  444  TSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             +N+ V+   TDKK+I D+GS ++FL  V YLLGKQAYSG+T
Sbjct  113  VNNLVVIAQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGET  154



>gb|ACD10926.1| photosystem II oxygen evolving system 23 kDa subunit [Lemna minor]
Length=115

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  321  NTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDY  500
            NT+F+P  G+GF L +P+KWNPSKE+E+PGQVLR+EDNFD TSN+ VLV  T KKSI++Y
Sbjct  1    NTDFIPYAGEGFNLLIPAKWNPSKEIEYPGQVLRFEDNFDATSNVSVLVQNTSKKSISEY  60

Query  501  GSPEEFLAQVDYLLGKQAYSGKT  569
            GSPEEFLAQVDYLLGKQ Y GKT
Sbjct  61   GSPEEFLAQVDYLLGKQVYGGKT  83



>ref|XP_001694126.1| oxygen-evolving enhancer protein 2 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP03062.1| oxygen-evolving enhancer protein 2 of photosystem II [Chlamydomonas 
reinhardtii]
Length=282

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  264  SPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQ  443
            SPA+AAYG++ANVFGK    + F+P  GDGF L +P+KWNPSKE +FPG +LRYEDNFD 
Sbjct  90   SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVILRYEDNFDA  149

Query  444  TSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             +N+ V+   TDKK+I D+GS ++FL  V YLLGKQAYSG+T
Sbjct  150  VNNLVVIAQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGET  191



>ref|XP_002956365.1| oxygen-evolving enhancer protein 2 [Volvox carteri f. nagariensis]
 gb|EFJ42509.1| oxygen-evolving enhancer protein 2 [Volvox carteri f. nagariensis]
Length=1454

 Score =   141 bits (356),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +3

Query  255   SKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDN  434
             S  +P+ AAYG++ANVFGK    + F+   GDGF L +PSKWNPSKE +FPG  LRYEDN
Sbjct  1259  SNANPSSAAYGDSANVFGKVTNKSGFVSYAGDGFALLLPSKWNPSKETDFPGVTLRYEDN  1318

Query  435   FDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
             FD  +N+ V+  PTDKKSI D GSP++FL  V YLLG+QAYSG+T
Sbjct  1319  FDAVNNLVVIAQPTDKKSIEDLGSPDKFLESVSYLLGRQAYSGET  1363



>emb|CCM44238.1| photosystem II subunit P, partial [Chlamydomonas raudensis]
Length=247

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPG  410
            ++G+AA+ S  +PA AAYG+ ANVFGK    ++F+P  GDGF +Q+P KWNPSKE +FPG
Sbjct  46   IVGSAALVS-AAPAFAAYGDGANVFGKVTNQSQFIPYVGDGFAVQLPGKWNPSKEQDFPG  104

Query  411  QVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
              LRYEDN D  +N  +L   TDK  I+D+G  + FL  V YLLGKQAYSG+T
Sbjct  105  VQLRYEDNGDAVNNFVILKNKTDKSKISDFGDKQAFLNSVSYLLGKQAYSGET  157



>gb|KIY95992.1| hypothetical protein MNEG_11971 [Monoraphidium neglectum]
Length=791

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L G AA+ S  +P+ AAYG++ANVFGK    T F+P  G+GF L +PSKWNPSKE +F 
Sbjct  585  MLAGVAALASGAAPSLAAYGDSANVFGKVTNKTGFVPYAGEGFALLLPSKWNPSKEQDFA  644

Query  408  G---QVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
                 VLRYEDN D  +N+ VL   +DK  I+ YG PE FL  +  LLGKQA+SG+T
Sbjct  645  KFGTTVLRYEDNGDAVNNVVVLTADSDKSDISGYGEPEAFLQTLTPLLGKQAFSGET  701



>ref|XP_005649549.1| photosystem II oxygen evolving complex protein PsbP [Coccomyxa 
subellipsoidea C-169]
 gb|EIE25005.1| photosystem II oxygen evolving complex protein PsbP [Coccomyxa 
subellipsoidea C-169]
Length=255

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTN-TEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            + G+ A+ S V P++AA+GEAA VFG   TN T F+P +G+GF L +PSK+NPSKE EFP
Sbjct  52   VAGSIALLSGVRPSEAAFGEAARVFGSKATNSTGFVPYSGEGFALLLPSKYNPSKEKEFP  111

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            G  LRYEDN D  ++I V+V  T K SI +YG+P++FL +   LLG Q + G++
Sbjct  112  GTQLRYEDNGDAVNSIAVMVRSTTKNSIEEYGTPDKFLDENKNLLGAQVFKGES  165



>ref|XP_001763489.1| predicted protein [Physcomitrella patens]
 gb|EDQ71678.1| predicted protein [Physcomitrella patens]
Length=184

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  291  AANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVT  470
            AANVFG PK  T F   T +GF + V SKWNPSKE EFP  V+RY+DNFD T+N+ V ++
Sbjct  3    AANVFGAPKKTTGFTSFTDNGFSMDVRSKWNPSKEKEFPEIVIRYKDNFDATNNLFVSIS  62

Query  471  PTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK  566
            PT K +I+DY +PE+F  QV YL  KQAY GK
Sbjct  63   PTTKSTISDYRAPEKFFDQVSYLFEKQAYDGK  94



>emb|CEG02166.1| Mog1/PsbP, alpha/beta/alpha sandwich [Ostreococcus tauri]
Length=243

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPG  410
            LI   A      PA AAYG++ANV+G     T F+P  GDG+   +P+K+NPSKE  FP 
Sbjct  42   LIAGTASVLASKPAFAAYGDSANVWGGVTNPTGFVPYAGDGYAFLLPAKYNPSKERPFPN  101

Query  411  QVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            Q   +EDNFD  +NI V+V    K  I+DYG PE FL QV YLLGKQ+Y+G+T
Sbjct  102  QDAYWEDNFDAVTNISVIVEKASKSKISDYGKPEAFLEQVSYLLGKQSYTGET  154



>ref|XP_001422601.1| oxygen evolving enhancer 2 of Photosystem II [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00918.1| oxygen evolving enhancer 2 of Photosystem II [Ostreococcus lucimarinus 
CCE9901]
Length=249

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPG  410
            LI  A   +   PA AAYG++ANVFG     T F+P  GDGF   +PSK+NPSKE  FP 
Sbjct  48   LIAGATTLAMSKPAFAAYGDSANVFGGVSNPTGFVPYAGDGFAFLLPSKYNPSKERPFPN  107

Query  411  QVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
                +EDNFDQ +NI V+    +K SI  YG PE+FL ++ YLLG Q+Y+G+T
Sbjct  108  TECYFEDNFDQVTNISVIAEKAEKGSIDAYGKPEQFLEKLGYLLGVQSYAGQT  160



>ref|XP_005649550.1| oxygen evolving enhancer 2 of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25006.1| oxygen evolving enhancer 2 of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=254

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVF-GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            L GA+ + SK   + AA+GE+A++F  KP   T F+P +G+GF L +PSKWNPSKE E  
Sbjct  51   LAGASLLLSKPQSSQAAFGESASIFKSKPTNTTGFIPYSGEGFALLLPSKWNPSKEREES  110

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            G  LRYEDN D  +++ V+   +DK SI  YG+P+EFL  +  LLG+Q + G+T
Sbjct  111  GVALRYEDNGDNLNHVTVITRKSDKSSIDQYGAPDEFLNSIKNLLGEQTFKGET  164



>ref|XP_002505689.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas sp. RCC299]
 gb|ACO66947.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas sp. RCC299]
Length=257

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  YGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICV  461
            YG++AN++G    ++ F+P +GDG+   +PSK+NPSKE  FPGQ   +EDNFD  SNI +
Sbjct  73   YGDSANIWGSTTNSSGFIPYSGDGYAFLLPSKYNPSKERPFPGQDAYFEDNFDAVSNISI  132

Query  462  LVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            LV    K  I D+GSPE +L ++ YLLG+Q YSG+T
Sbjct  133  LVEKCGKSKIEDFGSPESYLEKIGYLLGQQVYSGET  168



>ref|XP_003060004.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas pusilla CCMP1545]
 gb|EEH55956.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas pusilla CCMP1545]
Length=258

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +3

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPG  410
            +I AA V +   P+ AAYG++AN++G     + F+P +GDG+   +PSK+NPSKE  FP 
Sbjct  56   VITAAGVAAVAKPSLAAYGDSANIWGATTNTSGFIPYSGDGYAFLLPSKYNPSKERPFPN  115

Query  411  QVLRYEDNFDQTSNICVLVTPTDKKS-ITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            Q + +EDNFD  +NI V+V     KS I D+GSPE +L ++ YLLG+Q Y+G+T
Sbjct  116  QDVYFEDNFDAVTNISVMVEKKCGKSKIEDFGSPEAYLEKIGYLLGQQVYAGET  169



>ref|XP_007509854.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18969.1| predicted protein [Bathycoccus prasinos]
Length=255

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = +3

Query  267  PADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQT  446
            P+ AAYG++ANVFG     + F+P  G+G+   +PSK+NPSKE  FP     +EDNFDQ 
Sbjct  66   PSFAAYGDSANVFGGVSNTSGFIPYAGNGYAFLLPSKYNPSKERPFPDTDSYFEDNFDQV  125

Query  447  SNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            SNI V+ T     SI  YG PE  LA   YLLG Q+Y+G+T
Sbjct  126  SNISVITTKAKGNSIESYGKPEAMLADFGYLLGVQSYAGET  166



>ref|XP_011396200.1| Oxygen-evolving enhancer protein 2, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23330.1| Oxygen-evolving enhancer protein 2, chloroplastic [Auxenochlorella 
protothecoides]
Length=255

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +3

Query  270  ADAAYGEAANVF-GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQT  446
            + AAYG+AA VF GK    + F+P  G+GF L +P+KWNPS E +FPG VLRYEDN+   
Sbjct  64   SQAAYGDAARVFAGKITNKSGFVPYAGEGFALLLPAKWNPSPERDFPGTVLRYEDNYFPV  123

Query  447  SNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQA  554
            +N+ V+  P  K SI D G+P++FL+   +L G+ A
Sbjct  124  NNLMVIQRPVGKNSIEDLGAPDKFLSDNAFLFGESA  159



>gb|KIZ07080.1| hypothetical protein MNEG_0869 [Monoraphidium neglectum]
Length=233

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 15/114 (13%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L G AA+ +  +P+ AAYG++ANVFGK    + F+P +G+GF + +PS           
Sbjct  45   MLAGVAALATGAAPSFAAYGDSANVFGKVTNKSGFIPYSGEGFAILLPS-----------  93

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
                RYEDN D  +N+ VL  P DK  IT YG+PE+ L  + +L G+Q++SG+T
Sbjct  94   ----RYEDNGDSVNNVVVLTQPADKGDITSYGAPEKLLQDLTFLFGRQSFSGET  143



>gb|ACF24545.1| photosystem II oxygen evolving enhancer protein 2 [Gymnochlora 
stellata]
Length=289

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +3

Query  249  VGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYE  428
            V  ++  ADAAYG+ ANVFG+   +  F+P   D +   +PSKW  S E +F   + RY+
Sbjct  83   VVGQLKKADAAYGDPANVFGRTTNSKGFIPTKRDDYSFLLPSKWIYSSERDFDDIIERYQ  142

Query  429  DNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            DNFD  +   ++     K SI   GSPEEFL   ++LLGKQ + G+T
Sbjct  143  DNFDAVNFGTIIKKSVGKSSIDQLGSPEEFLKSCEFLLGKQTWQGET  189



>gb|AAP79210.1| photosystem II protein PsbP [Bigelowiella natans]
Length=288

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = +3

Query  240  AAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVL  419
            AA +  +++ A A YG+ ANVFGK   +  F+P   D +   +PSKW  S E +F   V 
Sbjct  88   AAGLFGQLNKASAEYGDPANVFGKVTNSKGFIPTKRDEYSFLLPSKWLYSTERDFDNIVE  147

Query  420  RYEDNFDQTSNICVLVTPTD-KKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            RY+DNFD  +   ++    D K S+   GSPEEFL   D+L GKQA++G+T
Sbjct  148  RYQDNFDAVNFAAIIKKKVDGKTSVDQLGSPEEFLKSCDFLFGKQAWTGET  198



>gb|ABS71999.1| putative chloroplast photosystem II 23kDa protein [Olea europaea]
Length=76

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  426  EDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            EDNFD  SN+ V+VTPTDKKSI D+GSPE FL+QVDYLLGKQAY GKT
Sbjct  1    EDNFDSNSNVSVMVTPTDKKSIADFGSPENFLSQVDYLLGKQAYFGKT  48



>gb|ADJ67185.1| oxygen-evolving enhancer protein 2 [Jatropha curcas]
Length=114

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +3

Query  51   CFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTV  230
            CF  HH   +  +  S S R V   KP QL+CRA  Q   A +D+  S   VSRRLALTV
Sbjct  2    CFLHHHALTNRLSSSSLSQRQVS--KPTQLICRA-TQKQQAAQDEDISLSLVSRRLALTV  58

Query  231  LIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLP  338
            LIGAAAVGSKV+PADAAYGE+ANVFGKPKTNT+FLP
Sbjct  59   LIGAAAVGSKVAPADAAYGESANVFGKPKTNTDFLP  94



>gb|ABV57471.1| chloroplast PsbP [Phyllostachys edulis]
Length=118

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +3

Query  417  LRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            LRYEDNFD  SN+ V++TPT KK+IT+YGSPEEFL+QVDYLLGKQAYSGKT
Sbjct  1    LRYEDNFDSNSNVSVMITPTTKKTITEYGSPEEFLSQVDYLLGKQAYSGKT  51



>emb|CCC15105.1| oxygen-evolving enhancer protein 2 [Lepidodinium chlorophorum]
Length=191

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +3

Query  258  KVSPADAAYGEAANVFGKPKTN-TEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDN  434
            K   A AAYG+ AN+F    TN + F   +GDGF L +PSKWNPSKE +F G VLRYE+N
Sbjct  111  KDRAALAAYGDGANIFAGRATNPSGFSAYSGDGFSLLLPSKWNPSKEKDFDGVVLRYENN  170

Query  435  FDQTSNICVLVTPTDKKSITD  497
             D+++++  L     K  + D
Sbjct  171  ADRSNDLMGLKIKNAKNKMED  191



>dbj|BAH57265.1| AT1G06680 [Arabidopsis thaliana]
Length=168

 Score = 54.7 bits (130),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 7/63 (11%)
 Frame = +3

Query  105  NRYVPVLKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAY  284
             R+V + KP Q++C+AQ+            + AVSRRLALT+L+GAAAVGSKVSPADAAY
Sbjct  27   QRHVSLSKPVQIICKAQQ-------SHEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAY  79

Query  285  GEA  293
            GEA
Sbjct  80   GEA  82


 Score = 43.9 bits (102),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  310  SRKQTQNSCQSPETDSSCRFPQSGTLARKLSFPVRFSDTKTTLTKPATSASW  465
            S+++TQ SC + E  S CRF Q+GT A++LS   +   +KTT    A S SW
Sbjct  92   SQRRTQTSCHTMEMGSKCRFQQNGTQAKRLSIQDKSLGSKTTSMLLAISMSW  143



>ref|XP_007155968.1| hypothetical protein PHAVU_003G2476000g, partial [Phaseolus vulgaris]
 gb|ESW27962.1| hypothetical protein PHAVU_003G2476000g, partial [Phaseolus vulgaris]
Length=80

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 50/86 (58%), Gaps = 6/86 (7%)
 Frame = +3

Query  36   MASTQCFYLHHpalsaparpsssNRYVPVLKPNQLVCRAQKQsasaheddaassvavsrr  215
            MASTQCF  HH   +         R V   KPN +VC+AQKQ     +     S  ++  
Sbjct  1    MASTQCFLHHHALTNPARASP--QRQVLTTKPNHIVCKAQKQVVQEPDATTLVSRRLAL-  57

Query  216  lalTVLIGAAAVGSKVSPADAAYGEA  293
               TVLIGAAAVGSKVSPADAAYGEA
Sbjct  58   ---TVLIGAAAVGSKVSPADAAYGEA  80



>ref|XP_005844169.1| hypothetical protein CHLNCDRAFT_139312 [Chlorella variabilis]
 gb|EFN52067.1| hypothetical protein CHLNCDRAFT_139312 [Chlorella variabilis]
Length=205

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  267  PADAAYGEAANVFGKPKTN-TEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLR  422
            P++AAYG+AA VF    TN + F+P  GDGF + +PSKWNPSKE +FPG VLR
Sbjct  59   PSEAAYGDAARVFAGSITNKSGFIPYAGDGFAVLIPSKWNPSKEQDFPGVVLR  111



>ref|NP_180637.3| photosystem II subunit P-2 [Arabidopsis thaliana]
 sp|O49344.3|PSBP2_ARATH RecName: Full=Putative oxygen-evolving enhancer protein 2-2; 
Short=OEE2 [Arabidopsis thaliana]
 dbj|BAD43501.1| putative photosystem II oxygen-evolving complex 23K protein [Arabidopsis 
thaliana]
 dbj|BAD43584.1| putative photosystem II oxygen-evolving complex 23K protein [Arabidopsis 
thaliana]
 dbj|BAD43697.1| putative photosystem II oxygen-evolving complex 23K protein [Arabidopsis 
thaliana]
 gb|AAY34155.1| At2g30790 [Arabidopsis thaliana]
 gb|AEC08441.1| photosystem II subunit P-2 [Arabidopsis thaliana]
Length=125

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  462  LVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKT  569
            ++TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T
Sbjct  1    MITPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGET  36



>gb|AAT09057.1| oxygen-evolving complex [Beta vulgaris]
Length=62

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 5/63 (8%)
 Frame = +3

Query  108  RYVPV-LKPNQLVCRAQKQsasaheddaassvavsrrlalTVLIGAAAVGSKVSPADAAY  284
            RY  V +KP Q+VC+AQKQ   A+  +A+ S  ++     TVLIGAAAVGSKVSPADAAY
Sbjct  4    RYQAVSIKPTQIVCKAQKQDDEANVLNASVSRRLAL----TVLIGAAAVGSKVSPADAAY  59

Query  285  GEA  293
            GEA
Sbjct  60   GEA  62



>gb|KDO67747.1| hypothetical protein CISIN_1g026701mg [Citrus sinensis]
Length=147

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 9/98 (9%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L+GA  + + + PA++ + +       PK    F+    DG+    PS W    E EF 
Sbjct  59   LLMGAGLLTANLLPANSLFAQEI-----PKNYDAFVDRI-DGYSYVYPSDWT---EFEFT  109

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFL  521
            G    ++D + Q  N+ V   PTDKK + D G  EEFL
Sbjct  110  GHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEFL  147



>ref|XP_007009492.1| PsbP-like protein 2 [Theobroma cacao]
 gb|EOY18302.1| PsbP-like protein 2 [Theobroma cacao]
Length=234

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 50/112 (45%), Gaps = 13/112 (12%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L+G  AV   + PA +   E       P+    F+ I  DG+    PS W   +E +F 
Sbjct  58   LLLGVGAVTVSLLPATSLLAEEI-----PQNYQAFVDIL-DGYSYYYPSDW---REFDFR  108

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            G    ++D F Q  N+ V   PTDKK I D G  EE    V Y L    Y+ 
Sbjct  109  GHDSAFKDKFLQLQNVRVRFIPTDKKDIHDLGPIEE----VVYNLVNHVYAA  156



>gb|KJB76059.1| hypothetical protein B456_012G069100 [Gossypium raimondii]
Length=262

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (49%), Gaps = 9/96 (9%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L+G  A+ + + PA++   E       P+    F+ I  DG+    PS W   +E +F 
Sbjct  62   LLLGVGAITANLLPANSLLAEEI-----PQNYRAFVDIP-DGYSYYYPSDW---REFDFR  112

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEE  515
            G    ++D F Q  N+ V   PTDK+ I + G  EE
Sbjct  113  GHDSAFKDRFLQLQNVRVRFIPTDKQDIHELGPIEE  148



>gb|KJB76058.1| hypothetical protein B456_012G069100 [Gossypium raimondii]
Length=238

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 13/112 (12%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L+G  A+ + + PA++   E       P+    F+ I  DG+    PS W   +E +F 
Sbjct  62   LLLGVGAITANLLPANSLLAEEI-----PQNYRAFVDIP-DGYSYYYPSDW---REFDFR  112

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            G    ++D F Q  N+ V   PTDK+ I + G  EE    V Y L    Y+ 
Sbjct  113  GHDSAFKDRFLQLQNVRVRFIPTDKQDIHELGPIEE----VVYNLVNHVYAA  160



>gb|KHG00113.1| PsbP-like protein 2, chloroplastic [Gossypium arboreum]
Length=239

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 13/112 (12%)
 Frame = +3

Query  228  VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFP  407
            +L+G  A+ + + PA++   E       P+    F+ I  DG+    PS W   +E +F 
Sbjct  63   LLLGVGAITANLLPANSLLAEEI-----PQNYRAFVDIP-DGYSYYYPSDW---REFDFR  113

Query  408  GQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG  563
            G    ++D F Q  N+ V   PTDK+ I + G  EE    V Y L    Y+ 
Sbjct  114  GHDSAFKDRFLQLQNVRVRFIPTDKQDIHELGPIEE----VVYNLVNHVYAA  161



Lambda      K        H        a         alpha
   0.317    0.127    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515