BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016P06

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC47163.2|  CDPK1                                                   335   5e-110   Ipomoea nil [qian niu]
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      256   3e-79    Nicotiana sylvestris
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      251   3e-77    Nicotiana tomentosiformis
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  251   4e-77    Nicotiana tabacum [American tobacco]
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    244   2e-74    Solanum tuberosum [potatoes]
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      241   2e-73    Solanum lycopersicum
gb|KDO76380.1|  hypothetical protein CISIN_1g010013mg                   228   4e-70    Citrus sinensis [apfelsine]
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    233   6e-70    Nelumbo nucifera [Indian lotus]
ref|XP_006439440.1|  hypothetical protein CICLE_v10019724mg             227   9e-70    
gb|KDO76378.1|  hypothetical protein CISIN_1g010013mg                   229   9e-70    Citrus sinensis [apfelsine]
gb|KDO76379.1|  hypothetical protein CISIN_1g010013mg                   228   2e-69    Citrus sinensis [apfelsine]
gb|KDO76377.1|  hypothetical protein CISIN_1g010013mg                   230   2e-69    Citrus sinensis [apfelsine]
ref|XP_006439442.1|  hypothetical protein CICLE_v10019724mg             228   2e-69    
ref|XP_006439441.1|  hypothetical protein CICLE_v10019724mg             227   3e-69    
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   229   6e-69    Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    229   6e-69    Citrus sinensis [apfelsine]
emb|CAN61364.1|  hypothetical protein VITISV_032639                     228   7e-69    Vitis vinifera
gb|KDP25359.1|  hypothetical protein JCGZ_20515                         229   1e-68    Jatropha curcas
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             229   1e-68    Citrus clementina [clementine]
gb|AGS15000.1|  calcium-dependent protein kinase 3                      228   3e-68    Vitis amurensis
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      228   3e-68    Vitis vinifera
ref|XP_006849377.1|  hypothetical protein AMTR_s00158p00082100          228   5e-68    Amborella trichopoda
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   227   7e-68    Medicago truncatula
gb|EYU40050.1|  hypothetical protein MIMGU_mgv1a011511mg                219   9e-68    Erythranthe guttata [common monkey flower]
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    225   3e-67    Nelumbo nucifera [Indian lotus]
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             225   3e-67    Phaseolus vulgaris [French bean]
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    224   6e-67    
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    224   7e-67    Sesamum indicum [beniseed]
gb|KJB52213.1|  hypothetical protein B456_008G251000                    224   9e-67    Gossypium raimondii
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         224   1e-66    Ricinus communis
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      224   1e-66    Gossypium arboreum [tree cotton]
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-66    Glycine max [soybeans]
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 226   2e-66    
ref|XP_007040388.1|  Calcium-dependent protein kinase 6 isoform 2       222   2e-66    
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    223   3e-66    Cicer arietinum [garbanzo]
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       222   4e-66    
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    221   8e-66    Glycine max [soybeans]
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      222   9e-66    Eucalyptus grandis [rose gum]
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 220   2e-65    Populus trichocarpa [western balsam poplar]
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    220   2e-65    Cicer arietinum [garbanzo]
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             219   5e-65    
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      219   6e-65    Fragaria vesca subsp. vesca
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             219   7e-65    Prunus persica
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      219   8e-65    Pyrus x bretschneideri [bai li]
ref|XP_009386326.1|  PREDICTED: calcium-dependent protein kinase ...    218   1e-64    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU98505.1|  calcium-dependent protein kinase                        218   1e-64    Musa acuminata AAA Group [Cavendish banana]
gb|AFW83320.1|  putative calcium-dependent protein kinase family ...    214   2e-64    
gb|KHN16772.1|  Calcium-dependent protein kinase 3                      207   2e-64    Glycine soja [wild soybean]
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    217   3e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    217   5e-64    Populus euphratica
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    216   8e-64    Tarenaya hassleriana [spider flower]
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      215   2e-63    Tarenaya hassleriana [spider flower]
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        215   2e-63    Zea mays [maize]
ref|NP_001169721.1|  uncharacterized LOC100383602                       215   3e-63    Zea mays [maize]
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    215   3e-63    Phoenix dactylifera
gb|AIU98501.1|  calcium-dependent protein kinase                        214   5e-63    Musa acuminata AAA Group [Cavendish banana]
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      214   7e-63    Populus euphratica
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...    214   8e-63    Setaria italica
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    212   8e-63    
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...    213   1e-62    Brachypodium distachyon [annual false brome]
emb|CAF18446.1|  putative calcium-dependent protein kinase              213   2e-62    Triticum aestivum [Canadian hard winter wheat]
gb|ABY59010.1|  calcium-dependent protein kinase                        213   2e-62    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ95679.1|  predicted protein                                      213   2e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC71113.1|  hypothetical protein OsI_02910                          212   3e-62    Oryza sativa Indica Group [Indian rice]
gb|ACA63885.1|  calcium-dependent protein kinase                        212   3e-62    Hordeum vulgare [barley]
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          212   3e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011080890.1|  PREDICTED: calcium-dependent protein kinase 3      211   3e-62    Sesamum indicum [beniseed]
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    211   6e-62    Elaeis guineensis
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    211   6e-62    Elaeis guineensis
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    212   7e-62    Setaria italica
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      213   7e-62    Gossypium arboreum [tree cotton]
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                    211   9e-62    Arabis alpina [alpine rockcress]
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      211   1e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          210   2e-61    Sorghum bicolor [broomcorn]
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g             209   2e-61    Phaseolus vulgaris [French bean]
gb|AFW81269.1|  putative calcium-dependent protein kinase family ...    209   2e-61    
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg             209   4e-61    Eutrema salsugineum [saltwater cress]
dbj|BAD61167.1|  putative calcium-dependent protein kinase              213   4e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg             209   4e-61    Capsella rubella
ref|NP_001056455.1|  Os05g0585500                                       209   6e-61    
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    209   6e-61    Zea mays [maize]
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3      208   1e-60    Camelina sativa [gold-of-pleasure]
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...    208   1e-60    Brassica rapa
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...    208   1e-60    Camelina sativa [gold-of-pleasure]
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...    208   1e-60    Camelina sativa [gold-of-pleasure]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      207   3e-60    Cucumis melo [Oriental melon]
emb|CDY62741.1|  BnaC07g50270D                                          208   4e-60    Brassica napus [oilseed rape]
emb|CDY54853.1|  BnaC01g15460D                                          206   6e-60    Brassica napus [oilseed rape]
gb|AHN16201.1|  CPK3-2.1                                                206   6e-60    Brassica napus [oilseed rape]
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950          206   6e-60    Sorghum bicolor [broomcorn]
ref|XP_002867697.1|  calcium-dependent protein kinase 6                 206   6e-60    
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                           206   9e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194096.1|  calcium-dependent protein kinase 6                    206   1e-59    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ94561.1|  predicted protein                                      204   3e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG14847.1|  Calcium-dependent protein kinase 3                      204   4e-59    Gossypium arboreum [tree cotton]
gb|KJB39672.1|  hypothetical protein B456_007G025000                    201   7e-59    Gossypium raimondii
gb|KJB39669.1|  hypothetical protein B456_007G025000                    201   8e-59    Gossypium raimondii
gb|AGG35973.1|  calcium-dependent protein kinase 3                      203   8e-59    Brassica napus [oilseed rape]
emb|CDY44125.1|  BnaA01g13330D                                          203   8e-59    Brassica napus [oilseed rape]
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...    203   1e-58    Phoenix dactylifera
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...    203   1e-58    Brassica rapa
gb|KJB39670.1|  hypothetical protein B456_007G025000                    201   2e-58    Gossypium raimondii
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...    201   2e-58    
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...    202   3e-58    Beta vulgaris subsp. vulgaris [field beet]
gb|EPS59027.1|  hypothetical protein M569_15783                         199   3e-58    Genlisea aurea
gb|KJB39673.1|  hypothetical protein B456_007G025000                    202   3e-58    Gossypium raimondii
gb|KEH27423.1|  calmodulin-domain kinase CDPK protein                   199   3e-58    Medicago truncatula
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            201   4e-58    Cucumis sativus [cucumbers]
gb|EPS65220.1|  hypothetical protein M569_09555                         199   8e-58    Genlisea aurea
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...    198   2e-57    
ref|XP_003611046.1|  Calcium dependent protein kinase                   199   2e-57    Medicago truncatula
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg                199   3e-57    Erythranthe guttata [common monkey flower]
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    199   3e-57    Cucumis melo [Oriental melon]
gb|EPS70504.1|  calcium dependent protein kinase 25                     199   4e-57    Genlisea aurea
ref|XP_009385897.1|  PREDICTED: calcium-dependent protein kinase ...    198   4e-57    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         199   4e-57    Ricinus communis
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       198   5e-57    Cucumis sativus [cucumbers]
gb|KJB21813.1|  hypothetical protein B456_004G015100                    199   5e-57    Gossypium raimondii
emb|CAD70166.1|  putative calcium-dependent protein kinase              189   7e-57    Landoltia punctata
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase ...    198   7e-57    Cucumis sativus [cucumbers]
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...    198   1e-56    Nicotiana sylvestris
dbj|BAA81749.1|  calcium-dependent protein kinase                       198   1e-56    Marchantia polymorpha
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                197   1e-56    Erythranthe guttata [common monkey flower]
dbj|BAA81748.1|  calcium-dependent protein kinase                       197   1e-56    Marchantia polymorpha
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...    197   1e-56    Nicotiana tomentosiformis
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...    197   2e-56    Solanum lycopersicum
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    197   2e-56    Pyrus x bretschneideri [bai li]
ref|XP_003622837.1|  Calcium dependent protein kinase                   197   2e-56    
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...    197   2e-56    
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...    196   2e-56    
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...    197   3e-56    Nicotiana tomentosiformis
ref|XP_001781985.1|  predicted protein                                  195   3e-56    
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17     196   3e-56    Tarenaya hassleriana [spider flower]
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     196   3e-56    Fragaria vesca subsp. vesca
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                196   3e-56    Morus notabilis
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    196   3e-56    Tarenaya hassleriana [spider flower]
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                196   3e-56    Morus notabilis
ref|XP_009402456.1|  PREDICTED: calcium-dependent protein kinase ...    196   4e-56    
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...    196   4e-56    
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...    196   4e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001771902.1|  predicted protein                                  195   4e-56    
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...    196   5e-56    Solanum lycopersicum
emb|CDP20327.1|  unnamed protein product                                196   5e-56    Coffea canephora [robusta coffee]
emb|CAG27840.1|  calcium-dependent protein kinase 17                    196   5e-56    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KDO36585.1|  hypothetical protein CISIN_1g042977mg                   194   5e-56    Citrus sinensis [apfelsine]
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    196   6e-56    Tarenaya hassleriana [spider flower]
gb|AAZ76712.1|  calcium-dependent protein kinase 1                      196   7e-56    Petunia integrifolia subsp. inflata
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...    194   7e-56    Oryza brachyantha
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    195   7e-56    Nicotiana sylvestris
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                195   7e-56    Erythranthe guttata [common monkey flower]
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...    195   7e-56    Sesamum indicum [beniseed]
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    195   8e-56    Nicotiana tomentosiformis
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    195   8e-56    Nicotiana sylvestris
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...    196   8e-56    Solanum tuberosum [potatoes]
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         195   9e-56    Jatropha curcas
emb|CDY13993.1|  BnaC09g38330D                                          195   1e-55    Brassica napus [oilseed rape]
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34     195   1e-55    Brassica rapa
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                195   1e-55    Theobroma cacao [chocolate]
gb|KJB83565.1|  hypothetical protein B456_013G253100                    194   1e-55    Gossypium raimondii
gb|ABV22565.1|  calcium-dependent protein kinase                        194   2e-55    Physcomitrella patens
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             194   2e-55    Citrus clementina [clementine]
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    194   2e-55    Citrus sinensis [apfelsine]
gb|ABV22575.1|  calcium-dependent protein kinase                        196   2e-55    Physcomitrella patens
emb|CDX97174.1|  BnaC09g44510D                                          194   2e-55    
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...    194   2e-55    Brachypodium distachyon [annual false brome]
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17     194   2e-55    Brassica rapa
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...    194   2e-55    Solanum tuberosum [potatoes]
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg             194   3e-55    Capsella rubella
gb|KJB09335.1|  hypothetical protein B456_001G135000                    193   3e-55    Gossypium raimondii
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    194   3e-55    Prunus mume [ume]
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...    194   3e-55    Setaria italica
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...    193   4e-55    Brassica rapa
emb|CDX70450.1|  BnaC03g05340D                                          193   4e-55    
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             193   4e-55    Prunus persica
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     193   4e-55    Nelumbo nucifera [Indian lotus]
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17     193   5e-55    Camelina sativa [gold-of-pleasure]
ref|XP_004978350.1|  PREDICTED: calcium-dependent protein kinase ...    193   5e-55    
gb|KJB55472.1|  hypothetical protein B456_009G078000                    193   5e-55    Gossypium raimondii
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...    193   5e-55    
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940          193   6e-55    Amborella trichopoda
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg             193   6e-55    Eutrema salsugineum [saltwater cress]
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    192   7e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871516.1|  calcium-dependent protein kinase 17                193   7e-55    
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g             192   7e-55    
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...    192   7e-55    Solanum lycopersicum
gb|AGG35954.1|  calcium-dependent protein kinase 34                     192   8e-55    Brassica napus [oilseed rape]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                    192   8e-55    Arabis alpina [alpine rockcress]
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     191   9e-55    Glycine soja [wild soybean]
emb|CDX78468.1|  BnaA03g03800D                                          192   9e-55    
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...    192   9e-55    Camelina sativa [gold-of-pleasure]
gb|AHG06449.1|  calcium-dependent protein kinase 17                     192   9e-55    Brassica napus [oilseed rape]
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    192   9e-55    Eucalyptus grandis [rose gum]
emb|CDY63783.1|  BnaCnng42690D                                          192   1e-54    Brassica napus [oilseed rape]
ref|NP_197437.1|  calcium-dependent protein kinase 34                   192   1e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873943.1|  calcium-dependent protein kinase 34                192   1e-54    Arabidopsis lyrata subsp. lyrata
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    192   1e-54    Glycine max [soybeans]
gb|AAL59948.1|  putative calcium-dependent protein kinase               192   1e-54    Arabidopsis thaliana [mouse-ear cress]
emb|CDY44912.1|  BnaA02g04170D                                          192   1e-54    Brassica napus [oilseed rape]
gb|AFW82380.1|  putative calcium-dependent protein kinase family ...    184   1e-54    
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34     192   1e-54    Brassica rapa
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg             192   1e-54    Capsella rubella
ref|NP_196779.1|  calcium-dependent protein kinase 17                   192   1e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    192   1e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     192   1e-54    Camelina sativa [gold-of-pleasure]
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17     192   1e-54    Populus euphratica
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    192   1e-54    Camelina sativa [gold-of-pleasure]
ref|XP_003617233.1|  Calcium dependent protein kinase                   191   2e-54    Medicago truncatula
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...    191   2e-54    Elaeis guineensis
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             191   2e-54    Eutrema salsugineum [saltwater cress]
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...    191   2e-54    Phoenix dactylifera
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100          191   2e-54    Sorghum bicolor [broomcorn]
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                    191   2e-54    Arabis alpina [alpine rockcress]
dbj|BAK06838.1|  predicted protein                                      191   3e-54    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002313265.1|  calcium-dependent protein kinase                   191   3e-54    Populus trichocarpa [western balsam poplar]
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    191   3e-54    Populus euphratica
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...    191   3e-54    Elaeis guineensis
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...    191   3e-54    Brachypodium distachyon [annual false brome]
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    191   3e-54    Populus euphratica
gb|KHN28162.1|  Calcium-dependent protein kinase 17                     190   3e-54    Glycine soja [wild soybean]
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...    191   4e-54    Glycine max [soybeans]
gb|EAY76207.1|  hypothetical protein OsI_04143                          190   4e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...    191   4e-54    Oryza brachyantha
ref|XP_001768980.1|  predicted protein                                  189   5e-54    
ref|NP_001044575.1|  Os01g0808400                                       190   5e-54    
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...    189   7e-54    
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...    189   1e-53    Cicer arietinum [garbanzo]
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    189   1e-53    
gb|EMT22025.1|  Calcium-dependent protein kinase 3                      188   1e-53    
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                189   1e-53    Saccharum hybrid cultivar R570
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34     189   1e-53    Zea mays [maize]
gb|AGT15898.1|  calcium-dependent protein kinase                        189   2e-53    Saccharum hybrid cultivar R570
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...    189   2e-53    Zea mays [maize]
ref|XP_009414363.1|  PREDICTED: calcium-dependent protein kinase 17     189   2e-53    
gb|ADE76782.1|  unknown                                                 182   2e-53    Picea sitchensis
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    190   2e-53    
gb|AGT17376.1|  calcium-dependent protein kinase                        189   2e-53    Saccharum hybrid cultivar R570
gb|ABV22562.1|  calcium-dependent protein kinase                        189   2e-53    Physcomitrella patens
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...    188   2e-53    Phoenix dactylifera
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...    189   2e-53    Vitis vinifera
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...    188   3e-53    Glycine max [soybeans]
gb|KDO62718.1|  hypothetical protein CISIN_1g0096582mg                  181   4e-53    Citrus sinensis [apfelsine]
emb|CAN62888.1|  hypothetical protein VITISV_025544                     188   4e-53    Vitis vinifera
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34     187   4e-53    Brachypodium distachyon [annual false brome]
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    187   6e-53    Phoenix dactylifera
gb|KDO62721.1|  hypothetical protein CISIN_1g0096582mg                  179   7e-53    Citrus sinensis [apfelsine]
gb|KJB59358.1|  hypothetical protein B456_009G251300                    177   7e-53    Gossypium raimondii
ref|XP_002442700.1|  hypothetical protein SORBIDRAFT_08g001380          188   7e-53    Sorghum bicolor [broomcorn]
ref|XP_008671573.1|  PREDICTED: calcium-dependent protein kinase ...    187   9e-53    Zea mays [maize]
gb|KJB35709.1|  hypothetical protein B456_006G124800                    186   1e-52    Gossypium raimondii
ref|XP_002448943.1|  hypothetical protein SORBIDRAFT_05g002110          187   1e-52    Sorghum bicolor [broomcorn]
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g             186   2e-52    Phaseolus vulgaris [French bean]
gb|KHN38392.1|  Calcium-dependent protein kinase 17                     186   2e-52    Glycine soja [wild soybean]
gb|EAY79844.1|  hypothetical protein OsI_35004                          180   2e-52    Oryza sativa Indica Group [Indian rice]
dbj|BAK06618.1|  predicted protein                                      186   2e-52    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...    186   2e-52    Glycine max [soybeans]
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...    186   3e-52    Nelumbo nucifera [Indian lotus]
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...    186   3e-52    Nelumbo nucifera [Indian lotus]
ref|NP_001266856.1|  calcium-dependent protein kinase                   186   3e-52    Zea mays [maize]
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...    186   3e-52    Brassica rapa
gb|KHN12036.1|  Calcium-dependent protein kinase 17                     186   3e-52    Glycine soja [wild soybean]
gb|AGT16545.1|  calcium-dependent protein kinase 34                     185   4e-52    Saccharum hybrid cultivar R570
gb|AFW64738.1|  putative calcium-dependent protein kinase family ...    186   4e-52    
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...    184   6e-52    
ref|XP_003578964.1|  PREDICTED: calcium-dependent protein kinase ...    185   1e-51    Brachypodium distachyon [annual false brome]
gb|EEC67625.1|  hypothetical protein OsI_35012                          181   1e-51    Oryza sativa Indica Group [Indian rice]
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    184   1e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002979552.1|  calcium dependent protein kinase 17                184   2e-51    Selaginella moellendorffii
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...    185   2e-51    
dbj|BAK07881.1|  predicted protein                                      184   2e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002977722.1|  calcium dependent protein kinase 17                184   2e-51    Selaginella moellendorffii
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase              184   3e-51    
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g             183   4e-51    Phaseolus vulgaris [French bean]
emb|CBX25242.1|  hypothetical_protein                                   183   5e-51    Oryza brachyantha
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...    182   5e-51    Brachypodium distachyon [annual false brome]
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...    181   7e-51    
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...    182   7e-51    Oryza brachyantha
ref|XP_006452370.1|  hypothetical protein CICLE_v10007983mg             181   8e-51    
emb|CBX25340.1|  hypothetical_protein                                   182   9e-51    Oryza brachyantha
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      182   1e-50    Phoenix dactylifera
gb|EAZ17352.1|  hypothetical protein OsJ_32875                          181   1e-50    
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    181   1e-50    
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             181   2e-50    
gb|EEE64198.1|  hypothetical protein OsJ_19030                          181   2e-50    
gb|ABA95733.1|  Calcium-dependent protein kinase, isoform 2, puta...    181   2e-50    
ref|NP_001055912.1|  Os05g0491900                                       181   2e-50    
ref|NP_001065691.1|  Os11g0136600                                       181   2e-50    
ref|NP_001176777.1|  Os12g0133500                                       181   2e-50    
gb|AAT69647.1|  hypothetical protein                                    181   2e-50    
gb|KJB19075.1|  hypothetical protein B456_003G084000                    180   2e-50    
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    180   4e-50    
emb|CDX85697.1|  BnaA02g01160D                                          180   4e-50    
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    180   4e-50    
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...    179   6e-50    
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    180   6e-50    
emb|CDX91168.1|  BnaC02g04290D                                          179   7e-50    
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    181   7e-50    
ref|XP_006855881.1|  hypothetical protein AMTR_s00037p00138680          176   7e-50    
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...    179   8e-50    
gb|ABY59018.1|  calcium-dependent protein kinase                        179   9e-50    
gb|EEC79448.1|  hypothetical protein OsI_20437                          179   1e-49    
gb|AFR11230.1|  calcium dependent protein kinase 1                      179   1e-49    
ref|XP_002891589.1|  calcium-dependent protein kinase 33                178   2e-49    
gb|KJB59359.1|  hypothetical protein B456_009G251300                    167   3e-49    
ref|XP_007020822.1|  Calmodulin-domain protein kinase 9 isoform 3       175   3e-49    
ref|XP_007020821.1|  Calmodulin-domain protein kinase 9 isoform 2       175   3e-49    
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    178   3e-49    
gb|KCW66999.1|  hypothetical protein EUGRSUZ_F007611                    174   4e-49    
ref|NP_001059775.1|  Os07g0515100                                       177   4e-49    
gb|AFY10519.1|  calcium dependent protein kinase 1                      177   5e-49    
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     176   6e-49    
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    177   8e-49    
emb|CAD70165.1|  calcium-dependent protein kinase                       177   8e-49    
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    177   8e-49    
ref|NP_175485.1|  calcium-dependent protein kinase 33                   176   9e-49    
gb|ADM14342.1|  calcium-dependent protein kinase 19                     176   1e-48    
gb|AAD17800.1|  Ca2+-dependent protein kinase                           176   1e-48    
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    176   1e-48    
ref|XP_002456506.1|  hypothetical protein SORBIDRAFT_03g037570          174   2e-48    
emb|CAA65500.1|  protein kinase                                         176   2e-48    
gb|ABE72958.1|  calcium dependent protein kinase 3                      176   2e-48    
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    176   2e-48    
gb|AAP03014.1|  seed calcium dependent protein kinase c                 176   2e-48    
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   176   2e-48    
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      176   2e-48    
gb|AET00506.2|  calcium-dependent kinase                                176   2e-48    
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    176   2e-48    
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             176   2e-48    
gb|EMT05629.1|  Calcium-dependent protein kinase 34                     175   2e-48    
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    176   2e-48    
gb|KDO78219.1|  hypothetical protein CISIN_1g009091mg                   174   2e-48    
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...    176   2e-48    
gb|ACJ61504.1|  calcium-dependent protein kinase                        176   2e-48    
dbj|BAA13440.1|  calcium dependent protein kinase                       175   2e-48    
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       175   3e-48    
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 176   3e-48    
gb|AGT17166.1|  calcium-dependent protein kinase                        174   3e-48    
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     175   3e-48    
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    175   3e-48    
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 174   4e-48    
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    174   4e-48    
gb|EMT33574.1|  Calcium-dependent protein kinase 34                     173   4e-48    
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780          175   4e-48    
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             175   4e-48    
emb|CDM84631.1|  unnamed protein product                                173   6e-48    
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    174   6e-48    
gb|AGA83664.1|  calcium-dependent protein kinase 1                      174   7e-48    
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     174   7e-48    
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    174   8e-48    
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      174   9e-48    
gb|KDP20751.1|  hypothetical protein JCGZ_21222                         174   9e-48    
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    174   9e-48    
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             174   9e-48    
ref|XP_007026067.1|  Calcium-dependent protein kinase 21 isoform 2      173   9e-48    
ref|XP_007026068.1|  Calcium-dependent protein kinase 21 isoform 3      173   1e-47    
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     174   1e-47    
gb|AAQ17506.1|  calcium dependent protein kinase 3                      173   1e-47    
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                   173   1e-47    
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    174   1e-47    
gb|AAA61682.1|  calcium-dependent protein kinase                        172   1e-47    
gb|EMT23982.1|  Calcium-dependent protein kinase 17                     174   1e-47    
gb|EMS56466.1|  Calcium-dependent protein kinase 34                     174   1e-47    
ref|XP_001782248.1|  predicted protein                                  172   1e-47    
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   173   2e-47    
emb|CAA57157.1|  calcium-dependent protein kinase                       173   2e-47    
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     173   2e-47    
emb|CDP05759.1|  unnamed protein product                                173   2e-47    
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    172   2e-47    
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    173   2e-47    
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    172   2e-47    
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      173   2e-47    
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    173   2e-47    
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    173   2e-47    
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    173   2e-47    
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           173   3e-47    
gb|AEY99979.1|  calcium-dependent protein kinase                        172   3e-47    
gb|KJB68586.1|  hypothetical protein B456_010G252400                    172   3e-47    
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    172   3e-47    
gb|KJB13681.1|  hypothetical protein B456_002G088800                    171   3e-47    
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             172   3e-47    
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      172   3e-47    
emb|CDX91224.1|  BnaC02g26350D                                          171   3e-47    
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    172   3e-47    
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      172   3e-47    
ref|NP_001105306.1|  calcium-dependent protein kinase                   172   4e-47    
ref|XP_002971737.1|  calcium-dependent protein kinase 17                171   4e-47    
ref|XP_002991556.1|  calcium dependent protein kinase 34                171   4e-47    
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    172   4e-47    
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    172   4e-47    
gb|KJB81729.1|  hypothetical protein B456_013G159300                    171   4e-47    
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    172   4e-47    
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    172   5e-47    
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    171   5e-47    
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...    172   5e-47    
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      172   5e-47    
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    171   5e-47    
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    171   6e-47    
gb|ABC59619.1|  calcium-dependent protein kinase                        171   6e-47    
dbj|BAJ99143.1|  predicted protein                                      171   6e-47    
gb|ABD98803.1|  calcium-dependent protein kinase                        171   6e-47    
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    171   7e-47    
ref|XP_003617547.1|  Calcium dependent protein kinase                   175   7e-47    
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    171   7e-47    
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 171   7e-47    
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      172   7e-47    
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             171   7e-47    
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      171   7e-47    
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      171   8e-47    
gb|KJB13679.1|  hypothetical protein B456_002G088800                    171   8e-47    
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             171   8e-47    
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            171   8e-47    
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      171   8e-47    
gb|ABB54456.1|  calcium-dependent protein kinase                        171   9e-47    
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    171   9e-47    
gb|KJB81728.1|  hypothetical protein B456_013G159300                    170   9e-47    
emb|CDP04396.1|  unnamed protein product                                171   9e-47    
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         171   9e-47    
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             171   1e-46    
gb|KJB63479.1|  hypothetical protein B456_010G001300                    171   1e-46    
gb|KDP39132.1|  hypothetical protein JCGZ_00889                         171   1e-46    
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    171   1e-46    
dbj|BAE71239.1|  putative calcium dependent protein kinase              171   1e-46    
ref|XP_003570118.1|  PREDICTED: calcium-dependent protein kinase ...    171   1e-46    
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 170   1e-46    
ref|XP_002983821.1|  calcium dependent protein kinase 3                 171   1e-46    
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                171   1e-46    
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...    170   2e-46    
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    170   2e-46    
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    171   2e-46    
gb|ABC59620.1|  calcium-dependent protein kinase                        170   2e-46    
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    171   2e-46    
gb|ACY78680.1|  calcium-dependent protein kinase 1                      170   2e-46    
ref|XP_002989102.1|  calcium dependent protein kinase                   170   2e-46    
emb|CDX82244.1|  BnaA03g35770D                                          170   2e-46    
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      170   2e-46    
gb|ACB71246.2|  calcium-dependent protein kinase 1                      170   2e-46    
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    170   2e-46    
emb|CDY36037.1|  BnaC03g41610D                                          170   2e-46    
gb|AGG35978.1|  calcium-dependent protein kinase 9                      170   3e-46    
gb|AGG35970.1|  calcium-dependent protein kinase 21                     170   3e-46    
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg             170   3e-46    
gb|ABD98804.1|  calcium-dependent protein kinase                        170   3e-46    
gb|KJB81727.1|  hypothetical protein B456_013G159300                    170   3e-46    
ref|XP_003610427.1|  Calcium-dependent protein kinase                   170   3e-46    
ref|XP_002874811.1|  calcium-dependent protein kinase 21                169   3e-46    
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29     169   3e-46    
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             169   3e-46    
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             169   3e-46    
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     169   4e-46    
gb|ACR34538.1|  unknown                                                 169   4e-46    
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    169   5e-46    
ref|XP_006827112.1|  hypothetical protein AMTR_s00010p00245350          169   5e-46    
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     169   5e-46    
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    169   6e-46    
gb|AAK92828.1|  putative calcium dependent protein kinase               169   6e-46    
ref|NP_192381.1|  calcium-dependent protein kinase 21                   169   6e-46    
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     169   6e-46    
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 169   6e-46    
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                   166   6e-46    
gb|KJB62816.1|  hypothetical protein B456_009G438300                    169   6e-46    
ref|XP_001768977.1|  predicted protein                                  169   7e-46    
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            167   7e-46    
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    169   7e-46    
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             169   7e-46    
gb|ABV22560.1|  calcium-dependent protein kinase                        169   8e-46    
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     169   8e-46    
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    168   9e-46    
gb|KJB69279.1|  hypothetical protein B456_011G014200                    168   1e-45    
dbj|BAG87126.1|  unnamed protein product                                162   1e-45    
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    168   1e-45    
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    168   1e-45    
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     168   1e-45    
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         168   1e-45    
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    168   1e-45    
gb|AGJ83805.1|  calcium-dependent protein kinase 1a                     168   1e-45    
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             168   1e-45    
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    168   1e-45    
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                   167   2e-45    
gb|AIU98504.1|  calcium-dependent protein kinase                        167   2e-45    
ref|XP_004976604.1|  PREDICTED: calcium-dependent protein kinase ...    167   2e-45    
emb|CAN67210.1|  hypothetical protein VITISV_026712                     167   2e-45    
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      167   2e-45    
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      167   3e-45    
gb|EPS59225.1|  calcium-dependent protein kinase 1                      166   3e-45    
gb|ABY59005.1|  calcium-dependent protein kinase                        167   3e-45    
ref|XP_008668637.1|  PREDICTED: calcium dependent protein kinase ...    167   3e-45    
gb|AAD28192.2|  calcium-dependent protein kinase                        167   3e-45    
gb|AAV41876.1|  calcium-dependent protein kinase 2                      167   3e-45    
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    167   4e-45    
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    169   4e-45    
dbj|BAJ89609.1|  predicted protein                                      166   4e-45    
gb|KCW68005.1|  hypothetical protein EUGRSUZ_F01694                     165   4e-45    
gb|AFV30233.1|  calcium-dependent protein kinase                        167   4e-45    
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...    166   5e-45    
ref|XP_002510594.1|  calcium-dependent protein kinase, putative         166   6e-45    
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                166   6e-45    
gb|KCW68004.1|  hypothetical protein EUGRSUZ_F01694                     164   6e-45    
dbj|BAJ93361.1|  predicted protein                                      166   7e-45    
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    166   7e-45    
ref|NP_001275322.1|  calcium-dependent protein kinase                   166   8e-45    
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    166   8e-45    



>gb|ABC47163.2| CDPK1 [Ipomoea nil]
 gb|AFO63177.1| calcium dependent protein kinase 1 [Ipomoea nil]
Length=514

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  216
            MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLPPSQPPPPRPFLSGVGRVLGRPMEDVH
Sbjct  1    MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLPPSQPPPPRPFLSGVGRVLGRPMEDVH  60

Query  217  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  396
            STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  120

Query  397  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM
Sbjct  121  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  171



>ref|XP_009786035.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana sylvestris]
Length=514

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  216
            MG+CNS  S      S+GG + PPP +     + PS  PPP   LSG+GRVLG+PMEDV 
Sbjct  1    MGNCNSSSSDQTTTISSGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEDVR  60

Query  217  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  396
            STYIFGGELGRGQFGVT+LVTH++T ++ ACKSIATRKL++ DDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTFLVTHKQTHQQFACKSIATRKLIAADDVDDVRREVQIMHHLTG  120

Query  397  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM
Sbjct  121  HRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  171



>ref|XP_009620189.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana tomentosiformis]
Length=514

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  216
            MG+CNS  S     TS GG + PPP +     + PS  PPP   LSG+GRVLG+PME+V 
Sbjct  1    MGNCNSSSSDQTTTTSLGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEEVR  60

Query  217  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  396
            STYIFGGELGRGQFGVTYLVTH++TR++ ACKSIATRKL++ DDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTYLVTHKQTRQQFACKSIATRKLIAADDVDDVRREVQIMHHLTG  120

Query  397  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM
Sbjct  121  HRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  171



>gb|ACH85192.1| calcium-dependent protein kinase CDPK5 [Nicotiana tabacum]
Length=514

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  216
            MG+CNS  S     T  GG + PPP +     + PS  PPP   LSG+GRVLG+PME+V 
Sbjct  1    MGNCNSSSSDQTTTTCLGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEEVR  60

Query  217  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  396
            STYIFGGELGRGQFGVTYLVTH++TR++ ACKSIATRKL++ DDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTYLVTHKQTRQQFACKSIATRKLIAADDVDDVRREVQIMHHLTG  120

Query  397  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM
Sbjct  121  HRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  171



>ref|XP_006352261.1| PREDICTED: calcium-dependent protein kinase 3-like [Solanum tuberosum]
Length=517

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 140/190 (74%), Gaps = 35/190 (18%)
 Frame = +1

Query  37   MGSCNSIPSS--------------PFAATSAGG-----ESDPPPPKNDITVLppsqpppp  159
            MG+CNS+ S                 +A S  G      S  PPP+              
Sbjct  1    MGNCNSLSSDHPPPPAAAAGGGGGATSAPSTTGIRIIPSSQTPPPRP-------------  47

Query  160  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  339
                SG+GRVLGRPMEDV S YIFGGELGRGQFGVTYLVT++KTR++ ACKSIATRKL++
Sbjct  48   ---FSGIGRVLGRPMEDVRSIYIFGGELGRGQFGVTYLVTNKKTRQQFACKSIATRKLIN  104

Query  340  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  519
            KDDVDDVRREVQIMHHLTGHRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSE
Sbjct  105  KDDVDDVRREVQIMHHLTGHRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSE  164

Query  520  RAAAGLCRQM  549
            RAAAG+CRQM
Sbjct  165  RAAAGVCRQM  174



>ref|XP_004244622.1| PREDICTED: calcium-dependent protein kinase 3 [Solanum lycopersicum]
Length=516

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
            G+GRVLGRPMEDV S YIFGGELGRGQFGVTYLVT++KTR++ ACKSIATRKL++KDDVD
Sbjct  49   GIGRVLGRPMEDVRSIYIFGGELGRGQFGVTYLVTNKKTRQQFACKSIATRKLINKDDVD  108

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHLTGHRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAG
Sbjct  109  DVRREVQIMHHLTGHRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAG  168

Query  535  LCRQM  549
            +CRQM
Sbjct  169  VCRQM  173



>gb|KDO76380.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=350

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>ref|XP_010261434.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=531

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 138/188 (73%), Gaps = 17/188 (9%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGES--DPPPPKNDITV-----------LppsqpppprpF---  168
            MG+CN +PS+       G  +   PPP  N I V           +    P  P  F   
Sbjct  1    MGNCNGLPSNGDQLQPGGAANLHAPPPTNNVINVRPDDKPTPPPSILHQGPQQPPSFVHR  60

Query  169  -LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  345
             LS  GRVLGRPMEDV STYIFG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   PLSSTGRVLGRPMEDVRSTYIFGRELGRGQFGVTYLVTHKETKQQYACKSIATRKLVNRD  120

Query  346  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  525
            D++DVRREVQIMHHLTGHRNIVELKG YEDR  V+LVMELC GGELFDRIIAKGHYSERA
Sbjct  121  DIEDVRREVQIMHHLTGHRNIVELKGAYEDRQSVNLVMELCEGGELFDRIIAKGHYSERA  180

Query  526  AAGLCRQM  549
            AA LCRQ+
Sbjct  181  AAALCRQI  188



>ref|XP_006439440.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52680.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=350

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>gb|KDO76378.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=420

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>gb|KDO76379.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=397

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>gb|KDO76377.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=480

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>ref|XP_006439442.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52682.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=420

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>ref|XP_006439441.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52681.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=397

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           + VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPGPSSSATSATSASVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera]
Length=482

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  14   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  73

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  74   IEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAA  133

Query  529  AGLCRQM  549
            A LCRQ+
Sbjct  134  AALCRQI  140



>gb|KDP25359.1| hypothetical protein JCGZ_20515 [Jatropha curcas]
Length=525

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 147/185 (79%), Gaps = 17/185 (9%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLS--------------  174
            MG+C+S+PS   + T++ G SD PPP N IT+ P +  PPPRP                 
Sbjct  1    MGNCSSLPS---SFTTSSGGSDNPPPSNGITIHPATASPPPRPPPPHSFQPSNRPSSTTP  57

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             VGRVLGRP+EDV +TYIFG ELGRGQFG+TYLVTH++T+E+ ACKSI TRKL+++DD++
Sbjct  58   AVGRVLGRPIEDVRNTYIFGRELGRGQFGITYLVTHKETKEQFACKSITTRKLINRDDIE  117

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHLTGHRNIVELKG YEDR+ ++LVMELCAGGELFDRIIAKGHYSERAAA 
Sbjct  118  DVRREVQIMHHLTGHRNIVELKGAYEDRHSINLVMELCAGGELFDRIIAKGHYSERAAAI  177

Query  535  LCRQM  549
            LCRQ+
Sbjct  178  LCRQI  182



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQM
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQM  177



>gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis]
Length=528

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  60   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  119

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAA  179

Query  529  AGLCRQM  549
            A LCRQ+
Sbjct  180  AALCRQI  186



>ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
 ref|XP_010658560.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
Length=528

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  60   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  119

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAA  179

Query  529  AGLCRQM  549
            A LCRQ+
Sbjct  180  AALCRQI  186



>ref|XP_006849377.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
 gb|ERN10958.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
Length=538

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            ++G+GR+LGRPMED  STYIFG ELGRGQFGVTY+ THR+T+E LACKSIATRKL++KDD
Sbjct  60   IAGIGRILGRPMEDGRSTYIFGKELGRGQFGVTYMCTHRETKEVLACKSIATRKLITKDD  119

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVELKG YEDRN V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELKGAYEDRNSVNLVMELCAGGELFDRIIAKGHYSERAA  179

Query  529  AGLCRQM  549
            A LCR++
Sbjct  180  ATLCREI  186



>gb|KEH21166.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=516

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLpps---qpppprpFLSGVGRVLGRPMED  210
            G+C++   +    T+    SDPPP KN  T+LP +    PP P    + +GR+L RPMED
Sbjct  3    GNCSTGAGAGINTTTTTPHSDPPP-KNAPTILPQNFTPSPPQPPLPTTTLGRILNRPMED  61

Query  211  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  390
            V S +IFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDVRREVQIMHHL
Sbjct  62   VRSIFIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDVRREVQIMHHL  121

Query  391  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            TGHRNIVELKG YED++ V+LVMELCAGGELFDRII KGHYSERAAA LCRQ+
Sbjct  122  TGHRNIVELKGAYEDKHSVNLVMELCAGGELFDRIILKGHYSERAAANLCRQI  174



>gb|EYU40050.1| hypothetical protein MIMGU_mgv1a011511mg [Erythranthe guttata]
Length=279

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 121/152 (80%), Gaps = 15/152 (10%)
 Frame = +1

Query  94   ESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYL  273
            ++DPPP +               P  +G GR+LGRPM DVHS Y FG ELGRGQFGVT+L
Sbjct  46   DADPPPRR---------------PLPTGNGRILGRPMADVHSVYTFGRELGRGQFGVTHL  90

Query  274  VTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHL  453
            VT R TRE  ACKSIATRKL++ DDV DVRREVQIMHHLTGHRNIVELK  +EDRN+VHL
Sbjct  91   VTRRATREAFACKSIATRKLVTADDVADVRREVQIMHHLTGHRNIVELKEVFEDRNNVHL  150

Query  454  VMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            VMELCAGGELFDRIIAKGHYSERAAAGLCRQ+
Sbjct  151  VMELCAGGELFDRIIAKGHYSERAAAGLCRQI  182



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 137/187 (73%), Gaps = 24/187 (13%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppppr----------------pF  168
            MG+CN +PS+         +  PPPP N I+V P  +P  P                   
Sbjct  1    MGNCNGLPSN--------DDRHPPPPINVISVRPDDKPTTPTPPNQHQGPPQPPSAVHRP  52

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            LSG GRVLGRPMEDV +TY+FG E+GRGQFGVT L TH++T+E+ ACKSIATRKL+++DD
Sbjct  53   LSGTGRVLGRPMEDVRATYVFGREIGRGQFGVTCLATHKETKEQFACKSIATRKLVNRDD  112

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            +DDVRREVQIMHHLTGHRNIVELKG YED + V+LVMELC GGELFDRII KGHYSERAA
Sbjct  113  IDDVRREVQIMHHLTGHRNIVELKGAYEDHHSVNLVMELCEGGELFDRIILKGHYSERAA  172

Query  529  AGLCRQM  549
            A LCRQ+
Sbjct  173  AALCRQI  179



>ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
Length=519

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +1

Query  37   MGSCNSI---PSSPFAATSAGGESDPPPPKNDITVLppsqppp----prpFLSGVGRVLG  195
            MG+C+S      +P  +T     SD  P +N ITVLPP+  P          S +GRVLG
Sbjct  1    MGNCSSSHGGGGTPATSTY----SDELPQRNGITVLPPNTNPSPPLPKPQASSSLGRVLG  56

Query  196  RPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQ  375
            RPMEDV S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDVRREVQ
Sbjct  57   RPMEDVRSIYIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDVRREVQ  116

Query  376  IMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            IMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRII KGHYSERAAA  CRQ+
Sbjct  117  IMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIITKGHYSERAAANSCRQI  174



>ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max]
Length=528

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 134/175 (77%), Gaps = 12/175 (7%)
 Frame = +1

Query  31   LQMGSCNSIPSSPFAATSAGGESDPPPPKND--ITVLppsqpppprpFLSGVGRVLGRPM  204
            + MG+CNS  SS    T    +  P P  N   ITVLPP+           VGRVLGRPM
Sbjct  22   VSMGNCNSEASS---QTQPHSDHHPQPRSNSNGITVLPPNSK-------PSVGRVLGRPM  71

Query  205  EDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMH  384
            EDV STY FG ELGRGQFGVTYLVTH+ T+++ ACKSIAT KL+ +DD++DVRREVQIMH
Sbjct  72   EDVRSTYTFGRELGRGQFGVTYLVTHKHTKQQFACKSIATPKLVHRDDLEDVRREVQIMH  131

Query  385  HLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HLTGHRNIVELKG YEDR+ V+L+MELC GGELFDRIIAKGHYSERAAA LCRQ+
Sbjct  132  HLTGHRNIVELKGAYEDRHSVNLIMELCGGGELFDRIIAKGHYSERAAADLCRQI  186



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            +G GRVLGRPM DVHS YIFG ELGRGQFGVT+LVTHR TR+  ACKSIATRKL++ DDV
Sbjct  49   TGTGRVLGRPMSDVHSAYIFGRELGRGQFGVTHLVTHRATRQTFACKSIATRKLVTPDDV  108

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
             DVRREVQIMHHLTGHRNIVELK  +EDR++VHLVMELCAGGELFDRIIAKGHYSERAAA
Sbjct  109  ADVRREVQIMHHLTGHRNIVELKEVFEDRHNVHLVMELCAGGELFDRIIAKGHYSERAAA  168

Query  532  GLCRQM  549
            GLCRQ+
Sbjct  169  GLCRQI  174



>gb|KJB52213.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=534

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 137/191 (72%), Gaps = 20/191 (10%)
 Frame = +1

Query  37   MGSCNSIPS--SPF-AATSAGG------------ESDPPPPK-----NDITVLppsqppp  156
            MG+CNS PS  S F   T+ GG             S P PPK     N  +         
Sbjct  1    MGNCNSQPSADSQFRPETNTGGGPNHGINVLPADASAPRPPKPSTHHNLSSSSAAPNHHT  60

Query  157  prpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLL  336
                   +GRVLGRPMEDV STY+FG ELGRGQFGVTYLVTH++T ++ ACKSIATRKL+
Sbjct  61   APSATPPIGRVLGRPMEDVRSTYVFGRELGRGQFGVTYLVTHKETNQQFACKSIATRKLI  120

Query  337  SKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYS  516
            ++DD++DVRREVQIM+HLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRIIAKGHYS
Sbjct  121  NRDDIEDVRREVQIMYHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIIAKGHYS  180

Query  517  ERAAAGLCRQM  549
            ER AA LCRQ+
Sbjct  181  EREAANLCRQI  191



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + VGRVLGRPMEDV S Y FG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++DD+
Sbjct  60   AAVGRVLGRPMEDVRSIYAFGRELGRGQFGVTYLVTHKETKQQFACKSIATRKLINRDDI  119

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA
Sbjct  120  EDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAA  179

Query  532  GLCRQM  549
             LCRQ+
Sbjct  180  NLCRQI  185



>gb|KHG11508.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=534

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 138/191 (72%), Gaps = 20/191 (10%)
 Frame = +1

Query  37   MGSCNSIPS--SPF-AATSAGG------------ESDPPPPK-----NDITVLppsqppp  156
            MG+CNS PS  S F   T+ GG             S P PPK     N  +  P      
Sbjct  1    MGNCNSQPSADSQFRPETNTGGGPNHGINVLPADASAPRPPKPSTHHNLSSSSPAPNHHT  60

Query  157  prpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLL  336
                   +GRVLGRPMEDV STY+FG ELGRGQFGVTYLVTH++T ++ ACKSIATRKL+
Sbjct  61   APSTTPPIGRVLGRPMEDVRSTYVFGRELGRGQFGVTYLVTHKETNQQFACKSIATRKLI  120

Query  337  SKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYS  516
            ++DD++DVRREVQIM+HLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRIIAKGHYS
Sbjct  121  NRDDIEDVRREVQIMYHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIIAKGHYS  180

Query  517  ERAAAGLCRQM  549
            ER AA LCRQ+
Sbjct  181  EREAANLCRQI  191



>ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=518

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 135/179 (75%), Gaps = 14/179 (8%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp--------prpFLSGVGRVL  192
            MG+C+S   +P         SD  P  N ITVLPP+  P              S +GRVL
Sbjct  1    MGNCSSGAGAPTTY------SDDHPHHNGITVLPPNSNPSPQLPKPPPTSSSSSSLGRVL  54

Query  193  GRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREV  372
            GRPMEDV S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DD+RREV
Sbjct  55   GRPMEDVRSIYIFGRELGRGQFGVTYLVTHKATKEQFACKSIATRKLVNRDDIDDIRREV  114

Query  373  QIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            QIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRII KGHYSERAAA  CRQ+
Sbjct  115  QIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIITKGHYSERAAANSCRQI  173



>ref|XP_010106587.1| Calcium-dependent protein kinase 3 [Morus notabilis]
 gb|EXC10841.1| Calcium-dependent protein kinase 3 [Morus notabilis]
Length=639

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV STYIFG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++DDV+D
Sbjct  60   VGRVLGRPMEDVRSTYIFGRELGRGQFGVTYLVTHKETKQQFACKSIATRKLVNRDDVED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHH+TGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHMTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAANL  179

Query  538  CRQM  549
            CRQ+
Sbjct  180  CRQI  183



>ref|XP_007040388.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao]
 gb|EOY24889.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao]
Length=476

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 133/188 (71%), Gaps = 17/188 (9%)
 Frame = +1

Query  37   MGSCNSIPSS-------------PFAATSAGGESDPPPPKNDITVLppsqpppprpFLSG  177
            MG+CN  PS+             P    +      PP P+   T    S         + 
Sbjct  1    MGNCNGHPSADNQFRPDSDSGGGPHNGINIKAGPSPPRPQQHSTTHHSSSAASNHRLATP  60

Query  178  ----VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  345
                +GRVLGRPMEDV S Y+FG ELGRGQFG+TYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   TTPPIGRVLGRPMEDVRSNYVFGRELGRGQFGITYLVTHKETKQQFACKSIATRKLINRD  120

Query  346  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  525
            D++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRI+AKGHYSER 
Sbjct  121  DIEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRILAKGHYSERE  180

Query  526  AAGLCRQM  549
            AA LCRQ+
Sbjct  181  AANLCRQI  188



>ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=511

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+L RPMEDV ST+IFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDV
Sbjct  47   GRILNRPMEDVRSTFIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLINRDDIDDV  106

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRII KGHYSERAAA LC
Sbjct  107  RREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIITKGHYSERAAANLC  166

Query  541  RQM  549
            RQ+
Sbjct  167  RQI  169



>ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
 gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
Length=531

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 136/188 (72%), Gaps = 17/188 (9%)
 Frame = +1

Query  37   MGSCNSIPSSPFA----ATSAGGESD---------PPPPKNDITVLppsqpppprpFLSG  177
            MG+CN  PS+       + S GG  +         PP P+   T    S         + 
Sbjct  1    MGNCNGHPSADNQFRPDSDSGGGPHNGINIKAGPSPPRPQQHSTTHHSSSAASNHRLATP  60

Query  178  ----VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  345
                +GRVLGRPMEDV S Y+FG ELGRGQFG+TYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   TTPPIGRVLGRPMEDVRSNYVFGRELGRGQFGITYLVTHKETKQQFACKSIATRKLINRD  120

Query  346  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  525
            D++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRI+AKGHYSER 
Sbjct  121  DIEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRILAKGHYSERE  180

Query  526  AAGLCRQM  549
            AA LCRQ+
Sbjct  181  AANLCRQI  188



>ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=505

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 132/171 (77%), Gaps = 8/171 (5%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  216
            MG+CNS PSS      +      P P N ITVLPP+           VGRVLGRPMED  
Sbjct  1    MGNCNSEPSSQ-TQPHSDHHHHHPQPSNGITVLPPNSK-------PSVGRVLGRPMEDAR  52

Query  217  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  396
            STY FG ELGRGQFGVTY VTH+ T+++ ACKSIATRKL+ +DD++DVRREVQIMHHLTG
Sbjct  53   STYTFGRELGRGQFGVTYQVTHKHTKQQFACKSIATRKLVHRDDLEDVRREVQIMHHLTG  112

Query  397  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HRNIVELKG YEDR+ V+L+MELC GGELFDRIIAKGHYSERAAA LCRQ+
Sbjct  113  HRNIVELKGAYEDRHSVNLIMELCGGGELFDRIIAKGHYSERAAADLCRQI  163



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV +TY+FG ELGRGQFGVTYLVTH++T+++ ACKSIA RKL++KDD++D
Sbjct  68   VGRVLGRPMEDVRATYVFGRELGRGQFGVTYLVTHKETKQQFACKSIAARKLVNKDDIED  127

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELKG YED++ V+LVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGHRNIVELKGAYEDKHSVNLVMELCAGGELFDRIIAKGHYTERAAANL  187

Query  538  CRQM  549
            CRQ+
Sbjct  188  CRQI  191



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 139/176 (79%), Gaps = 8/176 (5%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp-prpFL----SGVGRVLGRP  201
            MG+CNS+ SS   +++     +PPP    I VLPP+  PP    FL    + VGRVLGRP
Sbjct  1    MGNCNSLASS---SSTTTNHRNPPPSNGGIKVLPPNASPPPRSQFLHHSSAAVGRVLGRP  57

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV +TY FG E+GRGQFGVTYLVTH++T++  ACKSIA RKL+++DD++DV REVQIM
Sbjct  58   MEDVRNTYTFGREVGRGQFGVTYLVTHKETKQHFACKSIAKRKLINRDDIEDVLREVQIM  117

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HHLTGHRN+VELKG YEDR+ V+L+MELC GGELFDRII KGHYSERAAA LCRQ+
Sbjct  118  HHLTGHRNVVELKGAYEDRHSVNLIMELCEGGELFDRIITKGHYSERAAANLCRQI  173



>ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=509

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 135/174 (78%), Gaps = 10/174 (6%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDP---PPPKNDITVLppsqpppprpFLSGVGRVLGRPME  207
            MG+C S P S   + S    S+P   PPP      L P+QP P     S +GRVLGRPME
Sbjct  1    MGNCKSEPIS--NSESQPPHSNPISTPPPD-----LNPNQPTPTATPTSTMGRVLGRPME  53

Query  208  DVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHH  387
            D+ STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRK++++ D+DD+RREVQIMHH
Sbjct  54   DIRSTYTFGRELGRGQFGVTYLVTHKITKEQFACKSIATRKIINRGDLDDIRREVQIMHH  113

Query  388  LTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            LTGHRNIVELKG YED + V+L+MELCAGGELFDRIIAKGHYSERAAA LC QM
Sbjct  114  LTGHRNIVELKGAYEDHHSVNLIMELCAGGELFDRIIAKGHYSERAAAELCGQM  167



>ref|XP_002304529.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
 gb|EEE79508.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
Length=523

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 133/187 (71%), Gaps = 22/187 (12%)
 Frame = +1

Query  37   MGSCNSIP----------------SSPFAATSAGGESDPPPPKNDITVLppsqpppprpF  168
            MG+CNS+P                + P         +  PPP++       +        
Sbjct  1    MGNCNSLPSSSSTTTTSTTTDHHNTPPNGVIKVLPPTATPPPRSQHHHHSSASGS-----  55

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
             + VGRVLGRP EDV +TYIFG ELGRGQFGVTYLVTH++T++  ACKSIA+RKL+++DD
Sbjct  56   -TAVGRVLGRPREDVRNTYIFGRELGRGQFGVTYLVTHKETKQHFACKSIASRKLINRDD  114

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVELKG YED++ V+L+MELC GGELFDRIIAKGHYSERAA
Sbjct  115  IEDVRREVQIMHHLTGHRNIVELKGAYEDQHSVNLIMELCEGGELFDRIIAKGHYSERAA  174

Query  529  AGLCRQM  549
            A LCRQ+
Sbjct  175  ANLCRQI  181



>ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S VGRVLG+PMEDV +TY FG ELGRGQFGVTYLVTH++++ + ACKSIATRKL++ DDV
Sbjct  51   SPVGRVLGKPMEDVRATYTFGRELGRGQFGVTYLVTHKESKLQFACKSIATRKLVNHDDV  110

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA
Sbjct  111  EDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCGGGELFDRIIAKGHYSERAAA  170

Query  532  GLCRQM  549
             LCRQM
Sbjct  171  NLCRQM  176



>ref|XP_007209903.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
 gb|EMJ11102.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
Length=526

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+  +++ ACKSIATRKL++ DDV+D
Sbjct  60   IGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKHNKQQFACKSIATRKLINHDDVED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELKG YED++ V+LVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHLTGHRNIVELKGAYEDKHSVNLVMELCAGGELFDRIIAKGHYSERAAANL  179

Query  538  CRQM  549
            CRQ+
Sbjct  180  CRQI  183



>ref|XP_009334485.1| PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri]
Length=525

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GRVLGRPMEDV STY FG ELGRGQFGVTYLVT ++T++  ACKSIATRKL ++DDV+D
Sbjct  59   IGRVLGRPMEDVRSTYTFGRELGRGQFGVTYLVTDKQTKQLFACKSIATRKLSNQDDVED  118

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  119  VRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAANL  178

Query  538  CRQM  549
            CRQ+
Sbjct  179  CRQI  182



>ref|XP_009386326.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            LS VGRVLGRPME+V +TY FG ELGRGQFG+TYLVTHR+TRE+ ACKSIATRKL+ ++D
Sbjct  45   LSNVGRVLGRPMENVRATYSFGRELGRGQFGITYLVTHRETREQFACKSIATRKLVHEED  104

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRRE+QIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRII KGHYSERAA
Sbjct  105  LEDVRREIQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIITKGHYSERAA  164

Query  529  AGLCRQM  549
            A LCR++
Sbjct  165  AALCREI  171



>gb|AIU98505.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=517

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            LS VGRVLGRPME+V +TY FG ELGRGQFG+TYLVTHR+TRE+ ACKSIATRKL+ ++D
Sbjct  45   LSNVGRVLGRPMENVRATYSFGRELGRGQFGITYLVTHRETREQFACKSIATRKLVHEED  104

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRRE+QIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRII KGHYSERAA
Sbjct  105  LEDVRREIQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIITKGHYSERAA  164

Query  529  AGLCRQM  549
            A LCR++
Sbjct  165  AALCREI  171



>gb|AFW83320.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=373

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            +  VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH +T +R ACKSIATRKL+ +DD
Sbjct  60   VGAVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHSETGQRFACKSIATRKLVHRDD  119

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAA  179

Query  529  AGLCRQM  549
            A LCR++
Sbjct  180  ASLCREI  186



>gb|KHN16772.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=160

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = +1

Query  97   SDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLV  276
            SD    +N ITVLPP+      P  S     LGRPMED+ S YIFG ELGRGQFGVTYLV
Sbjct  16   SDDHLRRNGITVLPPNSNLSAPPATSS----LGRPMEDMRSIYIFGRELGRGQFGVTYLV  71

Query  277  THRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLV  456
            TH+ T+E+ ACKSIATRKL+++DD+DD+RREVQIMHHLTGHRNIVELKG YEDR+ V+LV
Sbjct  72   THKATKEQFACKSIATRKLVNRDDIDDIRREVQIMHHLTGHRNIVELKGAYEDRHSVNLV  131

Query  457  MELCAGGELFDRIIAKGHYSERAAAGLCR  543
            MELCAGGELFDRII K HYSERAAA  CR
Sbjct  132  MELCAGGELFDRIITKSHYSERAAANSCR  160



>ref|XP_009416404.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR T ++ ACKSIATRKL+ +DD+
Sbjct  49   SDVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRGTTKQFACKSIATRKLVRQDDL  108

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRRE+QIMHHLTGHRNIVELKG YEDR+ V+LVME+C GGELFDRII+KGHYSERAAA
Sbjct  109  DDVRREIQIMHHLTGHRNIVELKGAYEDRHSVNLVMEICEGGELFDRIISKGHYSERAAA  168

Query  532  GLCRQM  549
             LCR++
Sbjct  169  ALCREI  174



>ref|XP_011022588.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022589.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022590.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
Length=517

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + VGRVLGRP EDV +TYIFG ELGRGQFGVTYLVTH++T++  ACKSIA+RKL+++DD+
Sbjct  50   TAVGRVLGRPREDVRNTYIFGRELGRGQFGVTYLVTHKETKQHFACKSIASRKLINRDDI  109

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTGHRNIVELKG YED++ V+L+MELC GGELFDRIIAKGHYSERAAA
Sbjct  110  EDVRREVQIMHHLTGHRNIVELKGAYEDQHSVNLIMELCEGGELFDRIIAKGHYSERAAA  169

Query  532  GLCRQM  549
             LCRQ+
Sbjct  170  DLCRQI  175



>ref|XP_010529626.1| PREDICTED: calcium-dependent protein kinase 3-like [Tarenaya 
hassleriana]
Length=513

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GR+LGRPME+V STY FG ELGRGQFGVTYLVTH++TR++ ACKSI TR+L+ +DD++D
Sbjct  47   IGRILGRPMENVRSTYEFGHELGRGQFGVTYLVTHKETRKQFACKSIPTRRLVHRDDIED  106

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAAA L
Sbjct  107  VRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAAADL  166

Query  538  CRQM  549
            CRQM
Sbjct  167  CRQM  170



>ref|XP_010541306.1| PREDICTED: calcium-dependent protein kinase 3 [Tarenaya hassleriana]
Length=521

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GR+LGRPME+V +TY FG ELGRGQFGVTYLVTH++TR++ ACKSI TR+L+ +DD++D
Sbjct  53   IGRILGRPMENVRTTYEFGRELGRGQFGVTYLVTHKETRKQFACKSIPTRRLVHRDDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAADL  172

Query  538  CRQM  549
            CRQM
Sbjct  173  CRQM  176



>ref|NP_001152509.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|ACG47976.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|AFW83318.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW83319.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=530

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            +  VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH +T +R ACKSIATRKL+ +DD
Sbjct  60   VGAVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHSETGQRFACKSIATRKLVHRDD  119

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAA  179

Query  529  AGLCRQM  549
            A LCR++
Sbjct  180  ASLCREI  186



>ref|NP_001169721.1| uncharacterized LOC100383602 [Zea mays]
 gb|ACN34646.1| unknown [Zea mays]
 tpg|DAA58515.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=524

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++
Sbjct  56   AVGRVLGRPMEDVKATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIE  115

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHLTGHRNIVEL+G YEDR  V+L MELC GGELFDRIIA+GHY+ERAAA 
Sbjct  116  DVRREVQIMHHLTGHRNIVELRGAYEDRRSVNLAMELCEGGELFDRIIARGHYTERAAAA  175

Query  535  LCRQM  549
            LCR++
Sbjct  176  LCREI  180



>ref|XP_008792394.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=531

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 125/158 (79%), Gaps = 7/158 (4%)
 Frame = +1

Query  76   ATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQ  255
            A SAGG  D P P     V P      PRP    VGRVLGRPMEDV + Y FG ELGRGQ
Sbjct  38   AASAGG--DGPKP-----VWPRPASSIPRPLTPKVGRVLGRPMEDVRAFYTFGRELGRGQ  90

Query  256  FGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYED  435
            FGVTYLVT ++T ERLACKSIATRKL+ +DD++DVRREVQIMHHLTGHRNIVELK  YED
Sbjct  91   FGVTYLVTRKETGERLACKSIATRKLIHRDDIEDVRREVQIMHHLTGHRNIVELKAAYED  150

Query  436  RNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            R+ V+LVMELC GGELFDRIIAKGHYSERAAA LCR++
Sbjct  151  RHSVNLVMELCEGGELFDRIIAKGHYSERAAAALCREI  188



>gb|AIU98501.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=521

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR T ++ ACKSIATRKL+ +DD+
Sbjct  51   SDVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRGTTKQFACKSIATRKLVRQDDL  110

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRRE+QIMHHLTGHRNIVE KG YEDR+ V+LVME+C GGELFDRII+KGHYSERAAA
Sbjct  111  DDVRREIQIMHHLTGHRNIVEPKGAYEDRHSVNLVMEICEGGELFDRIISKGHYSERAAA  170

Query  532  GLCRQM  549
             LCR++
Sbjct  171  ALCREI  176



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 8/176 (5%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp-prpFL----SGVGRVLGRP  201
            MG+CNS+ S   ++++     + PP    I VLPP+  PP    FL    + VGRVLGRP
Sbjct  1    MGNCNSLSS---SSSTTTNHRNSPPSNGGIKVLPPNASPPPRSQFLHHSSAAVGRVLGRP  57

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV +TY FG E+GRGQFGVTYLVTH++T++  ACKSIA RKL+++DD++DV REVQIM
Sbjct  58   MEDVRNTYTFGREVGRGQFGVTYLVTHKETKQHFACKSIAKRKLINRDDIEDVLREVQIM  117

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HHLTGHRN+VELKG YEDR+ V+L+MELC GGELFDRII KGHYSERAAA LCRQ+
Sbjct  118  HHLTGHRNVVELKGAYEDRHSVNLIMELCEGGELFDRIITKGHYSERAAANLCRQI  173



>ref|XP_004969206.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=522

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
             GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++D
Sbjct  55   AGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIED  114

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHY+ERAAA L
Sbjct  115  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYTERAAAAL  174

Query  538  CRQM  549
            CR++
Sbjct  175  CREI  178



>ref|XP_006655639.1| PREDICTED: calcium-dependent protein kinase 3-like, partial [Oryza 
brachyantha]
Length=470

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
             GVGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL  KDDV
Sbjct  1    DGVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARKDDV  60

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRREV IMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA
Sbjct  61   DDVRREVHIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAA  120

Query  532  GLCRQM  549
             LCR++
Sbjct  121  ALCREI  126



>ref|XP_003569386.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=526

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  58   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  117

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA 
Sbjct  118  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAV  177

Query  535  LCRQM  549
            LCR+M
Sbjct  178  LCREM  182



>emb|CAF18446.1| putative calcium-dependent protein kinase [Triticum aestivum]
 emb|CDM83446.1| unnamed protein product [Triticum aestivum]
Length=518

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  50   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  109

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  110  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  169

Query  535  LCRQM  549
            LCR+M
Sbjct  170  LCREM  174



>gb|ABY59010.1| calcium-dependent protein kinase [Triticum aestivum]
Length=518

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  50   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  109

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  110  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  169

Query  535  LCRQM  549
            LCR+M
Sbjct  170  LCREM  174



>dbj|BAJ95679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  52   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  111

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  112  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  171

Query  535  LCRQM  549
            LCR+M
Sbjct  172  LCREM  176



>gb|EEC71113.1| hypothetical protein OsI_02910 [Oryza sativa Indica Group]
Length=520

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  53   MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA L
Sbjct  113  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAAL  172

Query  538  CRQM  549
            CR++
Sbjct  173  CREI  176



>gb|ACA63885.1| calcium-dependent protein kinase [Hordeum vulgare]
Length=520

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  52   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  111

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  112  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  171

Query  535  LCRQM  549
            LCR+M
Sbjct  172  LCREM  176



>gb|EAZ12734.1| hypothetical protein OsJ_02652 [Oryza sativa Japonica Group]
 dbj|BAH01699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  51   MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  110

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA L
Sbjct  111  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAAL  170

Query  538  CRQM  549
            CR++
Sbjct  171  CREI  174



>ref|XP_011080890.1| PREDICTED: calcium-dependent protein kinase 3 [Sesamum indicum]
Length=481

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 110/128 (86%), Gaps = 3/128 (2%)
 Frame = +1

Query  166  FLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  345
            F  G GRVLGRPM DVHS Y FG ELGRGQFGVT+LVTHR T +  ACKSIATRKL+   
Sbjct  18   FTGGTGRVLGRPMSDVHSAYTFGRELGRGQFGVTHLVTHRVTCQTFACKSIATRKLVI--  75

Query  346  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  525
             +DDVRREVQIMHHL GHRNIVELK  +EDRN+VHLVMELCAGGELFDRIIAKGHYSERA
Sbjct  76   -LDDVRREVQIMHHLAGHRNIVELKEVFEDRNYVHLVMELCAGGELFDRIIAKGHYSERA  134

Query  526  AAGLCRQM  549
            AAGLCRQ+
Sbjct  135  AAGLCRQI  142



>ref|XP_010924783.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Elaeis guineensis]
Length=527

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV + Y FG ELGRGQFGVTYLVT ++T ER ACKSIATRKL  +DD++D
Sbjct  61   VGRVLGRPMEDVRAFYTFGRELGRGQFGVTYLVTSKQTGERFACKSIATRKLTHRDDIED  120

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELK  YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA L
Sbjct  121  VRREVQIMHHLTGHRNIVELKAAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAAAL  180

Query  538  CRQM  549
            CR++
Sbjct  181  CREI  184



>ref|XP_010924782.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Elaeis guineensis]
Length=531

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV + Y FG ELGRGQFGVTYLVT ++T ER ACKSIATRKL  +DD++D
Sbjct  61   VGRVLGRPMEDVRAFYTFGRELGRGQFGVTYLVTSKQTGERFACKSIATRKLTHRDDIED  120

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVELK  YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA L
Sbjct  121  VRREVQIMHHLTGHRNIVELKAAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAAAL  180

Query  538  CRQM  549
            CR++
Sbjct  181  CREI  184



>ref|XP_004961071.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=546

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
            GVGRVLGRPMEDV + Y FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL  +DDVD
Sbjct  78   GVGRVLGRPMEDVRAAYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLAHRDDVD  137

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA 
Sbjct  138  DVRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAA  197

Query  535  LCRQM  549
            LCR++
Sbjct  198  LCREI  202



>gb|KHG03431.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=604

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             VGRVLGRPMEDV STY+F GELGRGQFG+TYLVTH+KT+++ ACKSI  RKL++++D++
Sbjct  52   AVGRVLGRPMEDVRSTYVFSGELGRGQFGITYLVTHKKTKQQFACKSIPKRKLINREDIE  111

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIM+HLTGHRNIVELKG YED   V+L+MELCAGGELF+RIIAKGH+SER AA 
Sbjct  112  DVRREVQIMYHLTGHRNIVELKGAYEDHQSVNLIMELCAGGELFNRIIAKGHFSERKAAN  171

Query  535  LCRQM  549
            LCRQ+
Sbjct  172  LCRQI  176



>gb|KFK28919.1| hypothetical protein AALP_AA7G065000 [Arabis alpina]
Length=529

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GR+LGRPME+V +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++D
Sbjct  61   IGRILGRPMENVRATYEFGRELGRGQFGVTYLVTHKETKQIFACKSIPTRRLVHRDDIED  120

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL+GHRNIV+LKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA L
Sbjct  121  VRREVQIMHHLSGHRNIVDLKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAADL  180

Query  538  CRQM  549
            CRQM
Sbjct  181  CRQM  184



>ref|XP_010676387.1| PREDICTED: calcium-dependent protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +GRVLGRPMEDV  +YIFG ELGRGQFG+TYLVTH++T+   ACKSIATRKL+++DD+
Sbjct  58   SNIGRVLGRPMEDVRESYIFGRELGRGQFGITYLVTHKQTKLNFACKSIATRKLINQDDI  117

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRREVQIMHHLTG+ NIVELK  +EDR+ V+L+MELCAGGELFDRIIAKGHYSER AA
Sbjct  118  DDVRREVQIMHHLTGNSNIVELKSAFEDRHSVNLIMELCAGGELFDRIIAKGHYSERQAA  177

Query  532  GLCRQM  549
             L RQ+
Sbjct  178  KLFRQI  183



>ref|XP_002455974.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
 gb|EES01094.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
Length=525

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  190  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRRE  369
            LGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DVRRE
Sbjct  62   LGRPMEDVRATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDVRRE  121

Query  370  VQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            VQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAAA LCR++
Sbjct  122  VQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAAAALCREI  181



>ref|XP_007158545.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
 gb|ESW30539.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
Length=502

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 129/173 (75%), Gaps = 13/173 (8%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGE--SDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMED  210
            MG+ NS     ++ T    E     P P N ++VLPP+  P        VGRVL RPMED
Sbjct  1    MGNSNS---QAYSQTQPHSEHHQHQPQPSNGVSVLPPNSKPT-------VGRVLDRPMED  50

Query  211  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  390
            V S YIFG ELGRGQFGVTY VTH+ T E LACKSIA RKL  +DD++DVRREVQIMHHL
Sbjct  51   VRSDYIFGRELGRGQFGVTYSVTHKHTNENLACKSIAKRKL-HRDDLEDVRREVQIMHHL  109

Query  391  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            TGHRNIVELKG  EDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA LCRQ+
Sbjct  110  TGHRNIVELKGACEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAADLCRQI  162



>gb|AFW81269.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=478

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDVDD
Sbjct  72   VGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHSDDVDD  131

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA L
Sbjct  132  VRREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAAL  191

Query  538  CRQM  549
            CR++
Sbjct  192  CREI  195



>ref|XP_006413532.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
 gb|ESQ54985.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
Length=527

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  60   GRILGRPMENVRGTYEFGRELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  119

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA LC
Sbjct  120  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAADLC  179

Query  541  RQM  549
            RQM
Sbjct  180  RQM  182



>dbj|BAD61167.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
Length=713

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  246  MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  305

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA L
Sbjct  306  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAAL  365

Query  538  CRQM  549
            CR++
Sbjct  366  CREI  369



>ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
 gb|ACC91261.1| putative calcium-dependent protein kinase [Capsella rubella]
 gb|EOA16418.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
Length=529

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  63   GRILGRPMENVKGTYEFGRELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  122

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  123  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  182

Query  541  RQM  549
            RQM
Sbjct  183  RQM  185



>ref|NP_001056455.1| Os05g0585500 [Oryza sativa Japonica Group]
 gb|AAT47064.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF18369.1| Os05g0585500 [Oryza sativa Japonica Group]
Length=542

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
             GVGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DD+
Sbjct  73   DGVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARPDDL  132

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRREV IMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA
Sbjct  133  DDVRREVHIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAA  192

Query  532  GLCRQM  549
             LCR++
Sbjct  193  ALCREI  198



>ref|XP_008656081.1| PREDICTED: calcium-dependent protein kinase 3-like [Zea mays]
 gb|AFW81270.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW81271.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=539

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDVDD
Sbjct  72   VGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHSDDVDD  131

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA L
Sbjct  132  VRREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAAL  191

Query  538  CRQM  549
            CR++
Sbjct  192  CREI  195



>ref|XP_010509303.1| PREDICTED: calcium-dependent protein kinase 3 [Camelina sativa]
Length=529

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  64   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  123

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  124  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  183

Query  541  RQM  549
            RQM
Sbjct  184  RQM  186



>ref|XP_009137374.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
 ref|XP_009137377.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=532

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  65   GRILGRPMENVRGTYDFGKELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  124

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  125  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  184

Query  541  RQM  549
            RQM
Sbjct  185  RQM  187



>ref|XP_010433881.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  62   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  121

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  122  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  181

Query  541  RQM  549
            RQM
Sbjct  182  RQM  184



>ref|XP_010439150.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  62   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  121

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  122  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  181

Query  541  RQM  549
            RQM
Sbjct  182  RQM  184



>ref|XP_008451994.1| PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo]
Length=527

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 129/184 (70%), Gaps = 13/184 (7%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPP--PPKNDITVLppsqpppprpFLS-----------G  177
            MG+C+ +P+   +     G SD    PP N +  + P    P  P               
Sbjct  1    MGNCSGLPTGQTSTAYPLGHSDADYRPPSNGVVKVLPPDSDPSLPPPLPKEISTSSAPPA  60

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+D
Sbjct  61   VGRVLGRPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVED  120

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTGH +IVELK  YEDR++V+L+MELCAGGELFDRIIAKGHYSE  AA L
Sbjct  121  VRREVQIMHHLTGHPHIVELKEVYEDRHYVNLIMELCAGGELFDRIIAKGHYSECTAASL  180

Query  538  CRQM  549
            CRQ+
Sbjct  181  CRQI  184



>emb|CDY62741.1| BnaC07g50270D [Brassica napus]
Length=615

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  148  GRILGRPMENVRGTYDFGKELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  207

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  208  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  267

Query  541  RQM  549
            RQM
Sbjct  268  RQM  270



>emb|CDY54853.1| BnaC01g15460D [Brassica napus]
Length=525

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LG+PMEDV +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREV IMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVHIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  541  RQM  549
            RQM
Sbjct  178  RQM  180



>gb|AHN16201.1| CPK3-2.1 [Brassica napus]
Length=527

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LG+PMEDV +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  60   GRILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSIPTRRLVQSDDIEDV  119

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREV IMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  120  RREVHIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  179

Query  541  RQM  549
            RQM
Sbjct  180  RQM  182



>ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
 gb|EES20022.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
Length=541

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + +GRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDV
Sbjct  72   TNIGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHLDDV  131

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA
Sbjct  132  EDVRREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAA  191

Query  532  GLCRQM  549
             LCR++
Sbjct  192  SLCREI  197



>ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43956.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ KDD++DV
Sbjct  54   GRILGRPMENVRGTYEFGRELGRGQFGVTYLVTHKETKQLFACKSIPTRRLVHKDDIEDV  113

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  114  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  173

Query  541  RQM  549
            RQM
Sbjct  174  RQM  176



>gb|AAL38596.1|AF446863_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAK96512.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
Length=529

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++++ACKSI TR+L+ KDD++DV
Sbjct  64   GRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDV  123

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRII+KG YSERAAA LC
Sbjct  124  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLC  183

Query  541  RQM  549
            RQM
Sbjct  184  RQM  186



>ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
 sp|Q42479.1|CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK6; Short=AtCDPK6 
[Arabidopsis thaliana]
 gb|AAK60302.1|AF385710_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAA67654.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAA67656.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 emb|CAA23031.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 emb|CAB79320.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 gb|AAL87385.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAM65176.1| calcium-dependent protein kinase CDPK6 [Arabidopsis thaliana]
 gb|AAN31878.1| putative calcium-dependent protein kinase (CDPK6) [Arabidopsis 
thaliana]
 gb|AEE84789.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
Length=529

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++++ACKSI TR+L+ KDD++DV
Sbjct  64   GRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDV  123

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRII+KG YSERAAA LC
Sbjct  124  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLC  183

Query  541  RQM  549
            RQM
Sbjct  184  RQM  186



>dbj|BAJ94561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DDV+D
Sbjct  60   VGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKSTGARYACKSIAARKLARADDVED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
             RREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA L
Sbjct  120  ARREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAATL  179

Query  538  CRQM  549
            CR++
Sbjct  180  CREV  183



>gb|KHG14847.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=530

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +GRV GRPMEDV STYI G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYIVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLNRDDIED  123

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGELFDRI+AKGHYSE+ AA L
Sbjct  124  VRREVQIMYHLTGHRNIVELEKACEDRRSVNLIMELCAGGELFDRILAKGHYSEKEAANL  183

Query  538  CRQM  549
            CRQ+
Sbjct  184  CRQI  187



>gb|KJB39672.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=431

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 127/190 (67%), Gaps = 22/190 (12%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  159
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  160  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  339
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  340  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  519
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  520  RAAAGLCRQM  549
            + AA LCRQ+
Sbjct  178  KEAANLCRQI  187



>gb|KJB39669.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=438

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 127/190 (67%), Gaps = 22/190 (12%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  159
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  160  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  339
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  340  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  519
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  520  RAAAGLCRQM  549
            + AA LCRQ+
Sbjct  178  KEAANLCRQI  187



>gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus]
Length=525

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR  V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVQIMHHLSGHRNIVDLKGAYEDRQSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  541  RQM  549
            RQM
Sbjct  178  RQM  180



>emb|CDY44125.1| BnaA01g13330D [Brassica napus]
Length=525

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR  V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVQIMHHLSGHRNIVDLKGAYEDRQSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  541  RQM  549
            RQM
Sbjct  178  RQM  180



>ref|XP_008802050.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=525

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            +  VGRV  RPM+ V + Y FG E+GRGQFGVTYLVTH++T +  ACKSIATR+LL +DD
Sbjct  52   IPNVGRVFKRPMDHVRAFYTFGSEIGRGQFGVTYLVTHKETGKLFACKSIATRRLLHRDD  111

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DVRREVQIMHHLTGHRNIVEL+  YEDRN V+LVMELC GGELFDRIIAKGHYSERAA
Sbjct  112  IEDVRREVQIMHHLTGHRNIVELEEAYEDRNSVNLVMELCEGGELFDRIIAKGHYSERAA  171

Query  529  AGLCRQM  549
            A LCR++
Sbjct  172  AALCREI  178



>ref|XP_009137281.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=525

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  541  RQM  549
            RQM
Sbjct  178  RQM  180



>gb|KJB39670.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
 gb|KJB39671.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=504

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 127/190 (67%), Gaps = 22/190 (12%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  159
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  160  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  339
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  340  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  519
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  520  RAAAGLCRQM  549
            + AA LCRQ+
Sbjct  178  KEAANLCRQI  187



>ref|XP_009406794.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV +TY FG ELGRGQFGVTYLV HR+T ++LACK+IATRKL+ +DD+DDVRRE+QIM
Sbjct  1    MEDVRATYSFGRELGRGQFGVTYLVVHRETGKQLACKAIATRKLVRQDDLDDVRREIQIM  60

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA LCR++
Sbjct  61   HHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAAALCREI  116



>ref|XP_010673770.1| PREDICTED: calcium-dependent protein kinase 17-like [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 124/170 (73%), Gaps = 8/170 (5%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  219
            G+ N+IP+       A   + P PP +  T    +            G VLGRPMEDV +
Sbjct  26   GNNNAIPNPSTQKPEAS--TKPTPPSSSGTTHNKNTKTAQN------GPVLGRPMEDVKT  77

Query  220  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  399
            TY FG ELGRGQFGVT+LVTHR+T E+ ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  78   TYSFGKELGRGQFGVTHLVTHRQTGEQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  137

Query  400  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
             NIVELKG +ED++ VHL+MELCAGGELFDRIIAKGH++ERAAA L R +
Sbjct  138  PNIVELKGAFEDKHSVHLIMELCAGGELFDRIIAKGHFTERAAASLLRTI  187



>gb|EPS59027.1| hypothetical protein M569_15783, partial [Genlisea aurea]
Length=433

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH++T ++LACK+IA RKL SK+DVDD
Sbjct  70   IGPVLGRPMEDVRSIYTMGKELGRGQFGVTHLCTHKQTGQQLACKTIAKRKLGSKEDVDD  129

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  N+VELKGTYED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  130  VRREVQIMHHLTGQPNVVELKGTYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  189

Query  538  CRQM  549
             R +
Sbjct  190  LRTI  193



>gb|KJB39673.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=530

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 127/190 (67%), Gaps = 22/190 (12%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  159
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  160  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  339
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  340  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  519
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  520  RAAAGLCRQM  549
            + AA LCRQ+
Sbjct  178  KEAANLCRQI  187



>gb|KEH27423.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=433

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +GRVLG+PMEDV STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+ +DD+
Sbjct  50   SPLGRVLGKPMEDVRSTYTFGRELGRGQFGVTYLVTHKLTKEQFACKSIATRKLIRRDDL  109

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DD+RREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRII+KGHYSERAAA
Sbjct  110  DDIRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIISKGHYSERAAA  169

Query  532  GLCRQM  549
             LCRQ+
Sbjct  170  ELCRQI  175



>ref|NP_001267714.1| calcium-dependent protein kinase 3-like [Cucumis sativus]
 emb|CAC44471.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
 gb|AAK26164.2| calcium-dependent calmodulin-independent protein kinase 5 [Cucumis 
sativus]
Length=514

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVL RP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+
Sbjct  47   ALGRVLARPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVE  106

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHLTGH +IVELK  YEDR++V+L+MELCAGGELFDRIIAKGHYSE  AA 
Sbjct  107  DVRREVQIMHHLTGHPHIVELKEVYEDRHYVNLIMELCAGGELFDRIIAKGHYSECTAAS  166

Query  535  LCRQM  549
            LCRQ+
Sbjct  167  LCRQI  171



>gb|EPS65220.1| hypothetical protein M569_09555, partial [Genlisea aurea]
Length=457

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
            G GRVLG+PM DV S Y FG E+GRGQFGVTYLVTH  T E+ ACKSI+ RK++S  DV 
Sbjct  1    GKGRVLGKPMSDVRSKYGFGKEIGRGQFGVTYLVTHSVTGEKFACKSISKRKIISPADVA  60

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIM+HLTGH N+VEL+  +E R HVHLVMELCAGGELFDRIIAKGHY+ERAAAG
Sbjct  61   DVRREVQIMYHLTGHPNVVELREVFEGRQHVHLVMELCAGGELFDRIIAKGHYTERAAAG  120

Query  535  LCRQM  549
            LCRQ+
Sbjct  121  LCRQI  125



>tpg|DAA58514.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=460

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DVRREVQIM
Sbjct  1    MEDVKATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDVRREVQIM  60

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HHLTGHRNIVEL+G YEDR  V+L MELC GGELFDRIIA+GHY+ERAAA LCR++
Sbjct  61   HHLTGHRNIVELRGAYEDRRSVNLAMELCEGGELFDRIIARGHYTERAAAALCREI  116



>ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AES94004.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=517

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +GRVLG+PMEDV STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+ +DD+
Sbjct  50   SPLGRVLGKPMEDVRSTYTFGRELGRGQFGVTYLVTHKLTKEQFACKSIATRKLIRRDDL  109

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DD+RREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRII+KGHYSERAAA
Sbjct  110  DDIRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIISKGHYSERAAA  169

Query  532  GLCRQM  549
             LCRQ+
Sbjct  170  ELCRQI  175



>gb|EYU23402.1| hypothetical protein MIMGU_mgv1a004683mg [Erythranthe guttata]
Length=515

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 124/173 (72%), Gaps = 6/173 (3%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGV--GRVLGRPMED  210
            MG+  SI + P A T+    + PP    D     P+ P  P      +  G +LGRP+ +
Sbjct  1    MGNAPSIDAPPHAPTA----TSPPNGGADSETSLPTPPESPPHPPGSLPTGAILGRPISN  56

Query  211  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  390
            VHS Y FG ELGRGQFGVT+LVTHR+TR   ACKSIA RKL + DD   VRREVQIMHHL
Sbjct  57   VHSAYNFGRELGRGQFGVTHLVTHRETRRAFACKSIAVRKLAAPDDAAAVRREVQIMHHL  116

Query  391  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            TGHRNIVEL+  +EDR HVHLVM+LCAGGELF+RI++KGHYSER AAGLCRQ+
Sbjct  117  TGHRNIVELREVFEDRRHVHLVMDLCAGGELFERIVSKGHYSERGAAGLCRQI  169



>ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase 34-like [Cucumis 
melo]
Length=535

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ + E+LACK+IA RKL++K+D+
Sbjct  64   SQIGTVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKASGEQLACKTIAKRKLVNKEDI  123

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  124  EDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  183

Query  532  GLCRQM  549
             L R +
Sbjct  184  SLLRTI  189



>gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea]
Length=527

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVTYL TH++T E+ ACK+IA RKL +K+D++D
Sbjct  54   IGPVLGRPMEDVRATYTIGKELGRGQFGVTYLCTHKQTGEKFACKTIAKRKLANKEDIED  113

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL+G +NIVELKG YED++ VHL+MELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  114  VRREVQIMHHLSGQQNIVELKGAYEDKHSVHLIMELCAGGELFDRIIAKGHYTERAAASL  173

Query  538  CRQM  549
             R +
Sbjct  174  LRTI  177



>ref|XP_009385897.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  190  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRRE  369
            L RPMEDVH+TY FG ELGRGQFGVT+L+T+R + E LACKSIATRKL ++DD++DVRRE
Sbjct  43   LRRPMEDVHATYSFGRELGRGQFGVTHLITNRASGEVLACKSIATRKLTNRDDLEDVRRE  102

Query  370  VQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            VQIMHHLTGHRNIVEL+G +EDR  V+LVMELC GGELFDRII++GHYSERAAA LCR++
Sbjct  103  VQIMHHLTGHRNIVELRGAFEDRRSVNLVMELCEGGELFDRIISRGHYSERAAAALCREI  162



>ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 126/189 (67%), Gaps = 18/189 (10%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGE------------------SDPPPPKNDITVLppsqppppr  162
            MG+C S   S  AA +  GE                  S  PPPK+     P     P  
Sbjct  1    MGNCCSRGDSGDAAENEKGEAVANNTNGSVANNANQENSTTPPPKSTAPTSPSPAASPKP  60

Query  163  pFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSK  342
               + +G VLGRPME+V S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K
Sbjct  61   AKAAPIGPVLGRPMEEVKSVYTIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNK  120

Query  343  DDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSER  522
            +DV+DV+REVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ER
Sbjct  121  EDVEDVKREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTER  180

Query  523  AAAGLCRQM  549
            AAA L R +
Sbjct  181  AAASLLRTI  189



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +GRVL RP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+
Sbjct  60   ALGRVLARPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVE  119

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHLTGH +IVELK  +EDR++V+L+MELCAGGELFDRIIAKGHYSE  AA 
Sbjct  120  DVRREVQIMHHLTGHPHIVELKEVHEDRHYVNLIMELCAGGELFDRIIAKGHYSECTAAS  179

Query  535  LCRQM  549
            LCRQ+
Sbjct  180  LCRQI  184



>gb|KJB21813.1| hypothetical protein B456_004G015100 [Gossypium raimondii]
Length=538

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 114/162 (70%), Gaps = 18/162 (11%)
 Frame = +1

Query  58   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  237
            P+ P A+ S      P P  N I                  G VL RPMEDV +TY  G 
Sbjct  42   PTQPPASPSEEASPKPTPKPNPI------------------GTVLCRPMEDVRNTYTIGK  83

Query  238  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVEL  417
            ELGRGQFGVTYL TH+ T E+ ACK+IA RKL++K+D++DVRREVQIMHHLTG  N+VEL
Sbjct  84   ELGRGQFGVTYLCTHKVTGEQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNVVEL  143

Query  418  KGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCR  543
            KG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R
Sbjct  144  KGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLR  185



>emb|CAD70166.1| putative calcium-dependent protein kinase [Landoltia punctata]
Length=182

 Score =   189 bits (479),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 114/166 (69%), Gaps = 18/166 (11%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  219
            GS N+ P  P  A +  G    PP K                  + VG VLGR MEDV  
Sbjct  35   GSANAPPQKPPGAVT--GVLRQPPAKGS----------------AAVGPVLGRRMEDVRQ  76

Query  220  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  399
            TY  G ELGRGQFGVT+L T R T ++ ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  77   TYAIGKELGRGQFGVTHLCTDRVTGKQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  136

Query  400  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            +NIVEL G YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  137  QNIVELVGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASL  182



>ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis 
sativus]
 ref|XP_004156049.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis 
sativus]
 gb|KGN48093.1| hypothetical protein Csa_6G430690 [Cucumis sativus]
Length=535

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ + E LACK+IA RKL++K+D+
Sbjct  64   SQIGTVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKASGEHLACKTIAKRKLVNKEDI  123

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  124  EDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  183

Query  532  GLCRQM  549
             L R +
Sbjct  184  SLLRTI  189



>ref|XP_009773532.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
sylvestris]
Length=542

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  69   IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  128

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  129  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  188

Query  538  CRQM  549
             R +
Sbjct  189  LRTI  192



>dbj|BAA81749.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81751.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
             G VLGRP+EDV S Y  G ELGRGQFGVT+L TH+ T E LACKSIA RKL +KDDV+D
Sbjct  66   TGNVLGRPLEDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVED  125

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL G +NIVELKG YED+++VHLVMELCAGGELFDRII +GHYSERAAA L
Sbjct  126  VRREVQIMHHLEGQKNIVELKGAYEDKHNVHLVMELCAGGELFDRIIQRGHYSERAAAAL  185

Query  538  CRQM  549
            CR +
Sbjct  186  CRTI  189



>gb|EYU46187.1| hypothetical protein MIMGU_mgv1a004352mg [Erythranthe guttata]
Length=531

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRPMEDV STY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL +K+D++D
Sbjct  58   VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>dbj|BAA81748.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81750.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
             G VLGRP+EDV S Y  G ELGRGQFGVT+L TH+ T E LACKSIA RKL +KDDV+D
Sbjct  66   TGNVLGRPLEDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVED  125

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL G +NIVELKG YED+++VHLVMELCAGGELFDRII +GHYSERAAA L
Sbjct  126  VRREVQIMHHLEGQKNIVELKGAYEDKHNVHLVMELCAGGELFDRIIQRGHYSERAAAAL  185

Query  538  CRQM  549
            CR +
Sbjct  186  CRTI  189



>ref|XP_009627412.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=541

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  127

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  538  CRQM  549
             R +
Sbjct  188  LRTI  191



>ref|XP_004228884.1| PREDICTED: calcium-dependent protein kinase 34-like [Solanum 
lycopersicum]
Length=541

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV STY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL+SK+D++D
Sbjct  68   IGLVLGRPMEDVRSTYTIGKELGRGQFGVTHLCTQKQTNEQYACKTIAKRKLVSKEDIED  127

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIV+LKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQENIVQLKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  538  CR  543
             R
Sbjct  188  LR  189



>ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase 17-like [Pyrus x 
bretschneideri]
Length=534

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTTYSIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNKEDIED  124

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG +NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  125  VRREVQIMHHLTGQQNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  184

Query  538  CRQM  549
             R +
Sbjct  185  LRTI  188



>ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|KEH17263.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=534

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + VG VL RPMEDV +TY  G ELGRGQFGVT+L TH+ T+E+ ACK+IA RKL++K+D+
Sbjct  61   AAVGPVLQRPMEDVRATYSIGKELGRGQFGVTHLCTHKVTKEQFACKTIAKRKLVNKEDI  120

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  121  EDVRREVQIMHHLTGQANIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  180

Query  532  GLCRQM  549
             L R +
Sbjct  181  SLMRTI  186



>ref|XP_008365176.1| PREDICTED: calcium-dependent protein kinase 17-like [Malus domestica]
Length=533

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDVH+TY  G ELGRGQFGVT+L TH+   E+ ACK+IA RKL++K+D++D
Sbjct  63   IGPVLGRPMEDVHTTYSIGKELGRGQFGVTHLCTHKAXGEQFACKTIAKRKLVNKEDIED  122

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  123  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  182

Query  538  CRQM  549
             R +
Sbjct  183  LRTI  186



>ref|XP_006349794.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum tuberosum]
 ref|XP_006349796.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X3 
[Solanum tuberosum]
 ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
 ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  28   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  87

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  88   VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  147

Query  538  CRQM  549
             R +
Sbjct  148  LRTI  151



>ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  62   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDI  121

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  122  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  181

Query  532  GLCR  543
             L R
Sbjct  182  TLLR  185



>ref|XP_001781985.1| predicted protein [Physcomitrella patens]
 gb|EDQ53209.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
              G VLG+P+ DV S Y  G ELGRGQFGVTY  T+ KT E LACKSIA RKL+SK+D++
Sbjct  10   AAGTVLGKPLSDVRSVYTLGKELGRGQFGVTYACTNIKTGEHLACKSIAKRKLISKEDIE  69

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHL+G  N+VELKG +ED++HVH+VMELCAGGELFDRIIAKGHYSERAAA 
Sbjct  70   DVRREVQIMHHLSGTPNVVELKGVFEDKHHVHIVMELCAGGELFDRIIAKGHYSERAAAA  129

Query  535  LCRQM  549
            LCR +
Sbjct  130  LCRTI  134



>ref|XP_010536137.1| PREDICTED: calcium-dependent protein kinase 17 [Tarenaya hassleriana]
Length=521

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 118/164 (72%), Gaps = 13/164 (8%)
 Frame = +1

Query  58   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  237
            P++P   ++A  +  PP P   I                 +G VLGRPMED+ +++  G 
Sbjct  24   PTNPAETSAAASKHAPPSPPPAIK-------------QGPIGPVLGRPMEDIKASFSLGK  70

Query  238  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVEL  417
            ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVRREVQIMHHLTG  NIVEL
Sbjct  71   ELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVEL  130

Query  418  KGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            KG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +
Sbjct  131  KGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTI  174



>ref|XP_004293141.1| PREDICTED: calcium-dependent protein kinase 34 [Fragaria vesca 
subsp. vesca]
Length=531

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH++T E  ACK+IA RKL++K+D++D
Sbjct  61   IGPVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKQTGEHFACKTIAKRKLVNKEDIED  120

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  121  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  180

Query  538  CRQM  549
             R +
Sbjct  181  LRTI  184



>ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXC10389.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGTVLGRPMEDVRSTYNIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDIED  127

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  538  CRQM  549
             R +
Sbjct  188  LRTI  191



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 119/170 (70%), Gaps = 11/170 (6%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  219
            G+  +  S+P A TSA   S   PP                     +G VLGRPMEDV +
Sbjct  21   GNGATAQSNPAAETSAAPASKHAPPSPPPATKQ-----------GPIGPVLGRPMEDVKA  69

Query  220  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  399
            +Y  G ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  70   SYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  129

Query  400  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
             NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +
Sbjct  130  PNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTI  179



>ref|XP_010099802.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXB80470.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGTVLGRPMEDVRSTYNIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDIED  127

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  538  CRQM  549
             R +
Sbjct  188  LRTI  191



>ref|XP_009402456.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 128/179 (72%), Gaps = 8/179 (4%)
 Frame = +1

Query  37   MGSC----NSIPSSPFAATSAGGESDPPPPKNDITV----LppsqpppprpFLSGVGRVL  192
            MG+C     + P++P  A +     DP P  +D  V    +P +   PP    + +G VL
Sbjct  1    MGNCFTKKPADPATPTDADTPAHAPDPSPAPDDAPVQTAPVPTAAFSPPPKPAAPIGPVL  60

Query  193  GRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREV  372
            GRPMEDV +TY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL +K+D++DVRREV
Sbjct  61   GRPMEDVRTTYSLGKELGRGQFGVTHLCTHKATGDKYACKTIAKRKLANKEDIEDVRREV  120

Query  373  QIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            QIM+HL+G  NIVELKG +ED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +
Sbjct  121  QIMYHLSGQPNIVELKGAFEDKQSVHLVMELCAGGELFDRIIARGHYTERAAASLLRTI  179



>ref|XP_004513232.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=540

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + +G VL RPMEDV +TY  G ELGRGQFGVT+L TH+ T+E+ ACK+IA RKL++K+D+
Sbjct  67   AAMGPVLQRPMEDVRATYTIGKELGRGQFGVTHLCTHKVTKEQFACKTIAKRKLVNKEDI  126

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  127  EDVRREVQIMHHLTGQANIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  186

Query  532  GLCRQM  549
             L R +
Sbjct  187  SLLRTI  192



>ref|XP_009419685.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = +1

Query  37   MGSC-NSIPSSPFAATSAG-GESDPPPPKNDITVLppsqpppprpFL-----SGVGRVLG  195
            MG+C    P++P  A   G   +DP P            P P   F      + +G VLG
Sbjct  1    MGNCFTKNPTNPAPAEGEGEAGADPVPSSAPDDAPVQKAPIPTAAFTPPPKPTAIGPVLG  60

Query  196  RPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQ  375
            RPMEDV +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+D++DVRREVQ
Sbjct  61   RPMEDVRTTYSLGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTNKEDIEDVRREVQ  120

Query  376  IMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            IM+HL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +
Sbjct  121  IMYHLSGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIARGHYTERAAASLLRTI  178



>ref|XP_001771902.1| predicted protein [Physcomitrella patens]
 gb|EDQ63331.1| predicted protein [Physcomitrella patens]
Length=482

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            +S VG VLG+P+ D+  TY  G ELGRGQFGVTYL TH++T E+LACKSIA RKL++K+D
Sbjct  9    VSNVG-VLGKPLVDIRQTYSLGKELGRGQFGVTYLCTHKETGEKLACKSIAKRKLIAKED  67

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DV+REVQIMHHL+G  NIV+LKG YEDR+ VHLVMELCAGGELFDRIIAKGHYSERAA
Sbjct  68   IEDVKREVQIMHHLSGTPNIVDLKGVYEDRHSVHLVMELCAGGELFDRIIAKGHYSERAA  127

Query  529  AGLCR  543
            A LCR
Sbjct  128  ADLCR  132



>ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  63   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  122

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  123  VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  182

Query  538  CRQM  549
             R +
Sbjct  183  LRTI  186



>emb|CDP20327.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRPMEDV S Y  G ELGRGQFGVT+L T+++T E+ ACK+IA RKL++K+D++D
Sbjct  58   VGPVLGRPMEDVRSLYTIGKELGRGQFGVTHLCTNKQTGEQFACKTIAKRKLVNKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia]
Length=534

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV  TY  G ELGRGQFG+T+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  60   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGITHLCTHKQSGEQFACKTIAKRKLVNKEDI  119

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  120  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  179

Query  532  GLCRQM  549
             L R +
Sbjct  180  TLLRTI  185



>gb|KDO36585.1| hypothetical protein CISIN_1g042977mg, partial [Citrus sinensis]
Length=471

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVRR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRR  128

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  546
            EVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R 
Sbjct  129  EVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT  188

Query  547  M  549
            +
Sbjct  189  I  189



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 119/170 (70%), Gaps = 11/170 (6%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  219
            G+  +  S+P A TSA   S   PP                     +G VLGRPMEDV +
Sbjct  21   GNGATAQSNPAAETSAAPASKHAPPSPPPATKQ-----------GPIGPVLGRPMEDVKA  69

Query  220  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  399
            +Y  G ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  70   SYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  129

Query  400  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
             NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +
Sbjct  130  PNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTI  179



>gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integrifolia subsp. 
inflata]
Length=532

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  57   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDI  116

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  117  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  176

Query  532  GLCRQM  549
             L R +
Sbjct  177  TLLRTI  182



>ref|XP_006644382.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006644383.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Oryza brachyantha]
Length=460

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV +TY FG ELGRGQFGVTYLVTH+ + +R ACKSIATRKL+ +DD++DVRREVQIM
Sbjct  1    MEDVRATYTFGRELGRGQFGVTYLVTHKASGKRFACKSIATRKLVHRDDIEDVRREVQIM  60

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            +HLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHY+ERAAA LCR++
Sbjct  61   YHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYTERAAAALCREI  116



>ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=532

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  120  VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  179

Query  538  CRQM  549
             R +
Sbjct  180  LRTI  183



>gb|EYU35947.1| hypothetical protein MIMGU_mgv1a004350mg [Erythranthe guttata]
Length=532

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL +K+D++D
Sbjct  59   MGPVLGRPMEDIRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED  118

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  119  VRREVQIMHHLTGQANIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  178

Query  538  CRQM  549
             R +
Sbjct  179  LRTI  182



>ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase 34-like [Sesamum 
indicum]
Length=532

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRPMEDV STY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL +K+D++D
Sbjct  59   VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLANKEDIED  118

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  N+VELKG +ED++ VHLVMELCAGGELFDRIIA+GHY+ERAAA L
Sbjct  119  VRREVQIMHHLTGQPNVVELKGAFEDKHSVHLVMELCAGGELFDRIIARGHYTERAAASL  178

Query  538  CRQM  549
             R +
Sbjct  179  LRTI  182



>ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  123

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  124  VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  183

Query  538  CRQM  549
             R +
Sbjct  184  LRTI  187



>ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=537

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDIED  124

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            V+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  125  VKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAATL  184

Query  538  CR  543
             R
Sbjct  185  LR  186



>ref|XP_006361005.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
tuberosum]
Length=544

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL++K+D++D
Sbjct  71   IGLVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTQKQTSEQFACKTIAKRKLVNKEDIED  130

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIV+LKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  131  VRREVQIMHHLTGQENIVQLKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  190

Query  538  CRQM  549
             R +
Sbjct  191  LRTI  194



>gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas]
Length=531

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+DV+D
Sbjct  68   IGPVLGRPMEDVKSVYTIGKELGRGQFGVTHLCTHKITGEQFACKTIAKRKLVNKEDVED  127

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            V+REVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VKREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  538  CRQM  549
             R +
Sbjct  188  LRTI  191



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVTYL T + T  + ACK+IA RKL++K+D++D
Sbjct  45   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIED  104

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+++VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  105  VRREVQIMHHLTGQPNIVELKGAYEDKHNVHLVMELCAGGELFDRIIAKGHYSERAAASL  164

Query  538  CRQM  549
             R +
Sbjct  165  LRTI  168



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVTYL T + T  + ACK+IA RKL++K+D++D
Sbjct  45   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIED  104

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+++VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  105  VRREVQIMHHLTGQPNIVELKGAYEDKHNVHLVMELCAGGELFDRIIAKGHYSERAAASL  164

Query  538  CRQM  549
             R +
Sbjct  165  LRTI  168



>ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
 gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
Length=535

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ STY  G ELGRGQFGVT+L T++ T E+ ACK+IA RKL++K+D++D
Sbjct  66   IGPVLGRPMEDIKSTYTIGKELGRGQFGVTHLCTNKATGEQFACKTIAKRKLVNKEDIED  125

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  126  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  185

Query  538  CRQM  549
             R +
Sbjct  186  LRTI  189



>gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii]
Length=527

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 118/169 (70%), Gaps = 23/169 (14%)
 Frame = +1

Query  43   SCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHST  222
            S  + PSS  A+T  G +S P P                      +G VLGRPMEDV +T
Sbjct  36   SYRTAPSSQGAST-VGKQSKPAP----------------------MGPVLGRPMEDVKAT  72

Query  223  YIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHR  402
            Y  G ELGRGQFG+T+L TH+ T E+ ACK+IA RKL SK+DV+DVRREVQIMHHLTG  
Sbjct  73   YTIGKELGRGQFGITHLCTHKTTGEQFACKTIAKRKLSSKEDVEDVRREVQIMHHLTGQP  132

Query  403  NIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            NIVELKG YED++ VHLVMELC GGELFDRIIAKGHY+ERAAA L R +
Sbjct  133  NIVELKGAYEDKHAVHLVMELCGGGELFDRIIAKGHYTERAAASLLRTI  181



>gb|ABV22565.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22571.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=545

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
              G VLG+P+ DV S Y  G ELGRGQFGVTY  T+ KT E LACKSIA RKL+SK+D++
Sbjct  76   AAGTVLGKPLSDVRSVYTLGKELGRGQFGVTYACTNIKTGEHLACKSIAKRKLISKEDIE  135

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DVRREVQIMHHL+G  N+VELKG +ED++HVH+VMELCAGGELFDRIIAKGHYSERAAA 
Sbjct  136  DVRREVQIMHHLSGTPNVVELKGVFEDKHHVHIVMELCAGGELFDRIIAKGHYSERAAAA  195

Query  535  LCRQM  549
            LCR +
Sbjct  196  LCRTI  200



>ref|XP_006446309.1| hypothetical protein CICLE_v10014854mg [Citrus clementina]
 gb|ESR59549.1| hypothetical protein CICLE_v10014854mg [Citrus clementina]
Length=534

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVRR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRR  128

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  546
            EVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R 
Sbjct  129  EVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT  188

Query  547  M  549
            +
Sbjct  189  I  189



>ref|XP_006470577.1| PREDICTED: calcium-dependent protein kinase 17-like [Citrus sinensis]
Length=534

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVRR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRR  128

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  546
            EVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R 
Sbjct  129  EVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT  188

Query  547  M  549
            +
Sbjct  189  I  189



>gb|ABV22575.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22576.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=628

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            +S VG VLG+P+ D+  TY  G ELGRGQFGVTYL TH++T E+LACKSIA RKL++K+D
Sbjct  155  VSNVG-VLGKPLVDIRQTYSLGKELGRGQFGVTYLCTHKETGEKLACKSIAKRKLIAKED  213

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            ++DV+REVQIMHHL+G  NIV+LKG YEDR+ VHLVMELCAGGELFDRIIAKGHYSERAA
Sbjct  214  IEDVKREVQIMHHLSGTPNIVDLKGVYEDRHSVHLVMELCAGGELFDRIIAKGHYSERAA  273

Query  529  AGLCR  543
            A LCR
Sbjct  274  ADLCR  278



>emb|CDX97174.1| BnaC09g44510D [Brassica napus]
 emb|CDX69700.1| BnaA10g20490D [Brassica napus]
Length=522

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  112  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  171

Query  538  CRQM  549
             R +
Sbjct  172  LRTI  175



>ref|XP_003567831.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=548

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GRVLGRP+ DV +TY FG ELGRGQFGVTYL TH+ T  R ACKSI+ RKL   DD DDV
Sbjct  82   GRVLGRPLSDVRATYTFGRELGRGQFGVTYLATHKSTGARYACKSISARKLSRGDDADDV  141

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIMHHLTGHR+IVELKG +EDR+ V+LVMELC GGELFDRIIA+GHYSE AAA +C
Sbjct  142  RREVQIMHHLTGHRSIVELKGAHEDRHSVNLVMELCEGGELFDRIIARGHYSESAAAAVC  201

Query  541  RQM  549
            R++
Sbjct  202  REV  204



>ref|XP_009121874.1| PREDICTED: calcium-dependent protein kinase 17 [Brassica rapa]
Length=522

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  112  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  171

Query  538  CRQM  549
             R +
Sbjct  172  LRTI  175



>ref|XP_006356386.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
tuberosum]
Length=524

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH++  E+ ACK+IA RKL++K+D+
Sbjct  50   SPIGLVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDI  109

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRII KGHY+ERAAA
Sbjct  110  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIITKGHYTERAAA  169

Query  532  GLCRQM  549
             L R +
Sbjct  170  TLLRTI  175



>ref|XP_006289327.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
 gb|EOA22225.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
Length=530

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  179

Query  538  CRQM  549
             R +
Sbjct  180  LRTI  183



>gb|KJB09335.1| hypothetical protein B456_001G135000 [Gossypium raimondii]
Length=513

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 120/177 (68%), Gaps = 16/177 (9%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPP------PPKNDITVLppsqpppprpFLSGVGRVLGR  198
            MG+C S   SP A  +   + D P      PP    +                +G VLGR
Sbjct  1    MGNCCS-RGSPAAEDANDDKGDAPKQAEGSPPSGGAS---------SNSMSDSIGNVLGR  50

Query  199  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  378
            PMED+ +TY  G ELGRGQFGVT+L TH+ T E+ ACK+I  RKL +K+D++DV+R+VQI
Sbjct  51   PMEDIKATYTIGKELGRGQFGVTHLCTHKTTGEQFACKTITKRKLSTKEDIEDVKRDVQI  110

Query  379  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            MHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +
Sbjct  111  MHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTI  167



>ref|XP_008227265.1| PREDICTED: calcium-dependent protein kinase 34-like [Prunus mume]
Length=534

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E  ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTIAKRKLVNKEDIED  123

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  124  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  183

Query  538  CRQM  549
             R +
Sbjct  184  LRTI  187



>ref|XP_004980140.1| PREDICTED: calcium-dependent protein kinase 17-like [Setaria 
italica]
Length=538

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+LACK+IA RKL SK+DVDD
Sbjct  66   VGPVLGRPMEDVRTTYSMGKELGRGQFGVTHLCTHRATGEKLACKTIAKRKLASKEDVDD  125

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL+G  N+V L+G YED+++VHLVMELCAGGELFDRIIA+G Y+ERAAA L
Sbjct  126  VRREVQIMHHLSGQPNVVGLRGAYEDKHNVHLVMELCAGGELFDRIIARGQYTERAAASL  185

Query  538  CRQM  549
             R +
Sbjct  186  LRTI  189



>ref|XP_009125853.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=522

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  112  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  171

Query  538  CRQM  549
             R +
Sbjct  172  LRTI  175



>emb|CDX70450.1| BnaC03g05340D [Brassica napus]
Length=523

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>ref|XP_007213195.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
 gb|EMJ14394.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
Length=534

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E  ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTIAKRKLVNKEDIED  123

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  124  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  183

Query  538  CRQM  549
             R +
Sbjct  184  LRTI  187



>ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase 34 [Nelumbo nucifera]
Length=521

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMED+ + Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D+
Sbjct  50   SQIGTVLGRPMEDIKTVYTIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDI  109

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHL G  NIVELKG YED++ VHLVMELCAGGELFD+IIAKGHYSERAAA
Sbjct  110  EDVRREVQIMHHLAGQPNIVELKGAYEDKHSVHLVMELCAGGELFDKIIAKGHYSERAAA  169

Query  532  GLCRQM  549
             L R +
Sbjct  170  SLLRTI  175



>ref|XP_010453282.1| PREDICTED: calcium-dependent protein kinase 17 [Camelina sativa]
Length=530

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSE+AAA L
Sbjct  120  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSEKAAASL  179

Query  538  CRQM  549
             R +
Sbjct  180  LRTI  183



>ref|XP_004978350.1| PREDICTED: calcium-dependent protein kinase 17-like [Setaria 
italica]
Length=541

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+LACK+IA RKL SK+DVDD
Sbjct  69   VGPVLGRPMEDVRTTYSMGKELGRGQFGVTHLCTHRATGEKLACKTIAKRKLASKEDVDD  128

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL+G  N+V L+G YED+++VHLVMELCAGGELFDRIIA+G Y+ERAAA L
Sbjct  129  VRREVQIMHHLSGQPNVVGLRGAYEDKHNVHLVMELCAGGELFDRIIARGQYTERAAASL  188

Query  538  CRQM  549
             R +
Sbjct  189  LRTI  192



>gb|KJB55472.1| hypothetical protein B456_009G078000 [Gossypium raimondii]
Length=532

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L T++ T E+ ACK+IA RKL +K+D++D
Sbjct  60   IGPVLGRPMEDIKTTYNIGKELGRGQFGVTHLCTNKSTGEQFACKTIAKRKLANKEDIED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  120  VRREVQIMHHLTGQSNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  179

Query  538  CR  543
             R
Sbjct  180  LR  181



>ref|XP_010419805.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Camelina sativa]
 ref|XP_010491975.1| PREDICTED: calcium-dependent protein kinase 17-like [Camelina 
sativa]
Length=527

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  116

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSE+AAA L
Sbjct  117  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSEKAAASL  176

Query  538  CRQM  549
             R +
Sbjct  177  LRTI  180



>ref|XP_006845045.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
 gb|ERN06720.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
Length=517

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TYI G ELGRGQFG+T+L TH+ T +  ACK+IA RKL++K+D++D
Sbjct  49   IGPVLGRPMEDVRATYIMGKELGRGQFGITHLCTHKATGQPFACKTIAKRKLVNKEDIED  108

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HLTG  NIVELKG +ED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  109  VRREVQIMYHLTGQPNIVELKGAFEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAAAL  168

Query  538  CRQM  549
             R +
Sbjct  169  MRTI  172



>ref|XP_006399734.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
 gb|ESQ41187.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
Length=528

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+D+
Sbjct  52   AAIGPVLGRPMEDVGATYSLGKELGRGQFGVTHLCTHKATDEKLACKTIAKRKLANKEDI  111

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDR+IA+GHY+ERAAA
Sbjct  112  EDVRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRVIARGHYTERAAA  171

Query  532  GLCRQM  549
             L R +
Sbjct  172  SLLRTI  177



>ref|XP_002871516.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47775.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
Length=530

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIED  119

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  179

Query  538  CRQM  549
             R +
Sbjct  180  LRTI  183



>ref|XP_002299975.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
 gb|EEE84780.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
Length=505

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            ++ +G VLGRPMEDV S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  31   VAPIGPVLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  90

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  91   VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  150

Query  529  AGLCRQM  549
            A L R +
Sbjct  151  ASLLRTI  157



>ref|XP_004250895.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
lycopersicum]
Length=529

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH++  E+ ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDIED  116

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            V+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRII KGHY+ERAAA L
Sbjct  117  VKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIITKGHYTERAAATL  176

Query  538  CRQM  549
             R +
Sbjct  177  LRTI  180



>gb|AGG35954.1| calcium-dependent protein kinase 34 [Brassica napus]
Length=484

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDIKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  538  CRQM  549
             R +
Sbjct  167  LRTI  170



>gb|KFK26202.1| hypothetical protein AALP_AA8G215800 [Arabis alpina]
Length=523

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+++VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHNVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>gb|KHN23929.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=474

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D++D
Sbjct  1    MGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKATGQQFACKTIAKRKLVNKEDIED  60

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  61   VRREVQIMHHLSGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASL  120

Query  538  CR  543
             R
Sbjct  121  LR  122



>emb|CDX78468.1| BnaA03g03800D [Brassica napus]
Length=523

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>ref|XP_010419806.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Camelina sativa]
Length=528

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSE+AAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSEKAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>gb|AHG06449.1| calcium-dependent protein kinase 17 [Brassica napus]
Length=523

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus 
grandis]
 gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis]
Length=534

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPME+V S Y  G ELGRGQFGVT+L TH++T ++ ACK+IA RKL++K+D+
Sbjct  63   SPIGPVLGRPMEEVKSMYTIGKELGRGQFGVTHLCTHKQTGQQFACKTIAKRKLVNKEDI  122

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIM+HLTG  NIVELKG YED++ VHLVMELCAGGELFDRII+KGHY+ERAAA
Sbjct  123  EDVRREVQIMYHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIISKGHYTERAAA  182

Query  532  GLCRQM  549
             L R +
Sbjct  183  SLLRTI  188



>emb|CDY63783.1| BnaCnng42690D [Brassica napus]
Length=517

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMED+ S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDIKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  538  CRQM  549
             R +
Sbjct  167  LRTI  170



>ref|NP_197437.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana]
 sp|Q3E9C0.1|CDPKY_ARATH RecName: Full=Calcium-dependent protein kinase 34 [Arabidopsis 
thaliana]
 gb|ABE66169.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AED92691.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana]
Length=523

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>ref|XP_002873943.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50202.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  55   IGPVLGRPMEDVKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  114

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  115  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  174

Query  538  CRQM  549
             R +
Sbjct  175  LRTI  178



>ref|XP_003556786.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=546

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D+
Sbjct  71   AAMGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKATGQQFACKTIAKRKLVNKEDI  130

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  131  EDVRREVQIMHHLSGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  190

Query  532  GLCR  543
             L R
Sbjct  191  SLLR  194



>gb|AAL59948.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=528

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKSTGHQFACKTIAKRKLVNKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>emb|CDY44912.1| BnaA02g04170D [Brassica napus]
Length=517

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  538  CRQM  549
             R +
Sbjct  167  LRTI  170



>gb|AFW82380.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=220

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT L TH+ T  R ACK+I+ RKL +K+DV+D
Sbjct  50   IGPVLGRPMEDVRATYAVGKELGRGQFGVTSLCTHKATGHRFACKTISKRKLSTKEDVED  109

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL+G   +VELKG YED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L
Sbjct  110  VRREVQIMYHLSGQPGVVELKGAYEDKGSVHLVMELCAGGELFDRIIARGHYTERAAASL  169

Query  538  CRQM  549
             R +
Sbjct  170  LRTI  173



>ref|XP_009126355.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
Length=517

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  538  CRQM  549
             R +
Sbjct  167  LRTI  170



>ref|XP_006289743.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
 gb|EOA22641.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
Length=524

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  54   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  113

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  114  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  173

Query  538  CRQM  549
             R +
Sbjct  174  LRTI  177



>ref|NP_196779.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
 sp|Q9FMP5.1|CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17 [Arabidopsis 
thaliana]
 dbj|BAB10036.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAU95457.1| At5g12180 [Arabidopsis thaliana]
 gb|AED91771.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
Length=528

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>ref|XP_010420737.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=523

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>ref|XP_010454209.1| PREDICTED: calcium-dependent protein kinase 34 [Camelina sativa]
Length=523

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  538  CRQM  549
             R +
Sbjct  173  LRTI  176



>ref|XP_011024983.1| PREDICTED: calcium-dependent protein kinase 17 [Populus euphratica]
Length=530

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            ++ +G VLGRPMEDV S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  57   VAPIGPVLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  116

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  117  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  176

Query  529  AGLCRQM  549
            A L R +
Sbjct  177  ASLLRTI  183



>ref|XP_010492994.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=525

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  55   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  114

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  115  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  174

Query  538  CRQM  549
             R +
Sbjct  175  LRTI  178



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL +K+D+
Sbjct  51   SAIGPVLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKTTGKQYACKTIAKRKLANKEDI  110

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIMHHLTG  NIVEL G +ED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  111  EDVRREVQIMHHLTGQPNIVELIGAFEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  170

Query  532  GLCRQM  549
             L R +
Sbjct  171  SLLRTI  176



>ref|XP_010922091.1| PREDICTED: calcium-dependent protein kinase 17-like [Elaeis guineensis]
Length=515

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+ ACK+IA RKL++K+D++D
Sbjct  46   IGPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRISGEQFACKTIAKRKLVNKEDIED  105

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL+G  NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  106  VRREVQIMYHLSGQPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  165

Query  538  CRQM  549
             R +
Sbjct  166  LRTI  169



>ref|XP_006400491.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
 gb|ESQ41944.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
Length=527

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  116

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  117  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  176

Query  538  CRQM  549
             R +
Sbjct  177  LRTI  180



>ref|XP_008788593.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=515

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            G VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+ ACK+IA RKL+SK+D++DV
Sbjct  47   GPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRLTGEQFACKTIAKRKLVSKEDIEDV  106

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            RREVQIM+HL+G  NIVELKG +ED++ VHLVMELCAGGELFDRIIA+GHY+ERAAA L 
Sbjct  107  RREVQIMYHLSGQPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIARGHYTERAAASLL  166

Query  541  RQM  549
            R +
Sbjct  167  RTI  169



>ref|XP_002441304.1| hypothetical protein SORBIDRAFT_09g024100 [Sorghum bicolor]
 gb|EES19734.1| hypothetical protein SORBIDRAFT_09g024100 [Sorghum bicolor]
Length=527

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 125/176 (71%), Gaps = 9/176 (5%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  201
            GS ++ P+ P   +SAG  S P      PPP +  +    +      P  + +G VLGRP
Sbjct  8    GSSSAEPALP-PDSSAGSSSRPGGSATVPPPTSVSSSATTAPTQNKPP--AAIGPVLGRP  64

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  65   MEDVKSTYTMGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  124

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            +HL+G   +VELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  125  YHLSGQPGVVELKGAYEDKSSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  180



>gb|KFK25494.1| hypothetical protein AALP_AA8G122000 [Arabis alpina]
Length=528

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIED  117

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  538  CRQM  549
             R +
Sbjct  178  LRTI  181



>dbj|BAK06838.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRP+EDV +TY  G ELGRGQFGVTYL TH +T E+LACK+IA RKL   +DV+D
Sbjct  69   VGEVLGRPIEDVRATYTIGEELGRGQFGVTYLCTHTETGEKLACKTIAKRKLSGAEDVED  128

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREV+IMHHL+G  NIV+L+G YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  129  VRREVEIMHHLSGQPNIVDLRGAYEDKHNVHLVMELCAGGELFDRIIAKGHYTERAAASL  188

Query  538  CRQM  549
             R +
Sbjct  189  LRSV  192



>ref|XP_002313265.1| calcium-dependent protein kinase [Populus trichocarpa]
 gb|EEE87220.1| calcium-dependent protein kinase [Populus trichocarpa]
Length=525

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  112  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  171

Query  529  AGLCRQM  549
            A L R +
Sbjct  172  ASLLRTI  178



>ref|XP_011009111.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  112  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  171

Query  529  AGLCRQM  549
            A L R +
Sbjct  172  ASLLRTI  178



>ref|XP_010904692.1| PREDICTED: calcium-dependent protein kinase 34-like [Elaeis guineensis]
Length=516

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSAYTMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLVNKEDIED  106

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL+G  NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  107  VRREVQIMYHLSGQPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  166

Query  538  CRQM  549
             R +
Sbjct  167  LRTI  170



>ref|XP_003576346.1| PREDICTED: calcium-dependent protein kinase 17-like [Brachypodium 
distachyon]
Length=532

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 120/163 (74%), Gaps = 16/163 (10%)
 Frame = +1

Query  61   SSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGE  240
            +S  +A++ GG S   PP +                 + VG VLGRPMEDV +TY  G E
Sbjct  37   ASSSSASNRGGASKAAPPSSS----------------APVGEVLGRPMEDVRATYSIGKE  80

Query  241  LGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELK  420
            LGRGQFGVT+L THR + E+LACK+IA RKL +++D++DVRREVQIM+HL+G  NIV+L+
Sbjct  81   LGRGQFGVTHLCTHRTSGEKLACKTIAKRKLSTREDLEDVRREVQIMYHLSGQPNIVDLR  140

Query  421  GTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            G YED++ VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +
Sbjct  141  GAYEDKHSVHLVMELCAGGELFDRIIARGHYTERAAASLLRAI  183



>ref|XP_011014420.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  169  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  348
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  349  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  528
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  112  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  171

Query  529  AGLCRQM  549
            A L R +
Sbjct  172  ASLLRTI  178



>gb|KHN28162.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=472

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D++D
Sbjct  1    MGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDIED  60

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  61   VRREVQIMNHLSGQSNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASL  120

Query  538  CR  543
             R
Sbjct  121  LR  122



>ref|XP_003528592.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=541

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D+
Sbjct  68   AAMGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDI  127

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DVRREVQIM+HL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  128  EDVRREVQIMNHLSGQSNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  187

Query  532  GLCR  543
             L R
Sbjct  188  SLLR  191



>gb|EAY76207.1| hypothetical protein OsI_04143 [Oryza sativa Indica Group]
 gb|EAZ13887.1| hypothetical protein OsJ_03814 [Oryza sativa Japonica Group]
Length=501

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 114/167 (68%), Gaps = 25/167 (15%)
 Frame = +1

Query  61   SSPFAA----TSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYI  228
            SS F A    +SA  ++ PP P                     +G VLGRPMEDV S Y 
Sbjct  24   SSSFKAGASPSSAPAQNKPPAP---------------------IGPVLGRPMEDVRSIYT  62

Query  229  FGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNI  408
             G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL G  N+
Sbjct  63   IGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHLAGQPNV  122

Query  409  VELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            VELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  123  VELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  169



>ref|XP_006644875.1| PREDICTED: calcium-dependent protein kinase 34-like [Oryza brachyantha]
Length=518

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 117/173 (68%), Gaps = 24/173 (14%)
 Frame = +1

Query  31   LQMGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMED  210
            L+ G+     +SP   +SA  ++ PP P                     +G VLGRPMED
Sbjct  24   LRTGASMKAGASP---SSAPAQNKPPAP---------------------IGPVLGRPMED  59

Query  211  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  390
            V S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL
Sbjct  60   VRSIYTVGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHL  119

Query  391  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
             G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  120  AGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  172



>ref|XP_001768980.1| predicted protein [Physcomitrella patens]
 gb|EDQ66178.1| predicted protein [Physcomitrella patens]
Length=483

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            VLG+P+ D+  TY  G ELGRGQFGVTYL TH+ T E LACKSIA RKL +K+DV+DV+R
Sbjct  18   VLGKPLVDIRQTYSLGRELGRGQFGVTYLCTHKTTGEILACKSIAKRKLTTKEDVEDVKR  77

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCR  543
            EVQIMHHL+G  NIV+LKG YEDR+ VHLVMELCAGGELFDRIIAKGHYSERAAA LCR
Sbjct  78   EVQIMHHLSGTPNIVDLKGVYEDRHSVHLVMELCAGGELFDRIIAKGHYSERAAADLCR  136



>ref|NP_001044575.1| Os01g0808400 [Oryza sativa Japonica Group]
 dbj|BAD68074.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD68220.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06489.1| Os01g0808400 [Oryza sativa Japonica Group]
Length=515

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 114/167 (68%), Gaps = 25/167 (15%)
 Frame = +1

Query  61   SSPFAA----TSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYI  228
            SS F A    +SA  ++ PP P                     +G VLGRPMEDV S Y 
Sbjct  24   SSSFKAGASPSSAPAQNKPPAP---------------------IGPVLGRPMEDVRSIYT  62

Query  229  FGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNI  408
             G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL G  N+
Sbjct  63   IGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHLAGQPNV  122

Query  409  VELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            VELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  123  VELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  169



>gb|AFW84809.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=464

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  538  CRQM  549
             R +
Sbjct  171  LRTI  174



>ref|XP_004491231.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=520

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + +G VL RPMEDV +TY  G ELGRGQFGVTYL TH+ T ++ ACK+IA RKL++K+D+
Sbjct  48   AAIGPVLERPMEDVKATYSIGKELGRGQFGVTYLCTHKTTGKQYACKTIAKRKLVNKEDI  107

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +D RREVQIMHHLTG  N+VEL G YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  108  EDARREVQIMHHLTGQPNVVELVGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  167

Query  532  GLCRQM  549
             L R +
Sbjct  168  SLLRTI  173



>tpg|DAA57188.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=510

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  538  CRQM  549
             R +
Sbjct  171  LRTI  174



>gb|EMT22025.1| Calcium-dependent protein kinase 3 [Aegilops tauschii]
Length=481

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DDV+D RREVQIM
Sbjct  1    MEDVRATYTFGRELGRGQFGVTYLATHKSTGSRYACKSIAARKLARADDVEDARREVQIM  60

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            HHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA LCR++
Sbjct  61   HHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAATLCREV  116



>gb|AGT17455.1| hypothetical protein SHCRBa_258_F08_F_40 [Saccharum hybrid cultivar 
R570]
Length=519

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 10/176 (6%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  201
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            +HL+G   +VELKG YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  179



>ref|XP_008674922.1| PREDICTED: calcium-dependent protein kinase 34 [Zea mays]
Length=520

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  538  CRQM  549
             R +
Sbjct  171  LRTI  174



>gb|AGT15898.1| calcium-dependent protein kinase [Saccharum hybrid cultivar R570]
 gb|AGT16288.1| Protein kinase-like domain [Saccharum hybrid cultivar R570]
Length=526

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 10/176 (6%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  201
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            +HL+G   +VELKG YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  179



>ref|XP_008657141.1| PREDICTED: calcium-dependent protein kinase 34-like [Zea mays]
Length=520

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  538  CRQM  549
             R +
Sbjct  171  LRTI  174



>ref|XP_009414363.1| PREDICTED: calcium-dependent protein kinase 17 [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPM+DVH+TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL SK+DV+D
Sbjct  54   IGLVLGRPMQDVHATYTIGKELGRGQFGVTHLCTHKTTAEQFACKTIAKRKLTSKEDVED  113

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREV+IM+HL G  N+VELKG YED++ VHLVMELCAGGELFDRI+A+GH++E AAA L
Sbjct  114  VRREVEIMYHLAGQANVVELKGAYEDKHSVHLVMELCAGGELFDRIVAQGHFTEFAAASL  173

Query  538  CRQM  549
             R +
Sbjct  174  LRTI  177



>gb|ADE76782.1| unknown [Picea sitchensis]
Length=256

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  360
            GR+LGRP+EDV S Y  G ELGRGQFGVTY+ THR+T ++ ACKSIA RKL   DD++ V
Sbjct  62   GRILGRPLEDVRSQYSIGKELGRGQFGVTYICTHRQTLQKYACKSIAIRKLKRNDDIEKV  121

Query  361  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  540
            R EV+IM HLTG  NIVE KG YEDR  V+LVMELCAGGELF+RIIAKGHYSERAAA L 
Sbjct  122  RMEVKIMQHLTGKPNIVEFKGAYEDRRSVNLVMELCAGGELFERIIAKGHYSERAAASLF  181

Query  541  RQM  549
            R +
Sbjct  182  RTI  184



>ref|XP_004961659.1| PREDICTED: calcium-dependent protein kinase 34-like [Setaria 
italica]
Length=573

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            VG VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  101  VGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  160

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIM+HL+G   +VELKG YED+N VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  161  VRREVQIMYHLSGQPGVVELKGAYEDKNSVHLVMELCAGGELFDRIIAKGHYTERAAASL  220

Query  538  CRQM  549
             R +
Sbjct  221  LRTI  224



>gb|AGT17376.1| calcium-dependent protein kinase [Saccharum hybrid cultivar R570]
Length=540

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 10/176 (6%)
 Frame = +1

Query  40   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  201
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  202  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  381
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  382  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            +HL+G   +VELKG YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  179



>gb|ABV22562.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22563.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=578

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            VLG+P+ D+  TY  G ELGRGQFGVTYL TH+ T E LACKSIA RKL +K+DV+DV+R
Sbjct  113  VLGKPLVDIRQTYSLGRELGRGQFGVTYLCTHKTTGEILACKSIAKRKLTTKEDVEDVKR  172

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCR  543
            EVQIMHHL+G  NIV+LKG YEDR+ VHLVMELCAGGELFDRIIAKGHYSERAAA LCR
Sbjct  173  EVQIMHHLSGTPNIVDLKGVYEDRHSVHLVMELCAGGELFDRIIAKGHYSERAAADLCR  231



>ref|XP_008786936.1| PREDICTED: calcium-dependent protein kinase 34-like [Phoenix 
dactylifera]
Length=514

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 123/171 (72%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  216
            MG+C S   SP     A G +    P       PP +P PP      +G VLGRPMEDV 
Sbjct  1    MGNCFSNDKSP---RPAAGNAAADRPNLSPHAAPPPKPSPPPSKPVPIGPVLGRPMEDVK  57

Query  217  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  396
            +TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL +K+D++DVRREV+IM+HL+G
Sbjct  58   ATYSMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLANKEDIEDVRREVRIMYHLSG  117

Query  397  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
              NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +
Sbjct  118  QPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTI  168



>ref|XP_002276630.2| PREDICTED: calcium-dependent protein kinase 34-like [Vitis vinifera]
Length=534

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV + Y  G ELGRGQFGVT+L T + T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTIAKRKLVNKEDIED  124

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ER AA L
Sbjct  125  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERGAASL  184

Query  538  CRQM  549
             R +
Sbjct  185  LRTI  188



>ref|XP_003545165.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=529

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  354
             +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D++
Sbjct  58   AIGPVLGRPMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIE  117

Query  355  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  534
            DV+REVQIMHHL+G  NIVEL   YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA 
Sbjct  118  DVKREVQIMHHLSGQPNIVELVNVYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAAS  177

Query  535  LCRQM  549
            L R +
Sbjct  178  LLRTI  182



>gb|KDO62718.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62719.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62720.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=235

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            +LG+P EDV   Y FG ELGRGQFGVTYL T   T  + ACKSI+ RKL++K+D DD++R
Sbjct  69   ILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKNDKDDIKR  128

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  546
            E+QIM HL+G  NIVE KG YED+  VH+VMELCAGGELFDRIIAKGHYSERAAA +CR 
Sbjct  129  EIQIMQHLSGQPNIVEFKGAYEDKQSVHVVMELCAGGELFDRIIAKGHYSERAAASICRS  188

Query  547  M  549
            +
Sbjct  189  I  189



>emb|CAN62888.1| hypothetical protein VITISV_025544 [Vitis vinifera]
Length=540

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGRPMEDV + Y  G ELGRGQFGVT+L T + T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTIAKRKLVNKEDIED  124

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ER AA L
Sbjct  125  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERGAASL  184

Query  538  CRQM  549
             R +
Sbjct  185  LRTI  188



>ref|XP_003564438.1| PREDICTED: calcium-dependent protein kinase 34 [Brachypodium 
distachyon]
Length=514

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 110/159 (69%), Gaps = 21/159 (13%)
 Frame = +1

Query  73   AATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGELGRG  252
            + TSA  ++ PP P                     +G VLGRPMEDV S Y  G ELGRG
Sbjct  30   SPTSAPAQNKPPAP---------------------IGPVLGRPMEDVRSIYTVGKELGRG  68

Query  253  QFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYE  432
            QFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL G  NIVELKG YE
Sbjct  69   QFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHLAGQPNIVELKGAYE  128

Query  433  DRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            D+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L R +
Sbjct  129  DKQSVHLVMELCAGGELFDRIIAKGKYTERAAASLLRTI  167



>ref|XP_008798404.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=525

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = +1

Query  61   SSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGE  240
            ++PF A  A      P P N       +    P    + +G VLGRPMEDV  TY  G E
Sbjct  21   AAPFDAVRASK----PSPHNASPAAAAAATSRPPAKPARIGPVLGRPMEDVRFTYSMGKE  76

Query  241  LGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELK  420
            LGRGQFGVT+  TH+ T E+ ACK+IA RKL++K+D+ DVRREVQIM+HL+G  NIVELK
Sbjct  77   LGRGQFGVTHRCTHKATGEQFACKTIAKRKLVNKEDIQDVRREVQIMYHLSGQPNIVELK  136

Query  421  GTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCR  543
            G YED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L R
Sbjct  137  GAYEDQQSVHLVMELCAGGELFDRIIARGHYTERAAASLLR  177



>gb|KDO62721.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=207

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  187  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  366
            +LG+P EDV   Y FG ELGRGQFGVTYL T   T  + ACKSI+ RKL++K+D DD++R
Sbjct  69   ILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKNDKDDIKR  128

Query  367  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  546
            E+QIM HL+G  NIVE KG YED+  VH+VMELCAGGELFDRIIAKGHYSERAAA +C +
Sbjct  129  EIQIMQHLSGQPNIVEFKGAYEDKQSVHVVMELCAGGELFDRIIAKGHYSERAAASICSK  188



>gb|KJB59358.1| hypothetical protein B456_009G251300 [Gossypium raimondii]
 gb|KJB59360.1| hypothetical protein B456_009G251300 [Gossypium raimondii]
Length=148

 Score =   177 bits (449),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            S   RV  RPMEDV STY+F  ELG GQFG+TYLVTH++T+++ ACKSI++RKL++ +D+
Sbjct  4    SLFNRVFSRPMEDVRSTYVFDRELGYGQFGITYLVTHKETKQQFACKSISSRKLINHNDI  63

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            +DV  EVQIM+HLTGHR+IVELK  YEDR+ V+L++ELC  GELF RII KG+YSE+ AA
Sbjct  64   EDVCCEVQIMYHLTGHRDIVELKAVYEDRHSVNLIIELCVRGELFARIITKGNYSEKEAA  123

Query  532  GLCRQ  546
             LCRQ
Sbjct  124  NLCRQ  128



>ref|XP_002442700.1| hypothetical protein SORBIDRAFT_08g001380 [Sorghum bicolor]
 gb|EES16538.1| hypothetical protein SORBIDRAFT_08g001380 [Sorghum bicolor]
Length=574

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 116/167 (69%), Gaps = 19/167 (11%)
 Frame = +1

Query  49   NSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYI  228
             ++ +SP    ++ G S   PP                     +G VLGRPMEDV + Y 
Sbjct  78   QAVAASPSGGRASTGTSSSKPP-------------------GPLGAVLGRPMEDVRAAYS  118

Query  229  FGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNI  408
             G ELGRGQFGVT+L TH+ + E+LACK+IA RKL +K+DV+DVRREVQIMHHL+G  N+
Sbjct  119  MGKELGRGQFGVTHLCTHKASGEKLACKTIAKRKLATKEDVEDVRREVQIMHHLSGQPNV  178

Query  409  VELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  549
            V L+G YED+++VHLVMELCAGGELFDRIIAKG Y+ERAAA L R +
Sbjct  179  VSLRGAYEDKHNVHLVMELCAGGELFDRIIAKGQYTERAAASLLRTI  225



>ref|XP_008671573.1| PREDICTED: calcium-dependent protein kinase 17-like [Zea mays]
 tpg|DAA39257.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=552

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+LACK+IA RKL +++DV
Sbjct  78   AAVGTVLGRPMEDVRATYSMGKELGRGQFGVTHLCTHRTSGEKLACKTIAKRKLAAREDV  137

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRREVQIMHHL+G  N+V L+G YED+  VHLVMELCAGGELFDRIIA+G Y+ER AA
Sbjct  138  DDVRREVQIMHHLSGQPNVVGLRGAYEDKQSVHLVMELCAGGELFDRIIARGQYTERGAA  197

Query  532  GLCRQM  549
             L R +
Sbjct  198  ELLRAI  203



>gb|KJB35709.1| hypothetical protein B456_006G124800 [Gossypium raimondii]
Length=524

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  357
            +G VLGR MED+ +TY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL +KDD++D
Sbjct  57   IGPVLGRQMEDIKATYNIGKELGRGQFGVTHLCTCKQTGEQFACKTIAKRKLANKDDIED  116

Query  358  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  537
            VRREVQIMHHLTG  NIVELKG YED + ++LVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  117  VRREVQIMHHLTGQANIVELKGAYEDNHSIYLVMELCAGGELFDRIIAKGHYTERAAASL  176

Query  538  CRQM  549
             R +
Sbjct  177  LRTI  180



>ref|XP_002448943.1| hypothetical protein SORBIDRAFT_05g002110 [Sorghum bicolor]
 gb|EES07931.1| hypothetical protein SORBIDRAFT_05g002110 [Sorghum bicolor]
Length=538

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  172  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  351
            + VG VLGRPMEDV  T+  G ELGRGQFGVT+L THR + E+LACK+IA RKL +K+DV
Sbjct  65   AAVGPVLGRPMEDVRDTHSMGKELGRGQFGVTHLCTHRASGEKLACKTIAKRKLATKEDV  124

Query  352  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  531
            DDVRREVQIMHHL+G  N+V L+G YED+  VHLVMELCAGGELFDRIIA+G Y+ER AA
Sbjct  125  DDVRREVQIMHHLSGQPNVVALRGAYEDKQSVHLVMELCAGGELFDRIIARGQYTERGAA  184

Query  532  GLCRQM  549
             L R +
Sbjct  185  ALLRTI  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720