BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016K13

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010091928.1|  putative inactive receptor kinase                  201   8e-57   Morus notabilis
ref|XP_002323813.1|  leucine-rich repeat transmembrane protein ki...    199   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_004233342.1|  PREDICTED: probable inactive receptor kinase...    199   3e-56   Solanum lycopersicum
emb|CDP02178.1|  unnamed protein product                                199   3e-56   Coffea canephora [robusta coffee]
ref|XP_011009041.1|  PREDICTED: probable inactive receptor kinase...    198   7e-56   Populus euphratica
ref|XP_011047296.1|  PREDICTED: probable inactive receptor kinase...    197   9e-56   Populus euphratica
ref|XP_002298520.1|  leucine-rich repeat transmembrane protein ki...    197   9e-56   Populus trichocarpa [western balsam poplar]
gb|KDP45434.1|  hypothetical protein JCGZ_09683                         197   1e-55   Jatropha curcas
ref|XP_006357131.1|  PREDICTED: probable inactive receptor kinase...    196   4e-55   Solanum tuberosum [potatoes]
ref|XP_009617928.1|  PREDICTED: probable inactive receptor kinase...    195   8e-55   Nicotiana tomentosiformis
ref|XP_011098550.1|  PREDICTED: probable inactive receptor kinase...    194   2e-54   Sesamum indicum [beniseed]
gb|EYU34688.1|  hypothetical protein MIMGU_mgv1a026965mg                192   6e-54   Erythranthe guttata [common monkey flower]
ref|XP_003633815.1|  PREDICTED: probable inactive receptor kinase...    193   7e-54   Vitis vinifera
emb|CBI35007.3|  unnamed protein product                                192   7e-54   Vitis vinifera
ref|XP_004232252.1|  PREDICTED: probable inactive receptor kinase...    192   9e-54   Solanum lycopersicum
ref|XP_010033235.1|  PREDICTED: probable inactive receptor kinase...    192   1e-53   Eucalyptus grandis [rose gum]
ref|XP_011085787.1|  PREDICTED: probable inactive receptor kinase...    192   2e-53   Sesamum indicum [beniseed]
gb|KJB40808.1|  hypothetical protein B456_007G077900                    191   4e-53   Gossypium raimondii
ref|XP_002517430.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    191   4e-53   Ricinus communis
gb|KDO72413.1|  hypothetical protein CISIN_1g035917mg                   190   9e-53   Citrus sinensis [apfelsine]
ref|XP_006482508.1|  PREDICTED: probable inactive receptor kinase...    190   9e-53   Citrus sinensis [apfelsine]
gb|KJB11418.1|  hypothetical protein B456_001G257700                    189   1e-52   Gossypium raimondii
gb|KJB33686.1|  hypothetical protein B456_006G026400                    185   1e-52   Gossypium raimondii
ref|XP_006431036.1|  hypothetical protein CICLE_v10011313mg             189   2e-52   Citrus clementina [clementine]
ref|XP_007032365.1|  Leucine-rich repeat protein kinase family pr...    187   6e-52   
ref|XP_006338497.1|  PREDICTED: probable inactive receptor kinase...    187   1e-51   Solanum tuberosum [potatoes]
gb|EYU34129.1|  hypothetical protein MIMGU_mgv1a027001mg                186   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_010528295.1|  PREDICTED: probable inactive receptor kinase...    186   2e-51   Tarenaya hassleriana [spider flower]
gb|EPS58697.1|  hypothetical protein M569_16115                         182   3e-51   Genlisea aurea
ref|XP_004302375.1|  PREDICTED: probable inactive receptor kinase...    183   2e-50   Fragaria vesca subsp. vesca
ref|XP_010684872.1|  PREDICTED: probable inactive receptor kinase...    182   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010272145.1|  PREDICTED: probable inactive receptor kinase...    181   9e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009620632.1|  PREDICTED: probable inactive receptor kinase...    178   1e-48   Nicotiana tomentosiformis
ref|NP_189486.1|  leucine-rich repeat protein kinase-like protein       177   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33740.1|  hypothetical protein AALP_AA5G053600                    177   3e-48   Arabis alpina [alpine rockcress]
ref|XP_008389562.1|  PREDICTED: probable inactive receptor kinase...    177   4e-48   Malus domestica [apple tree]
ref|XP_002875454.1|  hypothetical protein ARALYDRAFT_484619             176   4e-48   
ref|XP_006290709.1|  hypothetical protein CARUB_v10016807mg             177   5e-48   
ref|XP_009335793.1|  PREDICTED: probable inactive receptor kinase...    176   5e-48   Pyrus x bretschneideri [bai li]
emb|CDY04020.1|  BnaC02g37350D                                          176   6e-48   
ref|XP_008361793.1|  PREDICTED: probable inactive receptor kinase...    176   6e-48   
ref|XP_008379313.1|  PREDICTED: probable inactive receptor kinase...    176   7e-48   
ref|XP_009759220.1|  PREDICTED: probable inactive receptor kinase...    176   8e-48   Nicotiana sylvestris
ref|XP_010514548.1|  PREDICTED: probable inactive receptor kinase...    176   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010425626.1|  PREDICTED: probable inactive receptor kinase...    176   1e-47   Camelina sativa [gold-of-pleasure]
gb|KDO82668.1|  hypothetical protein CISIN_1g007423mg                   175   2e-47   Citrus sinensis [apfelsine]
ref|XP_006395364.1|  hypothetical protein EUTSA_v10003844mg             175   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010502845.1|  PREDICTED: probable inactive receptor kinase...    175   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008341508.1|  PREDICTED: probable inactive receptor kinase...    175   2e-47   
ref|XP_009129373.1|  PREDICTED: probable inactive receptor kinase...    174   3e-47   Brassica rapa
emb|CDY47244.1|  BnaA02g29300D                                          174   3e-47   Brassica napus [oilseed rape]
ref|XP_009360430.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    174   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_006438525.1|  hypothetical protein CICLE_v10030999mg             174   6e-47   Citrus clementina [clementine]
ref|XP_010043841.1|  PREDICTED: probable inactive receptor kinase...    173   1e-46   Eucalyptus grandis [rose gum]
ref|XP_008221489.1|  PREDICTED: probable inactive receptor kinase...    173   1e-46   Prunus mume [ume]
emb|CDX86433.1|  BnaA06g31500D                                          172   1e-46   
ref|XP_007151169.1|  hypothetical protein PHAVU_004G023700g             172   2e-46   Phaseolus vulgaris [French bean]
ref|XP_009151873.1|  PREDICTED: probable inactive receptor kinase...    172   2e-46   Brassica rapa
ref|XP_007222048.1|  hypothetical protein PRUPE_ppa003089mg             172   2e-46   Prunus persica
gb|KFK44612.1|  hypothetical protein AALP_AA1G281300                    172   3e-46   Arabis alpina [alpine rockcress]
ref|XP_008353487.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    172   3e-46   
ref|XP_008230695.1|  PREDICTED: probable inactive receptor kinase...    171   5e-46   Prunus mume [ume]
ref|XP_002305238.2|  leucine-rich repeat transmembrane protein ki...    171   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010477749.1|  PREDICTED: probable inactive receptor kinase...    171   7e-46   Camelina sativa [gold-of-pleasure]
emb|CDY14686.1|  BnaC05g19430D                                          171   8e-46   Brassica napus [oilseed rape]
ref|XP_009115452.1|  PREDICTED: probable inactive receptor kinase...    171   8e-46   Brassica rapa
ref|XP_006357223.1|  PREDICTED: probable inactive receptor kinase...    170   1e-45   Solanum tuberosum [potatoes]
emb|CDY16228.1|  BnaA09g29620D                                          170   1e-45   Brassica napus [oilseed rape]
ref|XP_006303937.1|  hypothetical protein CARUB_v10008631mg             170   1e-45   Capsella rubella
ref|XP_010498954.1|  PREDICTED: probable inactive receptor kinase...    169   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007216971.1|  hypothetical protein PRUPE_ppa003100mg             169   2e-45   Prunus persica
ref|XP_002890616.1|  hypothetical protein ARALYDRAFT_889992             169   2e-45   Arabidopsis lyrata subsp. lyrata
ref|NP_174039.1|  leucine-rich repeat protein kinase family protein     169   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416011.1|  hypothetical protein EUTSA_v10009684mg             169   3e-45   Eutrema salsugineum [saltwater cress]
ref|XP_004298597.1|  PREDICTED: probable inactive receptor kinase...    169   4e-45   Fragaria vesca subsp. vesca
ref|XP_010460207.1|  PREDICTED: probable inactive receptor kinase...    168   4e-45   Camelina sativa [gold-of-pleasure]
gb|KDO72412.1|  hypothetical protein CISIN_1g040267mg                   167   6e-45   Citrus sinensis [apfelsine]
ref|XP_004148679.1|  PREDICTED: probable inactive receptor kinase...    167   1e-44   Cucumis sativus [cucumbers]
ref|XP_008800372.1|  PREDICTED: probable inactive receptor kinase...    167   1e-44   Phoenix dactylifera
ref|XP_008458707.1|  PREDICTED: probable inactive receptor kinase...    167   2e-44   Cucumis melo [Oriental melon]
ref|XP_010683354.1|  PREDICTED: probable inactive receptor kinase...    166   2e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21268.1|  hypothetical protein JCGZ_21739                         166   3e-44   Jatropha curcas
ref|XP_006849112.1|  hypothetical protein AMTR_s00028p00246730          166   3e-44   Amborella trichopoda
ref|XP_009602624.1|  PREDICTED: probable inactive receptor kinase...    165   7e-44   Nicotiana tomentosiformis
ref|XP_009799074.1|  PREDICTED: probable inactive receptor kinase...    165   7e-44   Nicotiana sylvestris
ref|XP_011043889.1|  PREDICTED: probable inactive receptor kinase...    165   8e-44   Populus euphratica
ref|XP_006372487.1|  leucine-rich repeat transmembrane protein ki...    164   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006595242.1|  PREDICTED: probable inactive receptor kinase...    156   3e-43   Glycine max [soybeans]
gb|ABR16721.1|  unknown                                                 163   3e-43   Picea sitchensis
ref|XP_004238738.1|  PREDICTED: probable inactive receptor kinase...    163   4e-43   Solanum lycopersicum
ref|XP_009105677.1|  PREDICTED: probable LRR receptor-like serine...    162   5e-43   Brassica rapa
ref|XP_011038318.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   Populus euphratica
ref|XP_003580015.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_004489358.1|  PREDICTED: probable inactive receptor kinase...    161   2e-42   Cicer arietinum [garbanzo]
gb|KFK41423.1|  hypothetical protein AALP_AA2G128900                    161   2e-42   Arabis alpina [alpine rockcress]
gb|KHN34180.1|  Putative inactive receptor kinase                       161   2e-42   Glycine soja [wild soybean]
ref|NP_177157.1|  putative LRR receptor-like serine/threonine-pro...    160   2e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38780.1|  BnaA07g28520D                                          160   3e-42   Brassica napus [oilseed rape]
ref|XP_010912844.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    160   4e-42   
gb|KHN13260.1|  Putative inactive receptor kinase                       159   6e-42   Glycine soja [wild soybean]
ref|XP_009342387.1|  PREDICTED: probably inactive leucine-rich re...    151   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_002268171.1|  PREDICTED: probable inactive receptor kinase...    158   2e-41   Vitis vinifera
ref|XP_007044441.1|  Leucine-rich repeat protein kinase family pr...    158   2e-41   
ref|NP_001174416.1|  Os05g0399800                                       151   6e-41   
ref|XP_003618423.1|  LRR receptor-like serine/threonine-protein k...    156   9e-41   Medicago truncatula
ref|XP_002888749.1|  hypothetical protein ARALYDRAFT_894788             156   1e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010415671.1|  PREDICTED: probable LRR receptor-like serine...    155   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007151168.1|  hypothetical protein PHAVU_004G023600g             150   2e-40   Phaseolus vulgaris [French bean]
gb|EAY97968.1|  hypothetical protein OsI_19886                          150   2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_009385796.1|  PREDICTED: probable inactive receptor kinase...    154   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009600980.1|  PREDICTED: probably inactive leucine-rich re...    154   4e-40   Nicotiana tomentosiformis
ref|XP_010098246.1|  putative inactive receptor kinase                  154   6e-40   
ref|XP_002446698.1|  hypothetical protein SORBIDRAFT_06g020750          153   1e-39   Sorghum bicolor [broomcorn]
gb|ABR16056.1|  unknown                                                 152   2e-39   Picea sitchensis
ref|XP_010532925.1|  PREDICTED: probable inactive receptor kinase...    151   8e-39   Tarenaya hassleriana [spider flower]
ref|XP_006653547.1|  PREDICTED: probable inactive receptor kinase...    150   1e-38   Oryza brachyantha
gb|AEW22944.1|  leucine-rich repeat receptor-like protein kinase        149   4e-38   Cenchrus ciliaris [African foxtail grass]
ref|XP_010551471.1|  PREDICTED: probable inactive receptor kinase...    149   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_010109951.1|  Probably inactive leucine-rich repeat recept...    144   5e-38   
ref|XP_009406402.1|  PREDICTED: probable inactive receptor kinase...    148   8e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008669246.1|  PREDICTED: probable inactive receptor kinase...    148   1e-37   Zea mays [maize]
dbj|BAK03355.1|  predicted protein                                      147   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB31374.1|  hypothetical protein B456_005G188100                    147   2e-37   Gossypium raimondii
gb|AGI92776.1|  RLP1.801.4                                              142   2e-37   Triticum aestivum [Canadian hard winter wheat]
gb|AFW58657.1|  putative leucine-rich repeat transmembrane protei...    147   2e-37   
emb|CDY11627.1|  BnaC06g31120D                                          146   3e-37   Brassica napus [oilseed rape]
ref|NP_001053144.1|  Os04g0487200                                       145   6e-37   
ref|XP_004492888.1|  PREDICTED: probably inactive leucine-rich re...    145   8e-37   
ref|XP_007213020.1|  hypothetical protein PRUPE_ppa023044mg             136   2e-36   
gb|AES90509.2|  LRR receptor-like kinase family protein, putative       144   2e-36   Medicago truncatula
ref|XP_003608312.1|  Receptor-like-kinase                               144   2e-36   
dbj|BAI94492.1|  receptor-like kinase                                   144   3e-36   Dianthus caryophyllus [carnation]
ref|XP_011089586.1|  PREDICTED: probably inactive leucine-rich re...    143   3e-36   Sesamum indicum [beniseed]
ref|XP_007028124.1|  BAK1-interacting receptor-like kinase 1 isof...    143   4e-36   Theobroma cacao [chocolate]
ref|XP_006584947.1|  PREDICTED: probably inactive leucine-rich re...    143   4e-36   
gb|EYU46077.1|  hypothetical protein MIMGU_mgv1a002955mg                143   4e-36   Erythranthe guttata [common monkey flower]
gb|KJB75784.1|  hypothetical protein B456_012G058000                    142   5e-36   Gossypium raimondii
ref|XP_010242455.1|  PREDICTED: probably inactive leucine-rich re...    143   6e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006342429.1|  PREDICTED: probably inactive leucine-rich re...    142   6e-36   Solanum tuberosum [potatoes]
gb|AGI92774.1|  RLP1.801.2                                              138   7e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003534491.1|  PREDICTED: probably inactive leucine-rich re...    142   7e-36   Glycine max [soybeans]
ref|XP_010471000.1|  PREDICTED: probable LRR receptor-like serine...    142   7e-36   Camelina sativa [gold-of-pleasure]
gb|KHN22142.1|  Probably inactive leucine-rich repeat receptor-li...    142   7e-36   Glycine soja [wild soybean]
gb|AGI92775.1|  RLP1.801.3                                              138   8e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AGI92772.1|  RLP1.1                                                  138   8e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AGI92777.1|  RLP1.801.5                                              138   8e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009784192.1|  PREDICTED: probably inactive leucine-rich re...    142   9e-36   Nicotiana sylvestris
ref|XP_006301045.1|  hypothetical protein CARUB_v10021437mg             142   1e-35   Capsella rubella
ref|XP_002267164.2|  PREDICTED: probably inactive leucine-rich re...    142   1e-35   Vitis vinifera
emb|CBI23354.3|  unnamed protein product                                142   1e-35   Vitis vinifera
ref|XP_010547175.1|  PREDICTED: probably inactive leucine-rich re...    142   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_007134301.1|  hypothetical protein PHAVU_010G035800g             142   1e-35   Phaseolus vulgaris [French bean]
ref|XP_010242501.1|  PREDICTED: probably inactive leucine-rich re...    138   2e-35   
ref|XP_008356285.1|  PREDICTED: probably inactive leucine-rich re...    137   2e-35   
ref|XP_010512071.1|  PREDICTED: probable LRR receptor-like serine...    141   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006390935.1|  hypothetical protein EUTSA_v10018330mg             141   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_004510191.1|  PREDICTED: probably inactive leucine-rich re...    141   2e-35   Cicer arietinum [garbanzo]
ref|XP_009615340.1|  PREDICTED: probably inactive leucine-rich re...    140   3e-35   
ref|XP_002527290.1|  ATP binding protein, putative                      137   4e-35   
ref|XP_010911215.1|  PREDICTED: probably inactive leucine-rich re...    140   5e-35   Elaeis guineensis
ref|XP_009619663.1|  PREDICTED: probably inactive leucine-rich re...    140   5e-35   Nicotiana tomentosiformis
ref|XP_010101366.1|  Probably inactive leucine-rich repeat recept...    143   5e-35   
ref|XP_010088605.1|  Probably inactive leucine-rich repeat recept...    140   6e-35   Morus notabilis
ref|XP_007139688.1|  hypothetical protein PHAVU_008G050700g             140   7e-35   Phaseolus vulgaris [French bean]
gb|KDP45204.1|  hypothetical protein JCGZ_15069                         134   8e-35   Jatropha curcas
ref|XP_006601824.1|  PREDICTED: probably inactive leucine-rich re...    140   8e-35   Glycine max [soybeans]
ref|XP_010053967.1|  PREDICTED: probably inactive leucine-rich re...    134   8e-35   Eucalyptus grandis [rose gum]
gb|KHN40510.1|  Probably inactive leucine-rich repeat receptor-li...    139   9e-35   Glycine soja [wild soybean]
ref|XP_009406423.1|  PREDICTED: probably inactive leucine-rich re...    139   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343705.1|  PREDICTED: probably inactive leucine-rich re...    135   9e-35   
emb|CDP03993.1|  unnamed protein product                                139   1e-34   Coffea canephora [robusta coffee]
ref|XP_010673854.1|  PREDICTED: probably inactive leucine-rich re...    139   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010053969.1|  PREDICTED: probably inactive leucine-rich re...    133   1e-34   Eucalyptus grandis [rose gum]
ref|XP_009767841.1|  PREDICTED: probably inactive leucine-rich re...    139   1e-34   Nicotiana sylvestris
ref|XP_010679004.1|  PREDICTED: probably inactive leucine-rich re...    139   2e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT19838.1|  Putative LRR receptor-like serine/threonine-prote...    134   2e-34   
ref|XP_009406422.1|  PREDICTED: probably inactive leucine-rich re...    139   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001239701.1|  probably inactive leucine-rich repeat recept...    137   3e-34   Glycine max [soybeans]
ref|XP_006372662.1|  hypothetical protein POPTR_0017s036502g            135   3e-34   
ref|XP_007159203.1|  hypothetical protein PHAVU_002G217900g             138   3e-34   Phaseolus vulgaris [French bean]
ref|XP_009799665.1|  PREDICTED: probably inactive leucine-rich re...    138   4e-34   Nicotiana sylvestris
gb|KJB10818.1|  hypothetical protein B456_001G226700                    138   4e-34   Gossypium raimondii
ref|XP_003624238.1|  Probably inactive leucine-rich repeat recept...    137   4e-34   Medicago truncatula
ref|XP_006366814.1|  PREDICTED: probably inactive leucine-rich re...    137   5e-34   Solanum tuberosum [potatoes]
ref|XP_010314784.1|  PREDICTED: probably inactive leucine-rich re...    137   5e-34   
ref|XP_010314785.1|  PREDICTED: probably inactive leucine-rich re...    137   5e-34   
ref|XP_004253035.2|  PREDICTED: probably inactive leucine-rich re...    137   5e-34   
ref|XP_010037082.1|  PREDICTED: probably inactive leucine-rich re...    137   6e-34   Eucalyptus grandis [rose gum]
ref|XP_010314786.1|  PREDICTED: probably inactive leucine-rich re...    137   6e-34   
ref|XP_010251401.1|  PREDICTED: probably inactive leucine-rich re...    137   8e-34   Nelumbo nucifera [Indian lotus]
gb|KFK25890.1|  hypothetical protein AALP_AA8G175500                    132   8e-34   Arabis alpina [alpine rockcress]
ref|XP_006372658.1|  hypothetical protein POPTR_0017s036302g            131   8e-34   
ref|XP_006372665.1|  hypothetical protein POPTR_0017s03660g             136   9e-34   
ref|XP_006372666.1|  hypothetical protein POPTR_0017s03660g             136   1e-33   
ref|XP_009416988.1|  PREDICTED: probably inactive leucine-rich re...    136   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006378629.1|  hypothetical protein POPTR_0010s18540g             136   1e-33   
gb|AGI92778.1|  RLP1.804.1                                              132   1e-33   Triticum aestivum [Canadian hard winter wheat]
gb|EMS46984.1|  hypothetical protein TRIUR3_06204                       132   2e-33   Triticum urartu
emb|CDY07991.1|  BnaC03g35320D                                          131   2e-33   Brassica napus [oilseed rape]
ref|XP_011004566.1|  PREDICTED: probably inactive leucine-rich re...    136   2e-33   Populus euphratica
gb|KEH18041.1|  LRR receptor-like kinase                                135   2e-33   Medicago truncatula
dbj|BAJ86446.1|  predicted protein                                      135   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001238083.1|  protein kinase precursor                           135   3e-33   Glycine max [soybeans]
ref|XP_010908584.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-33   Elaeis guineensis
ref|XP_007049531.1|  Probably inactive leucine-rich repeat recept...    135   3e-33   
ref|XP_008788252.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-33   Phoenix dactylifera
gb|KDP33138.1|  hypothetical protein JCGZ_13530                         135   3e-33   Jatropha curcas
gb|KDO37775.1|  hypothetical protein CISIN_1g042065mg                   129   3e-33   Citrus sinensis [apfelsine]
ref|XP_004242451.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-33   Solanum lycopersicum
ref|XP_006598679.1|  PREDICTED: protein kinase isoform X1               135   4e-33   Glycine max [soybeans]
emb|CDX70708.1|  BnaC03g07920D                                          133   4e-33   
ref|XP_011010442.1|  PREDICTED: probably inactive leucine-rich re...    134   6e-33   Populus euphratica
gb|EMT17156.1|  Putative LRR receptor-like serine/threonine-prote...    130   6e-33   
gb|EMT26982.1|  Putative inactive receptor kinase                       134   7e-33   
dbj|BAJ87832.1|  predicted protein                                      130   9e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010095584.1|  Probably inactive leucine-rich repeat recept...    134   9e-33   
ref|XP_006828241.1|  hypothetical protein AMTR_s00023p00191140          128   9e-33   Amborella trichopoda
gb|AGI92779.1|  RLP1.804.2                                              129   1e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004161544.1|  PREDICTED: probably inactive leucine-rich re...    128   1e-32   
emb|CBI23562.3|  unnamed protein product                                133   1e-32   Vitis vinifera
ref|XP_011013756.1|  PREDICTED: probably inactive leucine-rich re...    133   2e-32   Populus euphratica
ref|XP_004161543.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    133   2e-32   
ref|XP_003635622.1|  PREDICTED: probably inactive leucine-rich re...    133   2e-32   Vitis vinifera
ref|XP_004148961.1|  PREDICTED: probably inactive leucine-rich re...    128   2e-32   
ref|XP_007200419.1|  hypothetical protein PRUPE_ppa011049mg             127   2e-32   Prunus persica
ref|XP_009124570.1|  PREDICTED: probably inactive leucine-rich re...    128   2e-32   Brassica rapa
emb|CDM85413.1|  unnamed protein product                                129   3e-32   Triticum aestivum [Canadian hard winter wheat]
gb|KDO43522.1|  hypothetical protein CISIN_1g006982mg                   133   3e-32   Citrus sinensis [apfelsine]
ref|XP_006447934.1|  hypothetical protein CICLE_v10014610mg             133   3e-32   Citrus clementina [clementine]
ref|XP_008447262.1|  PREDICTED: probably inactive leucine-rich re...    132   3e-32   Cucumis melo [Oriental melon]
gb|KGN44709.1|  hypothetical protein Csa_7G373520                       127   3e-32   Cucumis sativus [cucumbers]
ref|XP_009132248.1|  PREDICTED: probably inactive leucine-rich re...    128   3e-32   Brassica rapa
emb|CDY05685.1|  BnaC02g38520D                                          132   3e-32   
ref|XP_008382758.1|  PREDICTED: probably inactive leucine-rich re...    126   4e-32   
ref|XP_004148962.1|  PREDICTED: probably inactive leucine-rich re...    132   4e-32   Cucumis sativus [cucumbers]
emb|CAN63265.1|  hypothetical protein VITISV_037939                     132   5e-32   Vitis vinifera
gb|KJB42638.1|  hypothetical protein B456_007G161400                    132   5e-32   Gossypium raimondii
dbj|BAJ33754.1|  unnamed protein product                                132   5e-32   Eutrema halophilum
ref|XP_008779573.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    132   6e-32   
ref|XP_002450551.1|  hypothetical protein SORBIDRAFT_05g006860          132   6e-32   Sorghum bicolor [broomcorn]
ref|NP_001143239.1|  uncharacterized protein LOC100275764 precursor     130   9e-32   
ref|XP_009132249.1|  PREDICTED: probably inactive leucine-rich re...    126   1e-31   Brassica rapa
ref|XP_006395190.1|  hypothetical protein EUTSA_v10003825mg             131   1e-31   
ref|XP_004250582.1|  PREDICTED: F-box protein At3g07870-like            130   1e-31   
ref|XP_007200215.1|  hypothetical protein PRUPE_ppa015531mg             126   1e-31   
ref|XP_008235929.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-31   
ref|XP_006379646.1|  hypothetical protein POPTR_0008s07830g             130   2e-31   
gb|EMT01778.1|  Putative LRR receptor-like serine/threonine-prote...    127   2e-31   
emb|CDY48749.1|  BnaA02g30100D                                          130   2e-31   Brassica napus [oilseed rape]
ref|XP_006372679.1|  hypothetical protein POPTR_0017s03800g             129   2e-31   
ref|XP_008801014.1|  PREDICTED: probably inactive leucine-rich re...    130   2e-31   Phoenix dactylifera
ref|XP_004305754.2|  PREDICTED: probably inactive leucine-rich re...    130   4e-31   Fragaria vesca subsp. vesca
ref|XP_009151638.1|  PREDICTED: probably inactive leucine-rich re...    130   4e-31   Brassica rapa
ref|XP_009607588.1|  PREDICTED: probably inactive leucine-rich re...    129   4e-31   Nicotiana tomentosiformis
emb|CDY38095.1|  BnaC02g06780D                                          125   4e-31   Brassica napus [oilseed rape]
ref|XP_006400208.1|  hypothetical protein EUTSA_v10015945mg             125   4e-31   
ref|XP_002529807.1|  serine-threonine protein kinase, plant-type,...    129   4e-31   
ref|XP_008372669.1|  PREDICTED: probably inactive leucine-rich re...    129   4e-31   
ref|XP_008356275.1|  PREDICTED: probably inactive leucine-rich re...    129   5e-31   
ref|XP_008382757.1|  PREDICTED: probably inactive leucine-rich re...    126   5e-31   
emb|CDY38092.1|  BnaC02g06810D                                          125   5e-31   Brassica napus [oilseed rape]
ref|XP_009342403.1|  PREDICTED: probably inactive leucine-rich re...    125   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_010037095.1|  PREDICTED: probably inactive leucine-rich re...    128   7e-31   Eucalyptus grandis [rose gum]
ref|XP_009342388.1|  PREDICTED: probably inactive leucine-rich re...    129   8e-31   Pyrus x bretschneideri [bai li]
gb|AGI92780.1|  RLP1.804.3                                              125   8e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006343706.1|  PREDICTED: probably inactive leucine-rich re...    127   8e-31   
ref|XP_008235867.1|  PREDICTED: probably inactive leucine-rich re...    123   1e-30   
emb|CDM85411.1|  unnamed protein product                                124   1e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008235927.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-30   
ref|XP_009126335.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-30   Brassica rapa
ref|XP_010456552.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002441100.1|  hypothetical protein SORBIDRAFT_09g020410          128   1e-30   Sorghum bicolor [broomcorn]
ref|XP_004290111.1|  PREDICTED: probably inactive leucine-rich re...    128   2e-30   Fragaria vesca subsp. vesca
gb|ACN26668.1|  unknown                                                 127   2e-30   Zea mays [maize]
ref|XP_010424129.1|  PREDICTED: probably inactive leucine-rich re...    124   2e-30   Camelina sativa [gold-of-pleasure]
gb|AFW78014.1|  putative leucine-rich repeat transmembrane protei...    128   2e-30   
ref|XP_006280968.1|  hypothetical protein CARUB_v10026969mg             124   2e-30   
ref|XP_006356492.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-30   Solanum tuberosum [potatoes]
ref|XP_009595674.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-30   Nicotiana tomentosiformis
ref|XP_008382538.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-30   
ref|XP_008359394.1|  PREDICTED: probable inactive receptor kinase...    122   2e-30   
emb|CDP06295.1|  unnamed protein product                                126   3e-30   
emb|CDX85334.1|  BnaC07g26450D                                          127   3e-30   
ref|NP_001147794.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    127   4e-30   
ref|XP_006654407.1|  PREDICTED: probably inactive leucine-rich re...    126   4e-30   
ref|XP_009129721.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    127   5e-30   
gb|KDP45203.1|  hypothetical protein JCGZ_15068                         127   5e-30   
gb|AGI92781.1|  RLP1.804.4                                              122   5e-30   
ref|XP_011015307.1|  PREDICTED: probably inactive leucine-rich re...    126   5e-30   
ref|XP_011015926.1|  PREDICTED: probably inactive leucine-rich re...    127   5e-30   
ref|XP_004242658.1|  PREDICTED: probably inactive leucine-rich re...    126   6e-30   
ref|XP_007199029.1|  hypothetical protein PRUPE_ppa017910mg             122   6e-30   
gb|EEC79229.1|  hypothetical protein OsI_19968                          127   6e-30   
ref|XP_011024726.1|  PREDICTED: probably inactive leucine-rich re...    126   7e-30   
ref|XP_009358936.1|  PREDICTED: probably inactive leucine-rich re...    126   7e-30   
ref|XP_008235928.1|  PREDICTED: probably inactive leucine-rich re...    121   8e-30   
ref|XP_006386865.1|  hypothetical protein POPTR_0002s24100g             126   8e-30   
ref|XP_009134974.1|  PREDICTED: probably inactive leucine-rich re...    122   9e-30   
ref|XP_006343707.1|  PREDICTED: probably inactive leucine-rich re...    124   2e-29   
gb|ACN31332.1|  unknown                                                 125   2e-29   
ref|XP_008235868.1|  PREDICTED: probably inactive leucine-rich re...    125   2e-29   
ref|XP_002962193.1|  hypothetical protein SELMODRAFT_77054              125   2e-29   
ref|XP_010493653.1|  PREDICTED: probably inactive leucine-rich re...    119   3e-29   
gb|AGI92782.1|  RLP1.813                                                120   3e-29   
ref|XP_007201733.1|  hypothetical protein PRUPE_ppa002865mg             124   3e-29   
gb|KJB40809.1|  hypothetical protein B456_007G077900                    124   3e-29   
ref|XP_002965106.1|  hypothetical protein SELMODRAFT_83773              125   3e-29   
ref|XP_002865632.1|  hypothetical protein ARALYDRAFT_357041             120   4e-29   
gb|AAB61113.1|  Similar to Arabidopsis receptor-like protein kina...    123   4e-29   
ref|XP_002865631.1|  hypothetical protein ARALYDRAFT_494891             124   5e-29   
ref|NP_568696.1|  BAK1-interacting receptor-like kinase BIR1            123   8e-29   
gb|AAL32637.1|  receptor-like protein kinase                            123   8e-29   
gb|AAN60365.1|  unknown                                                 123   8e-29   
dbj|BAA96958.1|  receptor-like protein kinase                           123   9e-29   
gb|AAT94042.1|  putative protein kinase                                 123   9e-29   
ref|NP_001055553.2|  Os05g0414700                                       123   9e-29   
ref|XP_010525273.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-28   
ref|XP_003532578.2|  PREDICTED: probably inactive leucine-rich re...    122   1e-28   
ref|XP_010495233.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-28   
ref|XP_003568447.1|  PREDICTED: probably inactive leucine-rich re...    122   2e-28   
ref|XP_006645152.1|  PREDICTED: probably inactive leucine-rich re...    118   3e-28   
ref|XP_006448523.1|  hypothetical protein CICLE_v10014622mg             122   3e-28   
ref|XP_006280190.1|  hypothetical protein CARUB_v10026094mg             121   5e-28   
ref|XP_006858332.1|  hypothetical protein AMTR_s00064p00147190          120   6e-28   
ref|XP_006468634.1|  PREDICTED: probably inactive leucine-rich re...    120   6e-28   
emb|CDM85370.1|  unnamed protein product                                116   8e-28   
ref|NP_001045059.1|  Os01g0892300                                       116   1e-27   
ref|XP_004962081.1|  PREDICTED: probably inactive leucine-rich re...    120   1e-27   
ref|XP_006372671.1|  hypothetical protein POPTR_0017s03710g             120   1e-27   
ref|XP_011004567.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-27   
emb|CDM85405.1|  unnamed protein product                                117   1e-27   
ref|XP_007200186.1|  hypothetical protein PRUPE_ppa016209mg             117   1e-27   
gb|EMT17153.1|  Putative LRR receptor-like serine/threonine-prote...    114   2e-27   
gb|EMT24743.1|  Putative inactive receptor kinase                       114   3e-27   
gb|KDP33141.1|  hypothetical protein JCGZ_13533                         115   3e-27   
ref|XP_011467436.1|  PREDICTED: probably inactive leucine-rich re...    118   3e-27   
ref|XP_004970860.1|  PREDICTED: probably inactive leucine-rich re...    114   4e-27   
gb|AGI92773.1|  RLP1.738                                                114   4e-27   
gb|EMT06892.1|  Putative LRR receptor-like serine/threonine-prote...    114   5e-27   
ref|XP_011459718.1|  PREDICTED: probably inactive leucine-rich re...    112   6e-27   
ref|XP_010442258.1|  PREDICTED: probably inactive leucine-rich re...    114   8e-27   
ref|XP_002980343.1|  hypothetical protein SELMODRAFT_112289             117   8e-27   
ref|XP_011013757.1|  PREDICTED: probably inactive leucine-rich re...    117   9e-27   
ref|XP_001774216.1|  predicted protein                                  117   9e-27   
emb|CBI24746.3|  unnamed protein product                                113   2e-26   
tpg|DAA41892.1|  TPA: putative leucine-rich repeat transmembrane ...    116   2e-26   
ref|NP_001151988.1|  brassinosteroid LRR receptor kinase precursor      116   2e-26   
ref|XP_002962989.1|  hypothetical protein SELMODRAFT_165616             115   5e-26   
ref|XP_010493657.1|  PREDICTED: probably inactive leucine-rich re...    115   5e-26   
gb|EMT18343.1|  Putative inactive receptor kinase                       113   6e-26   
gb|EMT29216.1|  Putative inactive receptor kinase                       115   7e-26   
gb|EMT18342.1|  Putative LRR receptor-like serine/threonine-prote...    111   8e-26   
ref|XP_004978965.1|  PREDICTED: probably inactive leucine-rich re...    114   9e-26   
ref|XP_002275677.1|  PREDICTED: probably inactive leucine-rich re...    114   1e-25   
gb|EMT17157.1|  Putative LRR receptor-like serine/threonine-prote...    110   2e-25   
ref|XP_010482086.1|  PREDICTED: probably inactive leucine-rich re...    114   2e-25   
ref|XP_002456769.1|  hypothetical protein SORBIDRAFT_03g042370          110   2e-25   
ref|XP_006387318.1|  hypothetical protein POPTR_1276s002001g            108   2e-25   
ref|XP_002315108.2|  hypothetical protein POPTR_0010s18550g             113   2e-25   
gb|EAY76795.1|  hypothetical protein OsI_04752                          111   3e-25   
gb|EMT09681.1|  Putative inactive receptor kinase                       107   4e-25   
ref|XP_006662858.1|  PREDICTED: probably inactive leucine-rich re...    113   4e-25   
ref|XP_006372284.1|  hypothetical protein POPTR_0017s00200g             110   5e-25   
ref|XP_002962990.1|  hypothetical protein SELMODRAFT_404473             108   5e-25   
ref|NP_001045057.1|  Os01g0891700                                       109   5e-25   
ref|XP_008673646.1|  PREDICTED: probably inactive leucine-rich re...    108   6e-25   
ref|NP_001045056.2|  Os01g0891500                                       108   6e-25   
ref|XP_003577638.1|  PREDICTED: probably inactive leucine-rich re...    112   6e-25   
gb|AAX95167.1|  receptor-like protein kinase                            111   1e-24   
gb|EAZ17993.1|  hypothetical protein OsJ_33541                          111   1e-24   
ref|XP_006288478.1|  hypothetical protein CARUB_v10001738mg             106   4e-24   
ref|XP_001776665.1|  predicted protein                                  108   1e-23   
emb|CAN68144.1|  hypothetical protein VITISV_035661                     108   2e-23   
ref|XP_002967283.1|  hypothetical protein SELMODRAFT_87671              108   2e-23   
ref|XP_002529809.1|  serine-threonine protein kinase, plant-type,...    107   3e-23   
ref|XP_002960437.1|  hypothetical protein SELMODRAFT_164132             107   4e-23   
emb|CDX69430.1|  BnaA10g17790D                                          103   6e-23   
gb|EMT17152.1|  Putative inactive receptor kinase                       100   7e-23   
ref|XP_003608311.1|  LRR receptor-like protein kinase                   105   1e-22   
ref|XP_002962585.1|  hypothetical protein SELMODRAFT_26690              101   1e-22   
dbj|BAF79937.1|  receptor-like kinase                                   106   1e-22   
ref|XP_009122865.1|  PREDICTED: probably inactive leucine-rich re...    102   1e-22   
ref|XP_002980502.1|  hypothetical protein SELMODRAFT_16597            99.8    3e-22   
ref|XP_010482085.1|  PREDICTED: probably inactive leucine-rich re...    101   3e-22   
ref|XP_011010589.1|  PREDICTED: probably inactive leucine-rich re...    103   7e-22   
gb|KCW65553.1|  hypothetical protein EUGRSUZ_G02950                   97.8    5e-21   
gb|EEE55789.1|  hypothetical protein OsJ_04371                        99.4    6e-21   
gb|EEC71938.1|  hypothetical protein OsI_04750                        98.6    1e-20   
ref|XP_001751680.1|  predicted protein                                  100   1e-20   
ref|XP_006379647.1|  hypothetical protein POPTR_0008s07830g           99.4    2e-20   
ref|XP_010463652.1|  PREDICTED: probable inactive receptor kinase...  96.7    2e-20   
gb|ABK22665.1|  unknown                                               96.3    4e-20   
ref|XP_004978090.1|  PREDICTED: probable inactive receptor kinase...  98.6    4e-20   
ref|XP_010484431.1|  PREDICTED: probable LRR receptor-like serine...  95.5    5e-20   
ref|XP_009411327.1|  PREDICTED: probable inactive receptor kinase...  95.1    9e-20   
ref|XP_010650777.1|  PREDICTED: probably inactive leucine-rich re...  97.4    1e-19   
emb|CBI32063.3|  unnamed protein product                              95.5    1e-19   
ref|XP_002980342.1|  hypothetical protein SELMODRAFT_112687           93.6    1e-19   
ref|XP_006393981.1|  hypothetical protein EUTSA_v10005320mg           94.4    1e-19   
ref|XP_006291633.1|  hypothetical protein CARUB_v10017786mg           94.4    1e-19   
gb|EMT26063.1|  Putative LRR receptor-like serine/threonine-prote...  92.4    1e-19   
ref|XP_009394292.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    2e-19   
ref|XP_010493656.1|  PREDICTED: probably inactive leucine-rich re...  90.9    3e-19   
ref|XP_010515338.1|  PREDICTED: probable inactive receptor kinase...  92.4    6e-19   
ref|XP_010232678.1|  PREDICTED: probable inactive receptor kinase...  92.4    6e-19   
gb|EYU41369.1|  hypothetical protein MIMGU_mgv1a011773mg              92.0    7e-19   
ref|XP_007148302.1|  hypothetical protein PHAVU_006G197000g           94.7    8e-19   
ref|XP_006404105.1|  hypothetical protein EUTSA_v10010947mg           92.4    1e-18   
ref|XP_010503642.1|  PREDICTED: probable inactive receptor kinase...  91.7    1e-18   
ref|XP_006280935.1|  hypothetical protein CARUB_v10026933mg           91.3    2e-18   
ref|XP_008788253.1|  PREDICTED: probably inactive leucine-rich re...  93.6    2e-18   
ref|XP_002883614.1|  hypothetical protein ARALYDRAFT_480045           93.6    2e-18   
ref|XP_009339384.1|  PREDICTED: probable inactive receptor kinase...  90.9    2e-18   
ref|XP_008393057.1|  PREDICTED: probable LRR receptor-like serine...  90.9    2e-18   
emb|CDY05959.1|  BnaC08g21360D                                        90.9    2e-18   
ref|XP_010426501.1|  PREDICTED: probable inactive receptor kinase...  90.9    2e-18   
emb|CDX85197.1|  BnaC07g25080D                                        90.1    3e-18   
ref|NP_190544.1|  receptor like protein 44                            90.5    3e-18   
ref|XP_009101260.1|  PREDICTED: probable inactive receptor kinase...  90.5    3e-18   
gb|KFK34242.1|  hypothetical protein AALP_AA5G119700                  90.1    4e-18   
ref|XP_004974286.1|  PREDICTED: probably inactive leucine-rich re...  89.7    5e-18   
ref|XP_002877697.1|  leucine-rich repeat family protein               89.7    5e-18   
ref|XP_010559281.1|  PREDICTED: probable inactive receptor kinase...  89.7    5e-18   
ref|XP_006466423.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    6e-18   
gb|KDO78860.1|  hypothetical protein CISIN_1g024203mg                 89.4    6e-18   
ref|XP_010106894.1|  hypothetical protein L484_012987                 89.0    7e-18   
gb|KDO78861.1|  hypothetical protein CISIN_1g024203mg                 89.4    7e-18   
ref|XP_006426140.1|  hypothetical protein CICLE_v10026270mg           89.4    7e-18   
gb|EYU44523.1|  hypothetical protein MIMGU_mgv1a022454mg              88.6    1e-17   
ref|XP_007047606.1|  Receptor like protein 44 isoform 1               88.6    1e-17   
ref|XP_007047607.1|  Receptor like protein 44 isoform 2               88.6    1e-17   
gb|KJB43964.1|  hypothetical protein B456_007G226700                  88.6    2e-17   
ref|XP_001776559.1|  predicted protein                                88.6    2e-17   
emb|CBI41043.3|  unnamed protein product                              87.8    3e-17   
gb|KJB48768.1|  hypothetical protein B456_008G086100                  87.4    3e-17   
gb|KDP33139.1|  hypothetical protein JCGZ_13531                       89.0    3e-17   
ref|XP_002265055.1|  PREDICTED: probable inactive receptor kinase...  87.4    4e-17   
ref|XP_002965447.1|  hypothetical protein SELMODRAFT_67606            87.4    4e-17   
ref|XP_002984543.1|  hypothetical protein SELMODRAFT_47607            87.4    4e-17   
ref|XP_001758290.1|  predicted protein                                87.4    4e-17   
dbj|BAJ94386.1|  predicted protein                                    89.4    4e-17   
ref|XP_008237444.1|  PREDICTED: probable inactive receptor kinase...  87.0    4e-17   
gb|AAM62916.1|  unknown                                               87.0    4e-17   
gb|KHN19056.1|  Probably inactive leucine-rich repeat receptor-li...  89.0    5e-17   
ref|XP_004231949.1|  PREDICTED: probable LRR receptor-like serine...  86.3    8e-17   
ref|XP_008354731.1|  PREDICTED: probable LRR receptor-like serine...  86.3    8e-17   
ref|XP_007205703.1|  hypothetical protein PRUPE_ppa009836mg           86.3    8e-17   
gb|EAZ43829.1|  hypothetical protein OsJ_28447                        86.3    9e-17   
ref|NP_201384.1|  receptor like protein 57                            86.3    1e-16   
ref|XP_010939348.1|  PREDICTED: probable LRR receptor-like serine...  86.3    1e-16   
gb|EPS74269.1|  hypothetical protein M569_00488                       85.5    1e-16   
ref|XP_009362609.1|  PREDICTED: probable inactive receptor kinase...  85.5    2e-16   
gb|EMT12771.1|  Mitogen-activated protein kinase 12                   88.6    2e-16   
ref|XP_004288279.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
ref|XP_011073668.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  85.1    2e-16   
ref|XP_006363800.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
ref|XP_008785726.1|  PREDICTED: leucine-rich repeat receptor-like...  84.7    3e-16   
ref|NP_001062623.1|  Os09g0131200                                     84.7    3e-16   
ref|XP_003541771.1|  PREDICTED: probably inactive leucine-rich re...  87.4    4e-16   
gb|EAZ31160.1|  hypothetical protein OsJ_15259                        87.0    4e-16   
ref|XP_004491533.1|  PREDICTED: probable LRR receptor-like serine...  87.4    5e-16   
emb|CAA16677.1|  LRR-like protein                                     85.9    5e-16   
ref|XP_006857059.1|  hypothetical protein AMTR_s00065p00062260        84.0    6e-16   
ref|XP_011099414.1|  PREDICTED: probable inactive receptor kinase...  83.6    6e-16   
emb|CDY16992.1|  BnaC09g41190D                                        82.8    6e-16   
ref|XP_008790267.1|  PREDICTED: probable LRR receptor-like serine...  84.0    7e-16   
gb|KJB18063.1|  hypothetical protein B456_003G032400                  83.2    9e-16   
ref|XP_009112204.1|  PREDICTED: probable inactive receptor kinase...  83.2    1e-15   
emb|CDP02635.1|  unnamed protein product                              83.2    1e-15   
ref|XP_011031327.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
ref|XP_002310881.1|  leucine-rich repeat family protein               82.4    2e-15   
ref|XP_010679675.1|  PREDICTED: probable LRR receptor-like serine...  82.4    2e-15   
ref|XP_010999923.1|  PREDICTED: probable inactive receptor kinase...  82.0    2e-15   
ref|XP_002320014.1|  leucine-rich repeat family protein               82.0    2e-15   
ref|XP_009389449.1|  PREDICTED: probably inactive leucine-rich re...  81.6    3e-15   
gb|KDP32114.1|  hypothetical protein JCGZ_12575                       81.6    3e-15   
ref|XP_009601000.1|  PREDICTED: probably inactive leucine-rich re...  84.0    4e-15   
ref|XP_002530612.1|  serine-threonine protein kinase, plant-type,...  81.3    4e-15   
ref|XP_010068891.1|  PREDICTED: probable inactive receptor kinase...  80.9    4e-15   
ref|XP_009387113.1|  PREDICTED: probable LRR receptor-like serine...  80.9    7e-15   
ref|XP_010936190.1|  PREDICTED: probable inactive receptor kinase...  80.5    1e-14   
ref|XP_009770457.1|  PREDICTED: probable inactive receptor kinase...  80.1    1e-14   
gb|EMT19839.1|  Putative NADP-dependent oxidoreductase P1             82.4    1e-14   
ref|XP_003617883.1|  Receptor protein kinase-like protein             82.8    1e-14   
gb|KJB10817.1|  hypothetical protein B456_001G226700                  82.0    1e-14   
ref|XP_009402118.1|  PREDICTED: probably inactive leucine-rich re...  79.7    2e-14   
ref|XP_003557650.1|  PREDICTED: leucine-rich repeat receptor-like...  82.8    2e-14   
ref|XP_002520188.1|  conserved hypothetical protein                   80.9    2e-14   
ref|XP_009597913.1|  PREDICTED: probable LRR receptor-like serine...  79.0    3e-14   
gb|KCW54722.1|  hypothetical protein EUGRSUZ_I00670                   78.6    4e-14   
ref|XP_010028069.1|  PREDICTED: probable inactive receptor kinase...  78.6    4e-14   
ref|XP_010273650.1|  PREDICTED: probable inactive receptor kinase...  78.2    5e-14   
ref|XP_008670931.1|  PREDICTED: LRR receptor-like serine/threonin...  78.6    6e-14   
ref|XP_004143410.1|  PREDICTED: receptor-like protein kinase BRI1...  77.8    6e-14   
gb|EMT32317.1|  Putative LRR receptor-like serine/threonine-prote...  80.9    6e-14   
ref|XP_010248331.1|  PREDICTED: probable inactive receptor kinase...  77.8    7e-14   
gb|KFK44613.1|  hypothetical protein AALP_AA1G281400                  79.7    9e-14   
ref|XP_002267870.2|  PREDICTED: probable LRR receptor-like serine...  80.1    1e-13   
gb|EYU40677.1|  hypothetical protein MIMGU_mgv1a004274mg              79.0    2e-13   
ref|XP_002271860.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   



>ref|XP_010091928.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB47708.1| putative inactive receptor kinase [Morus notabilis]
Length=597

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +1

Query  142  MVGFGFSRFLKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  315
            M G   + F  L +L    G   GVAEDDVKCL+G+K S RDP G L  W+F NT+ G I
Sbjct  1    MKGSATTIFASLLVLFASLGFCSGVAEDDVKCLRGIKQSLRDPQGKLDSWDFSNTSVGVI  60

Query  316  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  495
            CKFVGV+CWND ENR++ LELR++ L G VP AL+ C SLQ LD +GN LSGTIPSQIC 
Sbjct  61   CKFVGVSCWNDRENRILNLELRDMKLAGSVPQALEYCGSLQKLDFAGNDLSGTIPSQICT  120

Query  496  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            WLP++V LDLSSN  +GPIPP+LGNC YLN L+L+DN+L+G IP +I SL
Sbjct  121  WLPFVVDLDLSSNKFSGPIPPELGNCQYLNNLVLSDNRLSGTIPYEIGSL  170



>ref|XP_002323813.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03946.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=602

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 4/159 (3%)
 Frame = +1

Query  181  ILLVLFGVGV----AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWND  348
            I+++L  + V     EDDV+CLQGVK S  +P+G L  WNF N++ GFIC FVGV+CWND
Sbjct  13   IIVILVALSVINVLGEDDVRCLQGVKNSLDNPEGKLTTWNFANSSVGFICNFVGVSCWND  72

Query  349  NENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLS  528
             ENR+I L+LR++ L G+VP +L+ C SLQNLDLS N LSGTIP+QIC W+PYLVTLDLS
Sbjct  73   RENRIINLQLRDMKLSGQVPESLRYCQSLQNLDLSSNSLSGTIPAQICTWVPYLVTLDLS  132

Query  529  SNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +NDL+GPIPPDL NCTYLNKLIL++N+L+G+IP +++ L
Sbjct  133  NNDLSGPIPPDLANCTYLNKLILSNNRLSGSIPFELSGL  171



>ref|XP_004233342.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=603

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  FRMVGFGF-SRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  312
            FR++   F   FL    LL    V VAEDD+KCL+GVK S  DP GNL  WNF N+T GF
Sbjct  4    FRLINLPFIVLFLVFQPLLHCTAVAVAEDDIKCLEGVKNSLTDPKGNLNSWNFANSTVGF  63

Query  313  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  492
            ICKFVG +CWND ENR+I LELR++NLGG V  +L+ C SLQ LDLSGN +SG+IPS IC
Sbjct  64   ICKFVGASCWNDRENRLINLELRDMNLGGNVTDSLKYCRSLQTLDLSGNQISGSIPSDIC  123

Query  493  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             WLP+LVTLDLS N+ TG IP DL +C+YLNKL+LNDNKL+GNIP Q +SL
Sbjct  124  TWLPFLVTLDLSYNEFTGSIPSDLVSCSYLNKLMLNDNKLSGNIPPQFSSL  174



>emb|CDP02178.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            +AEDDVKCL+GVK S RDPDG   LWNF N++ GFIC FVGV+CWN NENR+IGL LR++
Sbjct  28   IAEDDVKCLRGVKSSLRDPDGRFSLWNFSNSSVGFICDFVGVSCWNPNENRLIGLLLRDM  87

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
            NL G VP ALQ CHSLQ LDLSGN LSG IP QIC WLPYLVT+DLS N LTG IP DL 
Sbjct  88   NLSGGVPDALQYCHSLQTLDLSGNDLSGPIPPQICDWLPYLVTVDLSGNALTGTIPEDLV  147

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
             C+YLN L+L+DNKL+GNIP Q ++L
Sbjct  148  KCSYLNSLVLDDNKLSGNIPYQFSTL  173



>ref|XP_011009041.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=602

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 128/159 (81%), Gaps = 4/159 (3%)
 Frame = +1

Query  181  ILLVLFGVGV----AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWND  348
            I+++L  + V     EDDV+CLQGVK S  +P G L  WNF N++ GFIC FVGV+CWND
Sbjct  13   IIVILVALSVINVLGEDDVRCLQGVKNSLDNPGGQLTTWNFANSSVGFICNFVGVSCWND  72

Query  349  NENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLS  528
             ENR+I L+LR++ L G+VP +L+ C SLQNLDLS N LSGTIP+QIC W+PYLVTLDLS
Sbjct  73   RENRIINLQLRDMKLSGQVPESLRYCQSLQNLDLSSNYLSGTIPAQICTWVPYLVTLDLS  132

Query  529  SNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +NDL+GPIPPDL NCTYLNKLIL++N+L+G+IP + +SL
Sbjct  133  NNDLSGPIPPDLANCTYLNKLILSNNRLSGSIPFEFSSL  171



>ref|XP_011047296.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=593

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  163  RFLKLSILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  339
            +F    ++   FG  V AEDD +CLQGV+ S  DP+G L  WNF N++ GFIC FVGV+C
Sbjct  2    KFCTFIVIFAAFGAIVFAEDDARCLQGVRKSLGDPEGRLATWNFANSSVGFICNFVGVSC  61

Query  340  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  519
            WND ENR+I LELR++ L G+VP ++Q C SLQNLDLS N LSGTIP+QIC WLPYLVTL
Sbjct  62   WNDRENRIINLELRDMKLSGQVPESIQYCESLQNLDLSSNSLSGTIPTQICTWLPYLVTL  121

Query  520  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            DLS+ND +GPIPPDL NC YLN LIL++N+L+G+IP   ++L
Sbjct  122  DLSNNDFSGPIPPDLANCIYLNNLILSNNRLSGSIPLGFSAL  163



>ref|XP_002298520.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE83325.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=595

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  163  RFLKLSILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  339
            +F    ++    G  V AEDD +CLQGV+ S  DP+G L  WNF NT+ GFIC FVGV+C
Sbjct  2    KFCTFIVIFAALGATVFAEDDARCLQGVQNSLGDPEGRLATWNFGNTSVGFICNFVGVSC  61

Query  340  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  519
            WND ENR+I LELR++ L G+VP +LQ C SLQNLDLS N LSGTIP+QIC WLPYLVTL
Sbjct  62   WNDRENRIINLELRDMKLSGQVPESLQYCKSLQNLDLSSNSLSGTIPAQICTWLPYLVTL  121

Query  520  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            DLS+ND +GPIPPDL NC YLN LIL++N+L+G+IP   ++L
Sbjct  122  DLSNNDFSGPIPPDLANCIYLNNLILSNNRLSGSIPLGFSAL  163



>gb|KDP45434.1| hypothetical protein JCGZ_09683 [Jatropha curcas]
Length=598

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +1

Query  157  FSRFLKLS--ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
            F+  LK++  I ++LF + + EDDV+CL+GV  S  DP G L  WNF NT+ GF+C FVG
Sbjct  4    FNNLLKIASLITVLLFSLAIGEDDVRCLRGVHSSLSDPQGKLSSWNFANTSNGFLCNFVG  63

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            V CWND ENR+IGLELR++ L G+ P +L++C SLQNLDLS N LSGTIP+QIC WLP+L
Sbjct  64   VTCWNDQENRIIGLELRDMKLSGQFPESLKECKSLQNLDLSSNALSGTIPTQICTWLPFL  123

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            VTLDLS+N+++G IPPDLGNCT+LN LIL++N LTG IP Q +SL
Sbjct  124  VTLDLSNNEISGSIPPDLGNCTFLNNLILSNNSLTGPIPYQFSSL  168



>ref|XP_006357131.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=612

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             VAEDD+KCL+GVK S  DP GNL  WNF N+T GFICKFVG +CWND ENR+I LELR+
Sbjct  33   AVAEDDIKCLKGVKNSLTDPKGNLNSWNFANSTVGFICKFVGASCWNDRENRLINLELRD  92

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            +NLGG VP +L+ C SLQ LDLSGN +SG+IPS IC WLP+LVTLDLS+N+ TG IP DL
Sbjct  93   MNLGGNVPDSLKYCRSLQTLDLSGNRISGSIPSDICTWLPFLVTLDLSNNEFTGSIPSDL  152

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             +C+YLNKL+LNDNKL+GNIP Q +SL
Sbjct  153  VSCSYLNKLMLNDNKLSGNIPPQFSSL  179



>ref|XP_009617928.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=605

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 129/168 (77%), Gaps = 5/168 (3%)
 Frame = +1

Query  157  FSRFLKLSILLVL----FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKF  324
            F  F+ + + LVL        VAEDD+KCLQGVK S  DP GNL  WNF N+T GFICKF
Sbjct  4    FRLFMLILLFLVLQPLPSSTVVAEDDIKCLQGVKNSLTDPKGNLKSWNFANSTVGFICKF  63

Query  325  VGVACWNDNENRVIglelrelnlg-geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWL  501
            VG +CWND ENR+I LELR+LNLG  ++P +LQ C SLQNLDLSGN LSG+IPS IC WL
Sbjct  64   VGASCWNDRENRLITLELRDLNLGGSKIPDSLQYCKSLQNLDLSGNRLSGSIPSDICTWL  123

Query  502  PYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            P+LV LDLS+N+ +G IP DL +C+YLNKLILNDNKL+GNIP Q +SL
Sbjct  124  PFLVILDLSNNEFSGSIPADLVSCSYLNKLILNDNKLSGNIPPQFSSL  171



>ref|XP_011098550.1| PREDICTED: probable inactive receptor kinase At1g27190 [Sesamum 
indicum]
Length=604

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD +CLQ VK S  DP+G L  W F NTT GFICKFVGV+CWND ENR+IGLELR+ +L
Sbjct  28   EDDTRCLQEVKKSLTDPEGKLNSWVFSNTTVGFICKFVGVSCWNDRENRLIGLELRDFSL  87

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ CHSLQ L+L+GN LSG+IP QIC WLPYLVTLDLS N LTG IP DL NC
Sbjct  88   TGSIPDSLQFCHSLQTLNLAGNSLSGSIPPQICTWLPYLVTLDLSQNSLTGQIPEDLANC  147

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +YLN LIL+DNKL+GNIP Q+++L
Sbjct  148  SYLNNLILDDNKLSGNIPYQLSTL  171



>gb|EYU34688.1| hypothetical protein MIMGU_mgv1a026965mg, partial [Erythranthe 
guttata]
Length=587

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+ VK S  D +G L  WNF NTT GFICKFVGV+CWND ENR+IGL LR+L+L
Sbjct  4    EDDVICLREVKNSLTDAEGRLSSWNFSNTTVGFICKFVGVSCWNDRENRLIGLALRDLSL  63

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G VP +LQ CHSLQNLDLSGN LSG+IP QIC WLPYLVTLDLS N LTG IP DL NC
Sbjct  64   AGVVPDSLQFCHSLQNLDLSGNSLSGSIPPQICTWLPYLVTLDLSRNGLTGQIPEDLANC  123

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +YLN LIL+DN+L+G+IP Q ++L
Sbjct  124  SYLNTLILDDNQLSGSIPFQFSNL  147



>ref|XP_003633815.1| PREDICTED: probable inactive receptor kinase At1g27190 [Vitis 
vinifera]
Length=613

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +1

Query  187  LVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVI  366
            + LF   VAEDDVKCL+GVK S  DP G L  W+F N + G +CKFVGVACWND ENR+ 
Sbjct  27   VALFSAAVAEDDVKCLRGVKESLSDPQGKLSSWSFSNISVGSLCKFVGVACWNDRENRIF  86

Query  367  glelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  546
            GLEL ++ L GE+P  L+ C S+Q LDLSGN L G IPSQIC WLPYLVTLDLS+NDL+G
Sbjct  87   GLELPDMKLSGEIPKPLEYCQSMQTLDLSGNRLYGNIPSQICTWLPYLVTLDLSNNDLSG  146

Query  547  PIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             IPPDL NC++LN L+L DN+L+G IPSQ++SL
Sbjct  147  TIPPDLANCSFLNSLLLADNQLSGIIPSQLSSL  179



>emb|CBI35007.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +1

Query  187  LVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVI  366
            + LF   VAEDDVKCL+GVK S  DP G L  W+F N + G +CKFVGVACWND ENR+ 
Sbjct  36   VALFSAAVAEDDVKCLRGVKESLSDPQGKLSSWSFSNISVGSLCKFVGVACWNDRENRIF  95

Query  367  glelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  546
            GLEL ++ L GE+P  L+ C S+Q LDLSGN L G IPSQIC WLPYLVTLDLS+NDL+G
Sbjct  96   GLELPDMKLSGEIPKPLEYCQSMQTLDLSGNRLYGNIPSQICTWLPYLVTLDLSNNDLSG  155

Query  547  PIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             IPPDL NC++LN L+L DN+L+G IPSQ++SL
Sbjct  156  TIPPDLANCSFLNSLLLADNQLSGIIPSQLSSL  188



>ref|XP_004232252.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=601

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  202  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  381
              VAEDD+KCL+G K S  DPDGNL  WNF NTT G ICKFVGV CWNDNENR+  L L 
Sbjct  24   AAVAEDDLKCLEGFKKSLEDPDGNLNSWNFKNTTIGAICKFVGVTCWNDNENRINSLSLP  83

Query  382  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  561
             +NLGG+V   +Q C SL  LDLSGN  SG IPSQIC WLPYLVTLDLS ND +GPIP D
Sbjct  84   AMNLGGKVTEPVQYCASLTALDLSGNSFSGPIPSQICTWLPYLVTLDLSGNDYSGPIPAD  143

Query  562  LGNCTYLNKLILNDNKLTGNIPSQIASL  645
            L  CT+LNKL L+DNKLTGNIP + +SL
Sbjct  144  LAKCTFLNKLSLSDNKLTGNIPPEFSSL  171



>ref|XP_010033235.1| PREDICTED: probable inactive receptor kinase At1g27190 [Eucalyptus 
grandis]
 gb|KCW52822.1| hypothetical protein EUGRSUZ_J02155 [Eucalyptus grandis]
Length=599

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +1

Query  199  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  378
             V   EDD++CLQG+K S  DP G L  W F +++ GFICKFVGV+CWND ENR++ LEL
Sbjct  19   AVAAVEDDIQCLQGLKASLGDPQGKLSSWRFASSSVGFICKFVGVSCWNDRENRILSLEL  78

Query  379  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  558
            R ++  G++P +LQ C SLQ LDLS NGLSGTIP QICRWLPYLVTLDLSSN L+G IPP
Sbjct  79   RGMDFTGQIPESLQYCRSLQTLDLSNNGLSGTIPPQICRWLPYLVTLDLSSNGLSGSIPP  138

Query  559  DLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            DL NCTYLN L+L++N+LTG IP    +L
Sbjct  139  DLVNCTYLNNLVLSNNRLTGTIPYDFLTL  167



>ref|XP_011085787.1| PREDICTED: probable inactive receptor kinase At1g27190 [Sesamum 
indicum]
Length=607

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +1

Query  139  RMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFIC  318
            R++    S F  L ++ +      AEDDV+CLQ VK S  D  G L  W F NT+ GFIC
Sbjct  4    RLLLLSRSIFSTLLLIFLFICSSFAEDDVRCLQEVKRSLTDTGGKLNSWVFSNTSVGFIC  63

Query  319  KFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRW  498
            +FVGV+CWND ENR+IGLELR+ +L G++P +LQ CHSLQ LDLSGN LSG+IP QIC W
Sbjct  64   RFVGVSCWNDRENRLIGLELRDFSLAGDIPDSLQFCHSLQTLDLSGNSLSGSIPPQICTW  123

Query  499  LPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LPYLVTLDLS N LTG IP DL NC++LN LIL+DNKL+G+IP Q+++L
Sbjct  124  LPYLVTLDLSRNSLTGHIPEDLANCSFLNALILDDNKLSGSIPYQLSNL  172



>gb|KJB40808.1| hypothetical protein B456_007G077900 [Gossypium raimondii]
Length=605

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = +1

Query  157  FSRFLKL--SILLVLFGVGV-----AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  315
            FSR LK+   +L  +F + +     A+DD+KCL+GVK S +DPDG L  W F+N + GF+
Sbjct  5    FSRRLKILSFVLSWMFSLALVFPATAQDDLKCLEGVKNSLKDPDGRLSSWTFNNNSVGFV  64

Query  316  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  495
            CKFVGV CWN+ ENR++GLELR++ L GE+P +L+ C SLQ LDLS N LSGTIP QIC 
Sbjct  65   CKFVGVQCWNEQENRLLGLELRDMKLSGELPQSLEYCRSLQTLDLSANKLSGTIPPQICS  124

Query  496  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            WLPYLVTLDLSSNDL G +PP+L NC YLN LIL++N+L+G+IP Q++ L
Sbjct  125  WLPYLVTLDLSSNDLHGSVPPELSNCAYLNNLILSNNRLSGSIPYQLSGL  174



>ref|XP_002517430.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF44972.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=602

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +1

Query  157  FSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVA  336
            F+  + +S  L+   V + EDD KCL+GV+ S  DP G L  WNF N+++GF+C FVGV+
Sbjct  10   FATLILVSATLISSSV-IGEDDAKCLEGVRNSLSDPQGKLSSWNFANSSSGFLCNFVGVS  68

Query  337  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  516
            CWND ENR+I LELR++ L G+VP +L+ C SLQNLDLS N LSGTIPSQIC WLPYLVT
Sbjct  69   CWNDQENRIINLELRDMQLSGQVPESLKYCKSLQNLDLSSNALSGTIPSQICTWLPYLVT  128

Query  517  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LDLS+NDL+G IP DL NCTYLN LIL++N+L+G IP + +SL
Sbjct  129  LDLSNNDLSGSIPHDLVNCTYLNNLILSNNRLSGPIPYEFSSL  171



>gb|KDO72413.1| hypothetical protein CISIN_1g035917mg [Citrus sinensis]
Length=611

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            VAEDDVKCL+GVK S  DP   L  W+F N+T GFIC+FVGV+CWND ENR++ LELRE+
Sbjct  47   VAEDDVKCLEGVKSSLNDPQRKLSSWSFGNSTIGFICQFVGVSCWNDKENRILNLELREM  106

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G++P  L+ C S+Q LDLS N LSG IP+QIC WLPYLV LDLS+NDL+GPIP DLG
Sbjct  107  KLSGKIPEPLKFCKSMQRLDLSANDLSGNIPAQICNWLPYLVLLDLSNNDLSGPIPADLG  166

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN LIL++NKL+G IP Q+++L
Sbjct  167  NCTYLNTLILSNNKLSGPIPYQLSNL  192



>ref|XP_006482508.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Citrus 
sinensis]
Length=612

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            VAEDDVKCL+GVK S  DP   L  W+F N+T GFIC+FVGV+CWND ENR++ LELRE+
Sbjct  35   VAEDDVKCLEGVKSSLNDPQRKLSSWSFGNSTIGFICQFVGVSCWNDKENRILNLELREM  94

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G++P  L+ C S+Q LDLS N LSG IP+QIC WLPYLV LDLS+NDL+GPIP DLG
Sbjct  95   KLSGKIPEPLKFCKSMQRLDLSANDLSGNIPAQICNWLPYLVLLDLSNNDLSGPIPADLG  154

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN LIL++NKL+G IP Q+++L
Sbjct  155  NCTYLNTLILSNNKLSGPIPYQLSNL  180



>gb|KJB11418.1| hypothetical protein B456_001G257700 [Gossypium raimondii]
Length=588

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +1

Query  190  VLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIg  369
            VL    V EDD+KCL+GVK S +DPDG L  W F+N + GFICKFVGV+CWN+ ENR++ 
Sbjct  5    VLVLSAVTEDDMKCLEGVKNSLKDPDGKLSSWTFNNNSVGFICKFVGVSCWNERENRLLS  64

Query  370  lelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGP  549
            L LR++ L G++P +LQ C SLQ+LDLS N LSG+IP+QIC WLPYLVTLDLSSNDL+G 
Sbjct  65   LGLRDMKLSGQLPQSLQYCRSLQSLDLSANKLSGSIPTQICSWLPYLVTLDLSSNDLSGT  124

Query  550  IPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            IPP+L  C YLN L L++N+L+G+IP Q++ L
Sbjct  125  IPPELSYCAYLNNLKLSNNRLSGSIPYQLSGL  156



>gb|KJB33686.1| hypothetical protein B456_006G026400 [Gossypium raimondii]
Length=399

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 124/163 (76%), Gaps = 2/163 (1%)
 Frame = +1

Query  163  RFLKLSILLVLFGVG--VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVA  336
            RF+ L+ +L    V   V EDD+KCL+G+K S  DPDG L  W+F+N +AGF+C  VGV 
Sbjct  13   RFVLLTRMLFAGHVSSTVTEDDIKCLKGIKNSLNDPDGKLSNWSFNNNSAGFLCNLVGVE  72

Query  337  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  516
            CW + E+R++ L+LR++ L G++P +LQ C SLQ LDLS N LSGT+P+QIC WLPYLVT
Sbjct  73   CWTEREDRLLSLQLRDMKLSGQLPQSLQYCQSLQTLDLSANRLSGTVPAQICSWLPYLVT  132

Query  517  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LDLSSNDL+G IP +L NC YLN L+L++N+L+G+IP Q++ L
Sbjct  133  LDLSSNDLSGSIPSELSNCAYLNNLVLSNNRLSGSIPEQLSGL  175



>ref|XP_006431036.1| hypothetical protein CICLE_v10011313mg [Citrus clementina]
 gb|ESR44276.1| hypothetical protein CICLE_v10011313mg [Citrus clementina]
Length=612

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            VAEDDVKCL+GVK S  DP   L  W+F N+T GFIC+FVGV+CWND ENR++ LELRE+
Sbjct  35   VAEDDVKCLEGVKSSLNDPQRKLSSWSFGNSTIGFICQFVGVSCWNDKENRILNLELREM  94

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G++P  L+ C S+Q LDLS N LSG IP+QIC WLPYLV LDLS+NDL+GPIP DLG
Sbjct  95   KLSGQIPEPLKFCKSMQRLDLSANDLSGNIPAQICDWLPYLVLLDLSNNDLSGPIPADLG  154

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN LIL++NKL+G IP Q+++L
Sbjct  155  NCTYLNTLILSNNKLSGPIPYQLSNL  180



>ref|XP_007032365.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY03291.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=606

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             V EDD+KCL+GVK S +DPD  L  W F+N + GFICKFVGV CWN+ ENR++ L+LR+
Sbjct  29   AVTEDDMKCLEGVKNSLKDPDRKLSSWTFNNNSVGFICKFVGVTCWNERENRLLSLQLRD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G++P +L+ C SLQ LDLS N LSGTIP QIC WLPYLVTLDLSSNDL+G IPP+L
Sbjct  89   MKLSGQLPESLEYCQSLQTLDLSANKLSGTIPPQICTWLPYLVTLDLSSNDLSGSIPPEL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
              C YLN L L++N+L+G+IP+Q+++L
Sbjct  149  SKCAYLNYLTLSNNRLSGSIPNQLSAL  175



>ref|XP_006338497.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=601

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            V EDD+KCL+G K S  DPDGNL  WNF NTT G ICKF GV CWNDNENR+I L L  +
Sbjct  26   VVEDDLKCLEGFKKSLEDPDGNLNSWNFKNTTVGAICKFTGVNCWNDNENRIISLSLSNI  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
            NLGG+V   +Q C SL  LDLSGN  SG IPSQIC WLP+LVTLDLS ND +GPIP DL 
Sbjct  86   NLGGKVTEPVQYCASLTTLDLSGNRFSGPIPSQICTWLPFLVTLDLSGNDYSGPIPADLA  145

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
             C +LNKL L+DNKLTGNIP + +S 
Sbjct  146  KCIFLNKLSLSDNKLTGNIPPEFSSF  171



>gb|EYU34129.1| hypothetical protein MIMGU_mgv1a027001mg, partial [Erythranthe 
guttata]
Length=603

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDVKCL+ VK S  DPDG L  W F N++ GFICKFVG +CWND ENR+IGLELR+  L
Sbjct  16   EDDVKCLREVKNSLSDPDGKLSSWIFSNSSLGFICKFVGASCWNDQENRLIGLELRDFRL  75

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ CHSLQ L+L+GN LSG+IP +IC WLPYLVTLDLS N LTG IP DL NC
Sbjct  76   AGNIPDSLQFCHSLQVLNLAGNSLSGSIPPEICTWLPYLVTLDLSQNRLTGSIPEDLANC  135

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +YLN LIL+DN+L+GN+P Q++SL
Sbjct  136  SYLNNLILDDNQLSGNLPYQLSSL  159



>ref|XP_010528295.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=611

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 125/172 (73%), Gaps = 5/172 (3%)
 Frame = +1

Query  145  VGFGFSRFLKLSILLVL-----FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAG  309
            +G   S+FL LSI + +       +   EDDV+CLQGVK S  DP G L LWNF N+T G
Sbjct  3    IGSKPSKFLLLSIAVTVVFFCCLVMAADEDDVRCLQGVKNSLSDPQGALKLWNFANSTVG  62

Query  310  FICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQI  489
            F+C FVGV+CWN+ ENRVI LELR++ L G +P +LQ C SLQ LDLSGN LSG IPSQ 
Sbjct  63   FLCNFVGVSCWNNQENRVINLELRDMGLSGRIPESLQFCGSLQKLDLSGNRLSGNIPSQF  122

Query  490  CRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            C WLP+LV+LDLSSNDL G +PP+L  C++LN L+L+ N+L+G IP Q ++L
Sbjct  123  CDWLPFLVSLDLSSNDLGGELPPELAKCSFLNSLVLSSNRLSGQIPVQFSAL  174



>gb|EPS58697.1| hypothetical protein M569_16115, partial [Genlisea aurea]
Length=400

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            VA+DDV+CLQ V+ S  DP G+L  WNF N TAGFIC F GV+CWND ENRVIGL L   
Sbjct  2    VAQDDVRCLQQVRNSLADPKGSLSSWNFGNDTAGFICHFDGVSCWNDFENRVIGLSLLNF  61

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
            +LGG VP +L+ CH+LQ L+L+GN L G+IP QIC WLPYLVTLDLS+NDLTG IP DL 
Sbjct  62   HLGGTVPDSLRLCHTLQTLNLAGNSLYGSIPLQICSWLPYLVTLDLSNNDLTGQIPEDLA  121

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC+YLN LIL+ N+L+G IP Q +++
Sbjct  122  NCSYLNALILDGNRLSGGIPYQFSTM  147



>ref|XP_004302375.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=596

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  169  LKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACW  342
            L L + L  F     V EDDVKCL+G+K +F DP G L  W+F N++ GF+C FVG++CW
Sbjct  10   LTLVLFLSFFSSYQAVVEDDVKCLKGIKEAFNDPLGKLDSWDFTNSSVGFVCHFVGISCW  69

Query  343  NDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLD  522
            ND ENR+  LELR+++L G +P +++ C SLQNLDL GN L+G IP  +C WLPYLVTLD
Sbjct  70   NDRENRIYNLELRDMSLSGTIPQSIEYCISLQNLDLGGNDLNGMIPKDLCSWLPYLVTLD  129

Query  523  LSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LS N+ TGPIP DL NCT+LN LIL+DNKL+G+IP +++SL
Sbjct  130  LSGNEFTGPIPVDLSNCTFLNNLILSDNKLSGSIPYELSSL  170



>ref|XP_010684872.1| PREDICTED: probable inactive receptor kinase At1g27190 [Beta 
vulgaris subsp. vulgaris]
Length=604

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 121/156 (78%), Gaps = 3/156 (2%)
 Frame = +1

Query  184  LLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTA--GFICKFVGVACWNDNEN  357
            LL  F + V EDDVKCL+G+K +  DP G L  WNF N++A  GF+C FVG +CWND EN
Sbjct  19   LLTTFSLAV-EDDVKCLEGIKNTLNDPQGKLNSWNFRNSSASVGFVCNFVGASCWNDREN  77

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            R+I L+LR+  L G +P +L+ C S+Q+LDLSGN L+GTIPS+IC WLP+LVTLDLS+N 
Sbjct  78   RLISLQLRDFQLSGHIPDSLEFCSSIQSLDLSGNSLTGTIPSKICSWLPFLVTLDLSNNQ  137

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            L+G IPPDLG C YLN+L L+DN L+G+IP Q+++L
Sbjct  138  LSGQIPPDLGKCQYLNRLDLSDNHLSGSIPLQLSNL  173



>ref|XP_010272145.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nelumbo 
nucifera]
Length=610

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  160  SRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  339
            S+   L +  ++F     EDDVKCL GVK S  DP G L  W F N + GF+CKFVGV+C
Sbjct  8    SQLFLLLLSAMIFASMAIEDDVKCLTGVKNSLSDPQGKLSSWIFSNNSVGFLCKFVGVSC  67

Query  340  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  519
            WN+ ENR+I L+L  +NL G++P +LQ C SLQ LDLSGN LSG IPSQIC W+PYLVTL
Sbjct  68   WNERENRLIRLDLPTMNLAGQIPDSLQYCQSLQGLDLSGNKLSGQIPSQICTWMPYLVTL  127

Query  520  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            DLS+ND +GPIPP+L +C +LN L L +N+L+G+IP +++ L
Sbjct  128  DLSNNDFSGPIPPELVDCKFLNSLNLANNRLSGSIPYELSRL  169



>ref|XP_009620632.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=602

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = +1

Query  142  MVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICK  321
            M  F F   L   +L   +   V EDD+KCL+G K S  DP GNL  W+F N+T   ICK
Sbjct  1    MTRFRFQLILLFVVLPQFYDAAVVEDDLKCLEGFKKSLEDPSGNLISWDFTNSTVSAICK  60

Query  322  FVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWL  501
            F GV CWN+ ENR+ GL L+ +NLGG+V  +L+ C SL  LDLSGN  SG IPS+IC WL
Sbjct  61   FTGVNCWNERENRINGLALQTMNLGGKVTESLEYCASLTTLDLSGNRFSGPIPSKICTWL  120

Query  502  PYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            P+L TLDLSSND +G IP DL  C YLNKL+LNDNKL+GNIP + +S 
Sbjct  121  PFLTTLDLSSNDFSGSIPADLVKCAYLNKLMLNDNKLSGNIPPEFSSF  168



>ref|NP_189486.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAB02861.1| receptor-like protein kinase-like protein [Arabidopsis thaliana]
 dbj|BAC42027.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59325.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77446.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=605

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+G+K S  DP   L  WNFDNTT GF+C FVGV+CWN+ ENRVI LELR++ L
Sbjct  31   EDDIRCLRGLKASLTDPQNALKSWNFDNTTLGFLCNFVGVSCWNNQENRVINLELRDMGL  90

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +LQ C SLQ LDLS N LSG IP+++C WLP+LV+LDLS+N+L G IPPDL  C
Sbjct  91   SGKIPDSLQYCASLQKLDLSSNRLSGNIPTELCNWLPFLVSLDLSNNELNGEIPPDLAKC  150

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +++N L+L+DN+L+G IP Q ++L
Sbjct  151  SFVNSLVLSDNRLSGQIPVQFSAL  174



>gb|KFK33740.1| hypothetical protein AALP_AA5G053600 [Arabis alpina]
Length=604

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CLQG+K S  DP G L  WNF NTT GF+C FVGV+CWN+ ENRVI LELR++ L
Sbjct  29   EDDIRCLQGIKTSLTDPQGALKSWNFGNTTLGFLCNFVGVSCWNNQENRVINLELRDMGL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +LQ C SLQ LDLS N LSG IP+Q+C WLP+LV++D S+N+L G IP DL NC
Sbjct  89   SGKIPESLQYCKSLQKLDLSSNRLSGNIPTQLCNWLPFLVSIDFSNNELNGEIPVDLANC  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +++N L+L+DN+L+G+IP Q ++L
Sbjct  149  SFVNSLVLSDNRLSGSIPVQFSAL  172



>ref|XP_008389562.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=607

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+GVK S  DP+G LG W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  23   EDDVACLEGVKSSLTDPEGRLGQWDLANRSVASICKLVGVSCWNEKENRLISLQLPSMEL  82

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G IPP++ NC
Sbjct  83   VGMLPESLKFCHSLQSLDLSGNALSGSIPPQICNWLPYLVTLDLSGNALSGSIPPEIVNC  142

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LILNDN+L+G++P ++  L
Sbjct  143  KFLNTLILNDNRLSGSLPYELGRL  166



>ref|XP_002875454.1| hypothetical protein ARALYDRAFT_484619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51713.1| hypothetical protein ARALYDRAFT_484619 [Arabidopsis lyrata subsp. 
lyrata]
Length=579

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+G+K S  DP   L  WNFDNTT GF+C FVGV+CWN+ ENRVI LELR++ L
Sbjct  5    EDDIRCLRGLKTSLTDPQNALKSWNFDNTTLGFLCNFVGVSCWNNQENRVINLELRDMGL  64

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +LQ C SLQ LDLS N LSG IP ++C WLP+LV+LDLS+N+L G IPPDL  C
Sbjct  65   SGKIPDSLQYCASLQKLDLSSNRLSGNIPKELCNWLPFLVSLDLSNNELNGEIPPDLAKC  124

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +++N L+L+DN+L+G IP Q ++L
Sbjct  125  SFVNSLVLSDNRLSGQIPVQFSAL  148



>ref|XP_006290709.1| hypothetical protein CARUB_v10016807mg, partial [Capsella rubella]
 gb|EOA23607.1| hypothetical protein CARUB_v10016807mg, partial [Capsella rubella]
Length=654

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  202  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  381
            +   EDD++CL+G++ S  DP G L  WNF NTT GF+CKFVGV+CWND ENRVI LELR
Sbjct  76   MAADEDDIRCLRGIQSSLTDPQGILKSWNFANTTVGFLCKFVGVSCWNDQENRVINLELR  135

Query  382  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  561
            ++ L G+VP +LQ C SLQ LDLS N LSG IP ++C WLP+LV+LDLS+N+L G I PD
Sbjct  136  DMGLSGKVPESLQYCGSLQKLDLSSNRLSGNIPRELCSWLPFLVSLDLSNNELNGEISPD  195

Query  562  LGNCTYLNKLILNDNKLTGNIPSQIASL  645
            L  C+++N ++L+DN+L+G IP Q ++L
Sbjct  196  LAKCSFVNSMVLSDNRLSGQIPVQFSAL  223



>ref|XP_009335793.1| PREDICTED: probable inactive receptor kinase At1g27190 [Pyrus 
x bretschneideri]
Length=601

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 118/171 (69%), Gaps = 9/171 (5%)
 Frame = +1

Query  160  SRFLKLSILLVLFG---------VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  312
            SR  ++ I ++L+G           V EDDV+CLQG+K S  DP GNL  W+F N T GF
Sbjct  3    SRIARIWIPVLLWGCMSTHFGSYAAVVEDDVRCLQGLKQSLNDPLGNLASWDFKNHTVGF  62

Query  313  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  492
            IC FVGV CWND ENR+  LELR++ + GEVP  ++ C SL  LDL GN +SG IP  IC
Sbjct  63   ICDFVGVTCWNDRENRIFSLELRDMEITGEVPRDIEYCASLTKLDLGGNEISGPIPPNIC  122

Query  493  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             WLP+LVTLDLS ND +G IPPDL +C YLN LIL+DNKL+G IP + +SL
Sbjct  123  DWLPFLVTLDLSGNDFSGAIPPDLQHCEYLNILILSDNKLSGPIPYEFSSL  173



>emb|CDY04020.1| BnaC02g37350D [Brassica napus]
Length=602

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 6/167 (4%)
 Frame = +1

Query  163  RFLKLSILLVLF------GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKF  324
            + L LSI ++L        +   EDD+KCL+G++ S  DP G L  WNF NTT GF+C F
Sbjct  10   KLLPLSIFIILLLCFSPPAMAADEDDIKCLKGIQTSLTDPQGILKSWNFANTTLGFLCNF  69

Query  325  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  504
            VGV+CWN+ ENRVI LELR++ L G +P +LQ C SLQ LDLS N LSG IP ++C WLP
Sbjct  70   VGVSCWNNQENRVINLELRDMGLSGRIPESLQYCGSLQKLDLSTNRLSGNIPRELCTWLP  129

Query  505  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +LV+LDLS+N L G IPP L  C ++N L+L++N+LTG IP Q++SL
Sbjct  130  FLVSLDLSNNQLNGEIPPSLAECRFVNSLVLSENRLTGQIPVQLSSL  176



>ref|XP_008361793.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=607

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+GVK S  DP+G L  W+  N +   ICK VGV CWN+ ENR+I L+L  + L
Sbjct  23   EDDVACLZGVKSSLTDPEGRLSQWDLANRSVASICKLVGVTCWNEKENRLISLQLPSMEL  82

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G IPP++ NC
Sbjct  83   AGKLPESLKFCHSLQSLDLSGNSLSGSIPPQICNWLPYLVTLDLSGNSLSGSIPPEIANC  142

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LILNDN+L+G++P ++  L
Sbjct  143  KFLNTLILNDNRLSGSLPYELGRL  166



>ref|XP_008379313.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=600

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             V EDD++CL+G+K S  DP   L  W+F NTTAG ICKFVG+ CWND ENR++ LELRE
Sbjct  26   AVVEDDLRCLRGLKQSLHDPLEKLASWDFGNTTAGVICKFVGITCWNDKENRIVKLELRE  85

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G VP  ++ C SL NLDL  N +SG IP  IC WLP+LVTLDLS ND +GPIPP L
Sbjct  86   MELTGAVPKEIEYCGSLTNLDLGSNAISGPIPPDICDWLPFLVTLDLSGNDFSGPIPPGL  145

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             +C YLN LIL+DNKLTG IP +++SL
Sbjct  146  QHCKYLNSLILSDNKLTGPIPFELSSL  172



>ref|XP_009759220.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
sylvestris]
Length=602

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = +1

Query  193  LFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgl  372
             +   V EDD+KCL+G K S  DP GNL  W+F N+T G ICKF GV CWN+ ENR+ GL
Sbjct  18   FYDTAVVEDDLKCLEGFKKSLEDPSGNLNSWDFTNSTVGAICKFAGVNCWNERENRINGL  77

Query  373  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  552
             L+ +NLGG+V  +L+ C SL  LDLSGN  SG IPS+IC WLP+L TLDLSSND +G I
Sbjct  78   ALQTMNLGGKVTESLEYCASLTTLDLSGNRFSGPIPSKICTWLPFLTTLDLSSNDFSGSI  137

Query  553  PPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            P DL  C YLNKL+LNDNKL+GNIP + +S 
Sbjct  138  PADLVKCAYLNKLMLNDNKLSGNIPPEFSSF  168



>ref|XP_010514548.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=607

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +1

Query  163  RFLKLSILLVLF----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
            + L LSI++ L      +   EDD++CL+GV+ S  DP G L  WNF NTT GF+C FVG
Sbjct  10   KLLPLSIIIFLCFCYPSMAADEDDIRCLRGVQSSLTDPQGALKSWNFGNTTVGFLCNFVG  69

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            V+CWN+ ENRVI LELR++ L G++P +LQ C SLQ LDLS N LSG IP ++C WLP+L
Sbjct  70   VSCWNNQENRVINLELRDMGLSGKIPESLQYCGSLQKLDLSSNQLSGNIPRELCTWLPFL  129

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            V+LDLS+N+L G I PDL  C+++N L+L+DN+L+G IP Q ++L
Sbjct  130  VSLDLSNNELNGEISPDLAKCSFVNSLVLSDNRLSGQIPVQFSAL  174



>ref|XP_010425626.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=606

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +1

Query  163  RFLKLSILLVLF----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
            + L LSI++ L      +   EDD++CL+GV+ S  DP G L  WNF NTT GF+C FVG
Sbjct  10   KLLPLSIIIFLCFCYPSMAADEDDIRCLRGVQSSLTDPQGALKSWNFGNTTVGFLCNFVG  69

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            V+CWN+ ENRVI LELR++ L G++P +LQ C SLQ LDLS N LSG IP ++C WLP+L
Sbjct  70   VSCWNNQENRVINLELRDMGLSGKIPESLQYCGSLQKLDLSSNQLSGNIPRELCTWLPFL  129

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            V+LDLS+N+L G I PDL  C+++N L+L+DN+L+G IP Q ++L
Sbjct  130  VSLDLSNNELNGEISPDLAKCSFVNSLVLSDNRLSGQIPVQFSAL  174



>gb|KDO82668.1| hypothetical protein CISIN_1g007423mg [Citrus sinensis]
Length=604

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDVKCL+G++ S +DPDG L  W+F NTT G IC+  GVACWN+ ENR+I L L  + L
Sbjct  23   EDDVKCLEGIQNSIKDPDGRLS-WSFTNTTVGAICRLTGVACWNEKENRIISLTLSSMQL  81

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L  CHSLQ+LDLS N LSG+IP  +C+WLPY+V LDLS+N L+GPIPP +  C
Sbjct  82   SGQLPESLHLCHSLQSLDLSDNSLSGSIPVDLCKWLPYVVQLDLSNNHLSGPIPPQIVEC  141

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LNKLIL++NKL+G+IP +++ L
Sbjct  142  KFLNKLILSNNKLSGSIPFEVSRL  165



>ref|XP_006395364.1| hypothetical protein EUTSA_v10003844mg [Eutrema salsugineum]
 gb|ESQ32650.1| hypothetical protein EUTSA_v10003844mg [Eutrema salsugineum]
Length=609

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +1

Query  166  FLKLSILLVLF-----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
             L ++ + V F      +   EDD++CLQG+K S  DP   L  WNF N+T GF+C FVG
Sbjct  13   LLIITTVFVFFLCYSPAMAADEDDIRCLQGLKSSLTDPQNALKSWNFANSTIGFLCNFVG  72

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            V+CWN+ ENRVI LELR++ L G +P +LQ C SLQ LDLS N +SG IP+Q+C WLP+L
Sbjct  73   VSCWNNQENRVINLELRDMGLSGRIPESLQFCGSLQKLDLSSNRISGNIPTQLCSWLPFL  132

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            V+LDLS+N+L G IPPDL  C+++N ++L+DN+L+G IP Q ++L
Sbjct  133  VSLDLSNNELNGEIPPDLAKCSFVNSIVLSDNRLSGQIPVQFSAL  177



>ref|XP_010502845.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=606

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +1

Query  163  RFLKLSILLVLF----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
            + + LSI++ L      +   EDD++CL+GV+ S  DP G L  WNF NTT GF+C FVG
Sbjct  10   KLIPLSIIIFLCFCYPSMAADEDDIRCLRGVQSSLTDPQGALKSWNFGNTTVGFLCNFVG  69

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            V+CWN+ ENRVI LELR++ L G++P +LQ C SLQ LDLS N LSG IP ++C WLP+L
Sbjct  70   VSCWNNQENRVINLELRDMGLSGKIPESLQYCGSLQKLDLSSNQLSGNIPRELCTWLPFL  129

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            V+LDLS+N+L G I PDL  C+++N L+L+DN+L+G IP Q ++L
Sbjct  130  VSLDLSNNELNGEISPDLAKCSFVNSLVLSDNRLSGQIPVQFSAL  174



>ref|XP_008341508.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=601

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  160  SRFLKLSILLVLFG---------VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  312
            SR  ++ I ++L+G           V EDDV+CLQG+K S  DP G L  W+F N T GF
Sbjct  3    SRIARIWIPVLLWGCMSTHFCSYAAVVEDDVRCLQGLKQSLNDPLGKLASWDFRNHTVGF  62

Query  313  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  492
            IC FVGV CWND ENR+  LELR++ + GEVP  ++ C SL  LDL GN +SG IP  IC
Sbjct  63   ICDFVGVTCWNDRENRIFSLELRDMEITGEVPKDIEYCASLTKLDLGGNEISGPIPPDIC  122

Query  493  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             WLP+LVTLDLS ND +G IPPDL +C YLN LIL+DNKL+G IP + +SL
Sbjct  123  DWLPFLVTLDLSGNDFSGAIPPDLQHCEYLNILILSDNKLSGPIPYEFSSL  173



>ref|XP_009129373.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=600

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = +1

Query  199  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  378
             +   EDD++CL+G++ S  DP G L  WNF NTT GF+C FVGV+CWN+ ENRVI LEL
Sbjct  26   AMAADEDDIRCLKGIQTSLTDPQGALRSWNFANTTLGFLCNFVGVSCWNNQENRVINLEL  85

Query  379  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  558
            R++ L G +P +LQ C SLQ LDLS N LSG IP Q+C WLP+LV+LDLS+NDL G +PP
Sbjct  86   RDMGLSGRIPESLQYCGSLQKLDLSTNRLSGNIPPQLCTWLPFLVSLDLSNNDLNGEVPP  145

Query  559  DLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             L  C ++N L+L+ N+LTG IP Q++SL
Sbjct  146  SLAECRFVNSLVLSKNRLTGQIPVQLSSL  174



>emb|CDY47244.1| BnaA02g29300D [Brassica napus]
Length=601

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = +1

Query  199  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  378
             +   EDD++CL+G++ S  DP G L  WNF NTT GF+C FVGV+CWN+ ENRVI LEL
Sbjct  26   AMAADEDDIRCLKGIQTSLTDPQGALRSWNFANTTLGFLCNFVGVSCWNNQENRVINLEL  85

Query  379  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  558
            R++ L G +P +LQ C SLQ LDLS N LSG IP Q+C WLP+LV+LDLS+NDL G +PP
Sbjct  86   RDMGLSGRIPESLQYCGSLQKLDLSTNRLSGNIPPQLCTWLPFLVSLDLSNNDLNGEVPP  145

Query  559  DLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             L  C ++N L+L+ N+LTG IP Q++SL
Sbjct  146  SLAECRFVNSLVLSKNRLTGQIPVQLSSL  174



>ref|XP_009360430.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Pyrus x bretschneideri]
Length=607

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+GVK S  DP+G LG W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  23   EDDVACLEGVKSSLTDPEGRLGQWDLANRSVASICKLVGVSCWNEKENRLISLQLPSMEL  82

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ CHSLQ+LDLS N LSG+IP QIC WLPYLVTLDLS N L+G IPP++ NC
Sbjct  83   AGKLPESLKFCHSLQSLDLSSNALSGSIPRQICNWLPYLVTLDLSGNALSGSIPPEIVNC  142

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L LNDN+L+G++P ++  L
Sbjct  143  KFLNTLFLNDNRLSGSLPYELGRL  166



>ref|XP_006438525.1| hypothetical protein CICLE_v10030999mg [Citrus clementina]
 ref|XP_006483300.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Citrus 
sinensis]
 gb|ESR51765.1| hypothetical protein CICLE_v10030999mg [Citrus clementina]
Length=604

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDVKCL+G++ S +DPDG L  W+F NTT G IC+  GV+CWN+ ENR+I L L  + L
Sbjct  23   EDDVKCLEGIQNSIKDPDGRLS-WSFTNTTVGAICRLTGVSCWNEKENRIISLTLSSMQL  81

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L  CHSLQ LDLS N LSG+IP  +C+WLPY+V LDLS+N L+GPIPP +  C
Sbjct  82   SGQLPESLHLCHSLQTLDLSDNSLSGSIPVDLCKWLPYVVQLDLSNNHLSGPIPPQIVEC  141

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LNKLIL++NKL+G+IP +++ L
Sbjct  142  KFLNKLILSNNKLSGSIPFEVSRL  165



>ref|XP_010043841.1| PREDICTED: probable inactive receptor kinase At1g27190 [Eucalyptus 
grandis]
 gb|KCW85840.1| hypothetical protein EUGRSUZ_B02576 [Eucalyptus grandis]
Length=616

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+GVK S  DP G+L  W F NT+A  IC   GVACWN NENR+I L L    +
Sbjct  34   EDDVLCLEGVKRSLGDPQGSLADWTFANTSASHICNLNGVACWNLNENRIISLSLTGFGV  93

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +L++CHSLQ LDLS N L G IP+QIC WLPYLV LDLSSN L GPIP  +G+C
Sbjct  94   SGGLPESLKNCHSLQTLDLSQNKLDGPIPAQICEWLPYLVKLDLSSNSLAGPIPSQIGDC  153

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LILNDNKLTG IP ++  L
Sbjct  154  KFLNNLILNDNKLTGPIPYEVGRL  177



>ref|XP_008221489.1| PREDICTED: probable inactive receptor kinase At1g27190 [Prunus 
mume]
Length=605

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+GVK S  DP G L  W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  22   EDDLTCLEGVKTSLTDPQGRLSQWDLGNRSVASICKLVGVSCWNEKENRLISLQLPSMEL  81

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE+P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS+N L+G IPP++ NC
Sbjct  82   AGELPESLKFCHSLQSLDLSGNALSGSIPPQICNWLPYLVTLDLSNNHLSGSIPPEIVNC  141

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LILNDN+L+G++P ++  L
Sbjct  142  KFLNTLILNDNRLSGSLPYELGRL  165



>emb|CDX86433.1| BnaA06g31500D [Brassica napus]
Length=560

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +1

Query  199  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  378
             +   EDD++CL+G+  S  DP+G L  WNF NTT GF+C FVGV+CWN+ ENRV+ LEL
Sbjct  24   ALAADEDDIRCLRGIHTSLTDPNGLLKSWNFANTTVGFLCNFVGVSCWNNQENRVLNLEL  83

Query  379  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  558
            R+++L G++P +L+ C SLQ LDLS N L+GTIP Q+C WLP+LV+LDLS+N L G IPP
Sbjct  84   RDMSLSGQIPDSLRFCGSLQKLDLSNNRLTGTIPRQLCSWLPFLVSLDLSNNQLNGEIPP  143

Query  559  DLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +L  C ++N L+L+DN+L+G IP Q++SL
Sbjct  144  ELAECRFVNSLVLSDNRLSGLIPVQLSSL  172



>ref|XP_007151169.1| hypothetical protein PHAVU_004G023700g [Phaseolus vulgaris]
 gb|ESW23163.1| hypothetical protein PHAVU_004G023700g [Phaseolus vulgaris]
Length=606

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = +1

Query  160  SRFLKLSIL---LVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
            S FL L++L   + L    V EDDVKCL+G+K +  DP G+L LW F+NTT GFIC FVG
Sbjct  9    SSFLILTLLGFHVFLGSSQVEEDDVKCLRGIKEALSDPQGHLDLWRFENTTVGFICDFVG  68

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPY  507
            V CWN  ENRV+ L+ ++  L G +P A++ C  SLQ L+L+ N  S  IP +IC W+P+
Sbjct  69   VTCWNQRENRVLSLDFQDFKLSGRIPEAMKYCGKSLQRLNLASNSFSFEIPHEICTWMPF  128

Query  508  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LV+LDLS N L+G IPP L NC+YLN+L+L+DN+L+G+IP ++ SL
Sbjct  129  LVSLDLSGNQLSGSIPPTLANCSYLNELMLSDNQLSGSIPFELGSL  174



>ref|XP_009151873.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=594

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+G+  S  DP+G L  WNF NTT GF+C FVGV+CWN+ ENRV+ LELR+++L
Sbjct  29   EDDIRCLRGIHTSLTDPNGLLKSWNFANTTVGFLCNFVGVSCWNNQENRVLNLELRDMSL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ C SLQ LDLS N L+GTIP Q+C WLP+LV+LDLS+N L G IPP+L  C
Sbjct  89   SGQIPDSLRFCGSLQKLDLSNNRLTGTIPRQLCSWLPFLVSLDLSNNQLNGEIPPELAEC  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             ++N L+L+DN+L+G IP Q++SL
Sbjct  149  RFVNSLVLSDNRLSGLIPVQLSSL  172



>ref|XP_007222048.1| hypothetical protein PRUPE_ppa003089mg [Prunus persica]
 gb|EMJ23247.1| hypothetical protein PRUPE_ppa003089mg [Prunus persica]
Length=605

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+GVK S  DP G L  W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  22   EDDLTCLEGVKTSLTDPQGRLSQWDLGNRSVASICKLVGVSCWNEKENRLISLQLPSMEL  81

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE+P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS+N L+G IPP++ NC
Sbjct  82   AGELPESLKFCHSLQSLDLSGNALSGSIPPQICTWLPYLVTLDLSNNHLSGSIPPEIVNC  141

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LILNDN+L+G++P ++  L
Sbjct  142  KFLNTLILNDNRLSGSLPYELGLL  165



>gb|KFK44612.1| hypothetical protein AALP_AA1G281300 [Arabis alpina]
Length=598

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = +1

Query  166  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
            F+ L  +L    +   EDDV CLQG+K S  DP   L  W+F N ++  ICK  GV+CWN
Sbjct  5    FIALLCILFTTSLSSGEDDVLCLQGLKNSLTDPSSRLTSWSFPNASSSSICKLTGVSCWN  64

Query  346  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  525
            + ENR+I L+L+ + L G++P +L+ CHSLQ+LDLSGN LSG+IPSQIC WLPYLVTLDL
Sbjct  65   EKENRIISLQLQLMQLKGQIPESLKLCHSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDL  124

Query  526  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQ  633
            S N L+G IP  +  C +LN L+L+DNKL+G+IPSQ
Sbjct  125  SGNKLSGSIPSQIVECKFLNTLVLSDNKLSGSIPSQ  160



>ref|XP_008353487.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Malus domestica]
Length=601

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  160  SRFLKLSILLVLFG---------VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  312
            SR  ++ I ++L+G           V EDDV+CLQG+K S  DP G L  W+F N T G 
Sbjct  3    SRIARIWIPVLLWGCMSTHFCSYAAVVEDDVRCLQGLKQSLNDPLGKLASWDFRNHTVGX  62

Query  313  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  492
            IC FVGV CWND ENR+  LELR++ + GEVP  ++ C SL  LDL GN +SG IP  IC
Sbjct  63   ICDFVGVTCWNDRENRIFSLELRDMEITGEVPKDIEYCASLTKLDLGGNEISGPIPPDIC  122

Query  493  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             WLP+LVTLDLS ND +G IPPDL +C YLN LIL+DNKL+G IP + +SL
Sbjct  123  DWLPFLVTLDLSGNDFSGAIPPDLQHCEYLNILILSDNKLSGPIPYEFSSL  173



>ref|XP_008230695.1| PREDICTED: probable inactive receptor kinase At1g27190 [Prunus 
mume]
Length=604

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             V EDDVKCLQ +K S +DP G L  W+F NT+   +CKFVGV CWND ENR++ LELR+
Sbjct  29   AVVEDDVKCLQSLKQSLKDPLGKLASWDFRNTSVVSMCKFVGVTCWNDRENRILNLELRD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G +   ++ C SLQNLDL GN LSG+IP  IC WLP+LVTLD S+ND +G IP DL
Sbjct  89   MELSGAIAKDIEYCSSLQNLDLGGNKLSGSIPPDICTWLPFLVTLDFSNNDFSGSIPTDL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             +C YLN LIL+DNKL+G IP + +SL
Sbjct  149  QHCKYLNNLILSDNKLSGTIPYEFSSL  175



>ref|XP_002305238.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE85749.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=609

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 1/160 (1%)
 Frame = +1

Query  169  LKLSILLVLFGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
            +  S+L  LF    A EDDV CL+GVK SF DP G L  W+F+N +  +ICK  GV+CWN
Sbjct  8    ISFSLLFSLFAFSFAIEDDVTCLEGVKNSFTDPLGRLTSWDFNNNSVAYICKLNGVSCWN  67

Query  346  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  525
            + ENR+I L+L    L G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+VTLDL
Sbjct  68   EKENRIISLQLPLFQLSGKLPESLKYCHSLTTLDLSNNDLSGPIPPEICNWLPYVVTLDL  127

Query  526  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            S N  +GPIPP++ NC +LN LIL+ NKLTG+IP     L
Sbjct  128  SGNKFSGPIPPEIVNCKFLNSLILSGNKLTGSIPYGFGRL  167



>ref|XP_010477749.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=600

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S +DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  22   AEDDVLCLQGLKDSLKDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  81

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  82   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  141

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN L+L+DNKL+G+IPSQ
Sbjct  142  CKFLNALVLSDNKLSGSIPSQ  162



>emb|CDY14686.1| BnaC05g19430D [Brassica napus]
Length=597

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  196  FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgle  375
            F    AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+
Sbjct  13   FLSSFAEDDVLCLQGLKKSLTDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQ  72

Query  376  lrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIP  555
            L+ + L G++P +L+ C SLQ+LDLSGN LSG IPSQIC WLPYLVTLDLS N L+GPIP
Sbjct  73   LQSMQLAGQIPESLKLCRSLQSLDLSGNDLSGAIPSQICSWLPYLVTLDLSGNKLSGPIP  132

Query  556  PDLGNCTYLNKLILNDNKLTGNIPSQ  633
              +  C +LN L+L+DNKL+G++P++
Sbjct  133  TQIVECKFLNALVLSDNKLSGSVPTE  158



>ref|XP_009115452.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=598

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  166  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
             L L  +++ F    AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN
Sbjct  4    LLPLLFIIISFLSPNAEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLTGVSCWN  63

Query  346  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  525
            + ENR+I L+L+ + L G++P +L+ C SLQ+LDLSGN LSG IPSQIC WLPYLVTLDL
Sbjct  64   EKENRIISLQLQSMQLAGQIPESLKLCRSLQSLDLSGNDLSGAIPSQICSWLPYLVTLDL  123

Query  526  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQ  633
            S N L+GPIP  +  C +LN L+L+DNKL+G++P++
Sbjct  124  SGNKLSGPIPTQIVECKFLNALVLSDNKLSGSVPTE  159



>ref|XP_006357223.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=615

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E+DVKCL+G+K +  DP   L  W+F NT+   ICK VGV+CWN+ ENR++ L+L  ++L
Sbjct  28   ENDVKCLEGIKSALSDPLNKLSSWSFSNTSVASICKLVGVSCWNEKENRLLSLQLPSMSL  87

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P ALQ C SLQ+LDLSGN  SG IP QIC WLPYLV LDLSSN  +G IPP+  NC
Sbjct  88   SGSLPPALQFCTSLQSLDLSGNSFSGPIPVQICSWLPYLVNLDLSSNSFSGSIPPEFINC  147

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+LNDNKLTG+IP +I  L
Sbjct  148  KFLNTLVLNDNKLTGSIPFEIGRL  171



>emb|CDY16228.1| BnaA09g29620D [Brassica napus]
Length=599

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  20   AEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  79

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G++P +L+ C SLQ+LDLSGN LSG IPSQIC WLPYLVTLDLS N L+GPIP  +  
Sbjct  80   LAGQIPESLKLCRSLQSLDLSGNDLSGAIPSQICSWLPYLVTLDLSGNKLSGPIPTQIVE  139

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN L+L+DNKL+G++P++
Sbjct  140  CKFLNALVLSDNKLSGSVPTE  160



>ref|XP_006303937.1| hypothetical protein CARUB_v10008631mg [Capsella rubella]
 gb|EOA36835.1| hypothetical protein CARUB_v10008631mg [Capsella rubella]
Length=601

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLTDPSSRLSTWSFPNSSASSICKLSGVSCWNEKENRIISLQLQSMQ  83

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  84   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  143

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN LIL+DNKL+G+IPSQ
Sbjct  144  CKFLNALILSDNKLSGSIPSQ  164



>ref|XP_010498954.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=598

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  21   AEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  80

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N+L G IP  +  
Sbjct  81   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNNLGGSIPTQIVE  140

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN L+L+DNKL+G+IPSQ
Sbjct  141  CKFLNALVLSDNKLSGSIPSQ  161



>ref|XP_007216971.1| hypothetical protein PRUPE_ppa003100mg [Prunus persica]
 gb|EMJ18170.1| hypothetical protein PRUPE_ppa003100mg [Prunus persica]
Length=604

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             V EDDVKCLQ +K S +DP G L  W+F NT+   +CKFVGV CWND ENR++ LELR+
Sbjct  29   AVVEDDVKCLQSLKQSLKDPLGKLVSWDFRNTSVVSMCKFVGVTCWNDRENRILNLELRD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G +   ++ C SLQNLDL GN LSG+IP  IC WLP+LVTLD S+ND +G IP DL
Sbjct  89   MELSGAIAKDIEYCSSLQNLDLGGNKLSGSIPPDICTWLPFLVTLDFSNNDFSGSIPTDL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             +C YLN LIL+DNKL+G IP + +SL
Sbjct  149  QHCKYLNNLILSDNKLSGTIPYEFSSL  175



>ref|XP_002890616.1| hypothetical protein ARALYDRAFT_889992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66875.1| hypothetical protein ARALYDRAFT_889992 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  83

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  84   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  143

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN LIL+DNKL+G+IPSQ
Sbjct  144  CKFLNALILSDNKLSGSIPSQ  164



>ref|NP_174039.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|O04567.1|Y1719_ARATH RecName: Full=Probable inactive receptor kinase At1g27190; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF79872.1|AC000348_25 T7N9.25 [Arabidopsis thaliana]
 gb|AAU94364.1| At1g27190 [Arabidopsis thaliana]
 gb|ACN59234.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30792.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=601

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  83

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  84   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  143

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN LIL+DNKL+G+IPSQ
Sbjct  144  CKFLNALILSDNKLSGSIPSQ  164



>ref|XP_006416011.1| hypothetical protein EUTSA_v10009684mg [Eutrema salsugineum]
 gb|ESQ34364.1| hypothetical protein EUTSA_v10009684mg [Eutrema salsugineum]
Length=601

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CLQG+K S  DP   L  W+F N +A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLTDPSSRLTTWSFPNASASSICKLTGVSCWNEKENRIISLQLQSMQ  83

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G++P +L+ C SLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G IP  + +
Sbjct  84   LAGQIPESLKLCRSLQSLDLSGNDLSGSIPPQICSWLPYLVTLDLSGNKLSGSIPTQIAD  143

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN L+L+DNKL+G IPSQ
Sbjct  144  CKFLNALVLSDNKLSGTIPSQ  164



>ref|XP_004298597.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=605

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL GVK S  DP G L  WN  N +   ICK VGV+CWN+ ENR++ L+L  ++L
Sbjct  24   EDDLACLAGVKSSLADPGGRLSQWNLANNSVASICKLVGVSCWNEKENRLLSLQLPSMSL  83

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE+P +L+ CHSLQ LDLSGN LSG++P QIC WLPYLVTLDLS+N L+G IPP++ NC
Sbjct  84   AGELPESLKYCHSLQTLDLSGNALSGSVPPQICDWLPYLVTLDLSNNRLSGSIPPEIVNC  143

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+LNDN  +G+IP ++  L
Sbjct  144  KFLNTLLLNDNGFSGSIPYELGRL  167



>ref|XP_010460207.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=598

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +1

Query  175  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  354
            L I  +L     AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ E
Sbjct  9    LFITTLLCSSSSAEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLSGVSCWNEKE  68

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            NR+I L+L+ + L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N
Sbjct  69   NRIISLQLQSMQLAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGN  128

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQ  633
            +L G IP  +  C +LN L+L+DNKL+G+IPSQ
Sbjct  129  NLGGSIPTQIVECKFLNALVLSDNKLSGSIPSQ  161



>gb|KDO72412.1| hypothetical protein CISIN_1g040267mg [Citrus sinensis]
Length=538

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +1

Query  202  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  381
               AEDDVKCL G+K SF DP G L  W+  N++ GFIC+F GV+CWN  ENR++ LEL 
Sbjct  6    TATAEDDVKCLAGIK-SFNDPQGKLSSWSLTNSSVGFICRFNGVSCWNGLENRILSLELE  64

Query  382  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  561
            E+NL G+VP +LQ C SLQ L+LS N L G IP+Q+C+W PYLV+LDLS+NDL+G IP +
Sbjct  65   EMNLSGQVPESLQSCKSLQVLNLSTNNLFGKIPTQLCKWFPYLVSLDLSNNDLSGTIPHE  124

Query  562  LGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LGNC YLN L L+ N+L+G +P Q++SL
Sbjct  125  LGNCVYLNTLYLSYNRLSGPLPPQLSSL  152



>ref|XP_004148679.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cucumis 
sativus]
 ref|XP_004168438.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cucumis 
sativus]
 gb|KGN52424.1| hypothetical protein Csa_5G633220 [Cucumis sativus]
Length=604

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFIC-KFVGVACWNDNENRVIglelre  384
            V EDD++CL+GVK +  DP G L  W+F NT+ G +C KFVG++CWND ENR++ LEL++
Sbjct  28   VPEDDIRCLRGVKNALVDPIGRLSSWDFKNTSVGHLCDKFVGLSCWNDRENRILSLELKD  87

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G +   LQ C SLQ LDLSGN  SG IP  IC WLPYLV++DLS+N  TG IP DL
Sbjct  88   MKLSGSISEDLQYCVSLQKLDLSGNSFSGEIPPHICEWLPYLVSMDLSNNQFTGSIPADL  147

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
              C+YLN LIL+DN+L+G IP ++ SL
Sbjct  148  ARCSYLNSLILSDNELSGTIPVELTSL  174



>ref|XP_008800372.1| PREDICTED: probable inactive receptor kinase At1g27190 [Phoenix 
dactylifera]
Length=618

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +1

Query  202  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  381
            V   EDDV+CL+GV+ +   PDG L  WNF N T GF+C FVGV+CWN  ENRVI L L 
Sbjct  25   VATDEDDVRCLRGVQQALSAPDGGLN-WNFSNKTVGFVCNFVGVSCWNPQENRVIALSLP  83

Query  382  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  561
             ++L G +P ALQ C +   LDLS N LSG IPS +C WLP+LVTLDLSSN L+GP+PP+
Sbjct  84   SMSLSGTIPSALQYCRAATTLDLSSNSLSGLIPSDLCDWLPFLVTLDLSSNSLSGPVPPE  143

Query  562  LGNCTYLNKLILNDNKLTGNIPSQIASL  645
            L  C +LN L+L+ N  +G IP+ ++ L
Sbjct  144  LSKCRFLNALLLSSNSFSGPIPASLSQL  171



>ref|XP_008458707.1| PREDICTED: probable inactive receptor kinase At1g27190 [Cucumis 
melo]
Length=604

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFIC-KFVGVACWNDNENRVIglelre  384
            V EDD++CL+GVK +  DP G L  W+F NT+ G +C KFVG++CWND ENR++ LEL++
Sbjct  28   VPEDDIRCLRGVKNALVDPLGRLSSWDFKNTSVGHLCNKFVGLSCWNDRENRILSLELKD  87

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G +   LQ C SLQ LDLSGN  SG IP  IC WLPYLV++DLS+N  TG IP DL
Sbjct  88   MKLSGSISEDLQYCVSLQKLDLSGNSFSGEIPPHICEWLPYLVSMDLSNNQFTGSIPADL  147

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
              C+YLN LIL+DN+L+G IP ++ SL
Sbjct  148  ARCSYLNSLILSDNELSGTIPVELTSL  174



>ref|XP_010683354.1| PREDICTED: probable inactive receptor kinase At1g27190 [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            +DDVKCLQGVK S  DP   L  W+FDNT+   ICKF GV+CWN+ E+R++ L+L  + L
Sbjct  20   DDDVKCLQGVKSSISDPQNRLSNWHFDNTSVDSICKFTGVSCWNEKEDRLLSLQLPAMFL  79

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +LQ C SLQ LD SGN +SG IP QIC WLPYLVTLDLS N+L+G IP  + NC
Sbjct  80   AGKLPSSLQFCRSLQTLDFSGNQISGEIPPQICDWLPYLVTLDLSGNELSGSIPTQIENC  139

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LIL++NKL+G++P ++  L
Sbjct  140  KFLNSLILSNNKLSGSVPFELGRL  163



>gb|KDP21268.1| hypothetical protein JCGZ_21739 [Jatropha curcas]
Length=601

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = +1

Query  166  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
            FL L  L V+F +   EDDV CL+G+K SF DP   L  W+  N +   ICK  GVACWN
Sbjct  6    FLFLFTLPVVFAI---EDDVTCLEGLKNSFTDPLSRLASWDLTNNSVASICKLNGVACWN  62

Query  346  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  525
            + ENR+I L L    L G++P +L+ C SLQ LDLS N LSG+IP QIC WLPY+VTLDL
Sbjct  63   EKENRIISLNLPASELSGQLPDSLKYCRSLQTLDLSNNALSGSIPPQICTWLPYIVTLDL  122

Query  526  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            S N  +G IPP++ NC +LN LILNDNKL+G+IP  +  L
Sbjct  123  SGNSFSGAIPPEIVNCKFLNNLILNDNKLSGSIPYGLGGL  162



>ref|XP_006849112.1| hypothetical protein AMTR_s00028p00246730 [Amborella trichopoda]
 gb|ERN10693.1| hypothetical protein AMTR_s00028p00246730 [Amborella trichopoda]
Length=620

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            VAEDDV+CL+  K    DP GNL  WNF NT+AGFIC F GV CW++NEN+V+ L L  L
Sbjct  40   VAEDDVQCLRATKSELLDPQGNLVSWNFGNTSAGFICAFGGVTCWHENENKVLDLRLSSL  99

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
            +L G VP +L+ C S+ +LD+S N +SG IP+ +C WLP+LVTLDLS N L+G IPP+L 
Sbjct  100  SLSGPVPSSLRLCSSMTSLDISKNSISGPIPANLCDWLPFLVTLDLSHNQLSGHIPPELV  159

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC +LN L L+ NKL+G IP Q+ASL
Sbjct  160  NCRFLNTLRLDSNKLSGQIPYQLASL  185



>ref|XP_009602624.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=617

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 1/145 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTT-AGFICKFVGVACWNDNENRVIglelreln  390
            E+D+KCL+G+K +  DP   L  W+F NT+ A  ICK VGV+CWN+ ENR+I L+L  ++
Sbjct  28   ENDIKCLEGIKSALSDPLNKLSSWSFSNTSVAASICKLVGVSCWNEKENRLISLQLPSMS  87

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G +P +LQ C SLQ+LDLSGN LSG++P Q+C WLPYLV LDLS N  +G IPP+  N
Sbjct  88   LSGSLPPSLQYCTSLQSLDLSGNSLSGSLPVQLCSWLPYLVNLDLSGNSFSGSIPPEFIN  147

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C +LN L+LNDNKLTG+IP +I  L
Sbjct  148  CKFLNTLLLNDNKLTGSIPFEIGRL  172



>ref|XP_009799074.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
sylvestris]
Length=617

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 1/145 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTT-AGFICKFVGVACWNDNENRVIglelreln  390
            E+D+KCL+G+K +  DP   L  W+F NT+ A  ICK VGV+CWN+ ENR+I L+L  ++
Sbjct  28   ENDIKCLEGIKSALSDPLNKLSSWSFSNTSIAASICKLVGVSCWNEKENRLISLQLPSMS  87

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G +P +LQ C SLQ+LDLSGN LSG++P Q+C WLPYLV LDLS N  +G IPP+  N
Sbjct  88   LSGSLPPSLQYCTSLQSLDLSGNSLSGSLPVQLCSWLPYLVNLDLSGNSFSGSIPPEFIN  147

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C +LN L+LNDNKLTG+IP +I  L
Sbjct  148  CKFLNTLLLNDNKLTGSIPFEIGRL  172



>ref|XP_011043889.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=609

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+GVK SF DP G L  W F+N +  +ICK  GV+CWN+ ENR+I L+L    L
Sbjct  24   EDDVTCLEGVKNSFTDPLGRLTSWAFNNNSVAYICKLNGVSCWNEKENRIISLQLPLFQL  83

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+VTLDLS N  +GPIPP++ NC
Sbjct  84   SGKLPESLKYCHSLTTLDLSNNDLSGPIPPEICNWLPYVVTLDLSGNKFSGPIPPEIVNC  143

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LIL+ NKLTG+IP     L
Sbjct  144  KFLNTLILSGNKLTGSIPYGFGRL  167



>ref|XP_006372487.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP50284.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=606

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+GVK SF DP G L  W F+N +  F+CK  GV+CWN+ ENR+I L+L    L
Sbjct  23   EDDITCLEGVKKSFTDPLGRLTSWTFNNNSVAFVCKLNGVSCWNEKENRIISLQLSSFQL  82

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+V+LDLS N  +GPIPP++ NC
Sbjct  83   SGKLPESLKYCHSLTTLDLSSNDLSGPIPPEICNWLPYIVSLDLSGNKFSGPIPPEIVNC  142

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LIL+ N+LTG+IP  +  L
Sbjct  143  KFLNNLILSGNQLTGSIPFGLGRL  166



>ref|XP_006595242.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Glycine 
max]
Length=234

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 114/162 (70%), Gaps = 2/162 (1%)
 Frame = +1

Query  166  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
            F+ L  L V F     ED V+CL+G++ +  DP   L  W FDNTT+GFIC F GV+CW 
Sbjct  14   FITLLGLHVYFASSQVEDYVRCLRGIEDTVSDPQARLATWRFDNTTSGFICDFEGVSCWG  73

Query  346  DNENRVIglelrelnlg-geVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  519
              ENRV+GL+LR+  L   ++P AL+ C  S+Q LDL+ +  +  IP +IC W+P+LV++
Sbjct  74   RRENRVLGLDLRDTKLSGNKIPEALKYCGKSIQRLDLASDSFTSKIPREICTWMPFLVSI  133

Query  520  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            DLSSN L+G IPP + NC+YLN+L+L++N+L+G+IPS+  SL
Sbjct  134  DLSSNKLSGHIPPTIVNCSYLNELVLSNNQLSGSIPSEFGSL  175



>gb|ABR16721.1| unknown [Picea sitchensis]
Length=613

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            VAE+D++CLQ  K   +DP  NL  WNFDN+T GFIC F+G+ CW++++N+V+ + L+E+
Sbjct  29   VAENDIQCLQSTKNHLKDPQDNLYTWNFDNSTKGFICNFLGITCWHNDDNKVLSISLQEM  88

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L GE P  ++ C S+ +L LS N L+GTIP ++C+WLPYLVT+DLS N+ TG IP +L 
Sbjct  89   GLQGEFPPGVKYCGSMTSLTLSQNSLTGTIPKELCQWLPYLVTIDLSQNEFTGSIPAELH  148

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN L LN N+LTG IP Q++ L
Sbjct  149  NCTYLNILRLNGNQLTGEIPWQLSRL  174



>ref|XP_004238738.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=610

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E+DVKCL+G+K +F DP   L  W+F NT+   ICK VGV+CWN+ ENR++ L+L  ++L
Sbjct  28   ENDVKCLEGIKSAFSDPLNKLSSWSFSNTSVASICKLVGVSCWNEKENRLLSLQLPSMSL  87

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ C SLQ+LDLSGN  SG IP QIC WLPYLV LDLSSN  +G IPP+  NC
Sbjct  88   SGSLPSSLQFCSSLQSLDLSGNSFSGPIPVQICSWLPYLVNLDLSSNYFSGSIPPEFINC  147

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+LNDNKLTG+IP +I  L
Sbjct  148  KFLNTLLLNDNKLTGSIPFEIGRL  171



>ref|XP_009105677.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Brassica rapa]
Length=596

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +1

Query  181  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  360
            I+L+      AEDDV CL+G+K S  DP G L  W+F N+++  ICK  GV+CWN  ENR
Sbjct  14   IILISSSSSYAEDDVLCLKGLKNSLTDPSGRLSTWSFPNSSSSSICKLTGVSCWNAKENR  73

Query  361  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  540
            ++ L L  + L G++P +L+ C SLQ+LDLSGN +SG IP +IC WLPYLVTLDLS N L
Sbjct  74   ILSLHLPSMQLAGKIPESLKLCRSLQSLDLSGNDISGEIPPEICSWLPYLVTLDLSGNKL  133

Query  541  TGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +G IP ++ NC +LN L LN+NKLTG +P Q+  L
Sbjct  134  SGEIPSEIVNCKFLNGLALNENKLTGPVPFQLTRL  168



>ref|XP_011038318.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=607

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+GVK SF DP   L  W F+N +  F+CK  GV+CWN+ ENR+I L+L    L
Sbjct  23   EDDITCLEGVKKSFTDPLSRLSSWTFNNNSVAFVCKLNGVSCWNEKENRIISLQLSSFEL  82

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+V LDLS N  +GPIPP++ NC
Sbjct  83   SGKLPESLKYCHSLTTLDLSSNDLSGPIPPEICNWLPYIVNLDLSGNKFSGPIPPEIVNC  142

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LIL+ N+LTG+IP  +  L
Sbjct  143  KFLNNLILSRNQLTGSIPFGLGRL  166



>ref|XP_003580015.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brachypodium 
distachyon]
Length=630

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+GVK   +DPDG L  WNF NT+AG +C + GV CWN  E+RVI L L    L
Sbjct  35   EDDLRCLRGVKDGLQDPDGRLASWNFRNTSAGALCDYSGVTCWNPQESRVITLSLSGFGL  94

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G VP +LQ C S    DLSGNGL G IP  +C W+P++V+LDLS N L+GP+P +L NC
Sbjct  95   RGHVPSSLQYCGSANTFDLSGNGLDGPIPPALCDWIPFVVSLDLSGNKLSGPLPAELANC  154

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+DN  TG IP+ +A L
Sbjct  155  RFLNSLKLSDNAFTGQIPASLARL  178



>ref|XP_004489358.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cicer 
arietinum]
Length=601

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            V ED+V+CL+G+K +  D +  L  W FDNTT GFIC FVGV CWN  ENRV+GLEL+ +
Sbjct  24   VEEDNVRCLKGIKQTLVDSENRLSTWRFDNTTVGFICDFVGVTCWNLRENRVLGLELQGM  83

Query  388  nlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
             L G +P AL+ C  SLQ LDL  N LS  IP+QIC W+P+LVT+DLS N+L G IP  +
Sbjct  84   KLSGMIPEALKYCGQSLQKLDLGSNSLSSVIPTQICSWMPFLVTMDLSDNNLEGSIPSTI  143

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC+YLN+L+L+DN   GNIP +  SL
Sbjct  144  VNCSYLNELMLSDNNFVGNIPYEFGSL  170



>gb|KFK41423.1| hypothetical protein AALP_AA2G128900 [Arabis alpina]
Length=595

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +1

Query  181  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  360
            +L +L     AEDDV CL+G+K S  DP   L  W F NT++  ICK  GV+CWN  ENR
Sbjct  8    LLTILISSSNAEDDVLCLKGLKSSLTDPSNRLNTWVFSNTSS--ICKLTGVSCWNAKENR  65

Query  361  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  540
            +I L+L+ + L G++P +L+ C SLQ+LDLS N  SG+IPS+IC WLPYLVTLDLS N L
Sbjct  66   IISLQLQSMQLAGQIPESLKLCRSLQSLDLSNNDFSGSIPSEICSWLPYLVTLDLSGNKL  125

Query  541  TGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIA  639
             G IP  +  C +LN L LNDNKLTG+IPSQ+ 
Sbjct  126  GGSIPSRIVECKFLNSLALNDNKLTGSIPSQLT  158



>gb|KHN34180.1| Putative inactive receptor kinase [Glycine soja]
Length=610

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 109/145 (75%), Gaps = 1/145 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV CL+G+K +  DP   L  W FDNTT GFIC FVGV+CWN  ENRVIGL+L++  L
Sbjct  29   EDDVTCLKGIKETLSDPLNRLSNWRFDNTTVGFICDFVGVSCWNQRENRVIGLDLQDFKL  88

Query  394  ggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
             G++P AL+ C  S+Q LDL+ N  S  IP +IC W+P+LV++DLSSN L+G IPP + N
Sbjct  89   SGKIPEALKYCGKSIQRLDLASNSFSSEIPHEICTWMPFLVSIDLSSNQLSGVIPPTIDN  148

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C+YLN+L+L++N+L+G+IP +  +L
Sbjct  149  CSYLNELVLSNNQLSGSIPFEFGNL  173



>ref|NP_177157.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGI5.1|Y1699_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g69990; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59270.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE35006.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=591

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 112/161 (70%), Gaps = 1/161 (1%)
 Frame = +1

Query  163  RFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACW  342
            + + +  +++L     AEDDV CL+G K S +DP   L  W+F N+++  ICK  GV+CW
Sbjct  2    KTISIFFVIILMSSSHAEDDVLCLKGFKSSLKDPSNQLNTWSFPNSSSS-ICKLTGVSCW  60

Query  343  NDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLD  522
            N  ENR++ L+L+ + L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLVTLD
Sbjct  61   NAKENRILSLQLQSMQLSGQIPESLKLCRSLQSLDLSFNDFSGLIPSQICSWLPYLVTLD  120

Query  523  LSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LS N L+G IP  + +C +LN L LN NKLTG+IPS++  L
Sbjct  121  LSGNKLSGSIPSQIVDCKFLNSLALNQNKLTGSIPSELTRL  161



>emb|CDY38780.1| BnaA07g28520D [Brassica napus]
Length=600

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CL+G+K S  DP G L  W+F N+++  ICK  GV+CWN  ENR++ L L  + 
Sbjct  28   AEDDVLCLKGLKNSLTDPSGRLSTWSFPNSSSSSICKLTGVSCWNAKENRILSLHLPSMQ  87

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G++P +L+ C SLQ+LDLSGN +SG IP +IC WLPYLVTLDLS N L+G IP ++ N
Sbjct  88   LAGKIPESLKLCRSLQSLDLSGNDISGEIPPEICSWLPYLVTLDLSGNKLSGEIPSEIVN  147

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C +LN L LN+NKLTG +P Q+  L
Sbjct  148  CKFLNGLALNENKLTGPVPFQLTRL  172



>ref|XP_010912844.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Elaeis guineensis]
Length=614

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E+DV CL+GV+ S  DP+G+L  WNF NTT GF+C FVGV+CWN  ENRVI L L  ++L
Sbjct  27   ENDVNCLRGVQESL-DPNGSLN-WNFANTTVGFVCNFVGVSCWNPQENRVIALSLPSMSL  84

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P ALQ C +   LDLS N LSG IPS +C WLPYLVTLDLSSN L+G IPP+L  C
Sbjct  85   AGSIPSALQYCRTATTLDLSSNSLSGPIPSSLCDWLPYLVTLDLSSNSLSGLIPPELSKC  144

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+L+ N  +G IP+ ++ L
Sbjct  145  RFLNTLLLSSNSFSGPIPASLSQL  168



>gb|KHN13260.1| Putative inactive receptor kinase [Glycine soja]
Length=608

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  190  VLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIg  369
            V F     E DV+CL+G+K +  DP   L  W FDNTT GFICKF GV+CWND ENRV+ 
Sbjct  23   VFFVSSQVEGDVRCLKGIKETLSDPLNRLSDWRFDNTTIGFICKFAGVSCWNDRENRVLS  82

Query  370  lelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  546
            L LR+  L G++P AL+ C  ++Q LDL+ N  S  IP  IC W+P+LV+LDLSSN L+G
Sbjct  83   LTLRDFKLSGKIPEALKYCGKNIQKLDLASNSFSLEIPRNICSWMPFLVSLDLSSNQLSG  142

Query  547  PIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             IPP +  C+YLN+L+L++N+L+G+IP +  SL
Sbjct  143  FIPPTIDKCSYLNELVLSNNQLSGSIPFEFGSL  175



>ref|XP_009342387.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
 ref|XP_009342390.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
Length=226

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 106/156 (68%), Gaps = 2/156 (1%)
 Frame = +1

Query  181  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNEN  357
            +L   F +GV E D+ CL+ +K S  DP G L L W+F NTT GFICKF+G+ CW+ NEN
Sbjct  26   LLTCSFSLGV-ESDISCLKSIKASLEDPSGYLSLSWDFSNTTEGFICKFLGIECWHPNEN  84

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            +V+ ++L +L L G+ P  L +C SL  LDLSGN LSG +P  I R L ++ TLDLSSN 
Sbjct  85   KVLNIKLSDLGLKGQFPRGLSNCSSLTGLDLSGNKLSGPLPEDIGRILAFITTLDLSSNS  144

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +G IPP L NC+YLN L L +N+ +G IP Q+A L
Sbjct  145  FSGKIPPSLSNCSYLNVLKLENNEFSGKIPQQLAQL  180



>ref|XP_002268171.1| PREDICTED: probable inactive receptor kinase At1g27190 [Vitis 
vinifera]
Length=611

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  199  GVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgle  375
             V VA EDDV CLQG+K S  DPD  +  W F NT+A FIC  VGV+CWN  E+R+I L+
Sbjct  24   AVAVAIEDDVVCLQGLKDSLTDPDDKISTWRFTNTSASFICNLVGVSCWNAQESRIISLQ  83

Query  376  lrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIP  555
            L ++NL G +P +LQ C SLQ+L LSGN +SG+IP QIC WLPY+VTLDLS NDLTGPIP
Sbjct  84   LPDMNLIGTLPDSLQHCRSLQSLGLSGNRISGSIPDQICTWLPYVVTLDLSHNDLTGPIP  143

Query  556  PDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            P++ NC +LN LILN+N L+G IP +I  L
Sbjct  144  PEMVNCKFLNNLILNNNGLSGMIPYEIGRL  173



>ref|XP_007044441.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY00273.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=612

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+G+K S  DPD  L  W F+N ++ F+C   GV+CWN+ ENR+I L L  + L
Sbjct  24   EDDITCLEGLKSSLTDPDSPLATWTFNNRSSTFVCNLTGVSCWNEKENRIISLLLSSMKL  83

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ C SLQ LDLS N LSG IP+ IC WLPYLV LDLS N L+G IP  + NC
Sbjct  84   SGQLPDSLKYCRSLQILDLSNNSLSGPIPNDICSWLPYLVRLDLSGNRLSGSIPTQIANC  143

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+L++NKL+G+IP ++A L
Sbjct  144  KFLNDLVLDNNKLSGSIPYELARL  167



>ref|NP_001174416.1| Os05g0399800 [Oryza sativa Japonica Group]
 dbj|BAH01231.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63653.1| hypothetical protein OsJ_18470 [Oryza sativa Japonica Group]
 dbj|BAH93144.1| Os05g0399800 [Oryza sativa Japonica Group]
Length=255

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV+CL+G+K S  DPDG L  W F NT+AG IC+  GV+CWN +E+R+I L L    L
Sbjct  29   EDDVRCLEGLKTSLGDPDGRLASWTFSNTSAGAICELSGVSCWNPDESRIIALSLSGFGL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P  LQ C ++  LDLS N L G IP  +C WLP++V LDLS N L+GPIP +L NC
Sbjct  89   TGAIPSELQFCSAITTLDLSSNRLGGQIPPALCDWLPFVVNLDLSGNQLSGPIPAELANC  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             ++N L L+ N L+G IP+ +  L
Sbjct  149  KFINSLKLSANSLSGKIPASLVLL  172



>ref|XP_003618423.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago 
truncatula]
 gb|AES74641.1| LRR receptor-like kinase [Medicago truncatula]
Length=602

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 113/161 (70%), Gaps = 1/161 (1%)
 Frame = +1

Query  166  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
            F+  +  + L    V ED+V+CLQG++ +  + D  +  W F+N T GFIC FVGV CWN
Sbjct  10   FIVFAFWVTLSSSQVEEDNVRCLQGIQQNLGNSDSPISNWKFNNRTVGFICDFVGVTCWN  69

Query  346  DNENRVIglelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLD  522
              ENRV+GLEL+ + L G++P +L+ C  SLQ LDL  N LS  IP+QIC W+P+LVT+D
Sbjct  70   VRENRVLGLELKGMKLSGKIPESLKYCGQSLQRLDLGSNSLSSVIPTQICEWMPFLVTMD  129

Query  523  LSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LS N+L G IP  + NC+YLN+L+L++N LTG+IP +I SL
Sbjct  130  LSGNNLNGEIPHTIVNCSYLNELMLDNNHLTGSIPYEITSL  170



>ref|XP_002888749.1| hypothetical protein ARALYDRAFT_894788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65008.1| hypothetical protein ARALYDRAFT_894788 [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF-ICKFVGVACWNDNENRVIglelrel  387
            +EDD+ CL+G+K S +DP   L  W+F N+++   ICK  GV+CWN  ENR++ L+L+ +
Sbjct  18   SEDDILCLKGLKSSLKDPSNQLNTWSFPNSSSSSPICKLTGVSCWNAKENRILSLQLQSM  77

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLV+LDLS N L+G IP  + 
Sbjct  78   QLSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVSLDLSGNKLSGSIPSQIV  137

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            +C +LN L+LNDNKLTG+IPS++  L
Sbjct  138  DCKFLNSLVLNDNKLTGSIPSELTGL  163



>ref|XP_010415671.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=594

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +1

Query  181  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVGVACWNDNE  354
             +++L     AED+V CL+G+K S +DP   L  W+F N+++    ICK  GV+CWN  E
Sbjct  9    FVIILIPSSYAEDEVLCLKGLKASLKDPSNQLSTWSFPNSSSSSSSICKLTGVSCWNAKE  68

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            NR+I L+L+ + L G++P +L+ C SLQ+LDLS NG SG IPSQIC WLPYLVTL+LS N
Sbjct  69   NRIISLQLQSMQLSGQIPESLKLCRSLQSLDLSDNGFSGLIPSQICSWLPYLVTLNLSRN  128

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQ  633
             L G IP  + +C +LN L LN NKLTG+IPSQ
Sbjct  129  KLGGSIPSQVVDCKFLNTLALNKNKLTGSIPSQ  161



>ref|XP_007151168.1| hypothetical protein PHAVU_004G023600g [Phaseolus vulgaris]
 gb|ESW23162.1| hypothetical protein PHAVU_004G023600g [Phaseolus vulgaris]
Length=265

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 1/155 (1%)
 Frame = +1

Query  184  LLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRV  363
             L  F      DDV+CL+G+K +  DP+ +L  W F NTT GFIC F GV CWN +ENRV
Sbjct  19   FLSFFASSQVADDVECLRGIKATLSDPEASLATWRFGNTTPGFICNFEGVTCWNSSENRV  78

Query  364  IglelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  540
            + LEL+   L G +P +L+ C  SLQ L LS N LS  IP +IC WLP+LV++D S N L
Sbjct  79   LDLELQSFKLSGRIPESLKYCGKSLQRLSLSNNSLSSEIPIEICTWLPFLVSVDFSRNRL  138

Query  541  TGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +G IPP   NC+YLN+L+L+DN+L+G IP++  SL
Sbjct  139  SGAIPPSFSNCSYLNELVLSDNELSGAIPTEFGSL  173



>gb|EAY97968.1| hypothetical protein OsI_19886 [Oryza sativa Indica Group]
Length=255

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV+CLQG+K S  DPDG L  W F NT+ G IC+  GV+CW+ +E+R+IGL L    L
Sbjct  29   EDDVRCLQGIKTSLSDPDGRLASWTFSNTSTGAICELSGVSCWSPDESRIIGLSLSGFGL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P  LQ C ++  LDLS N L G IP  +C WLP++V LDLS N L+GPIP +L NC
Sbjct  89   TGAIPSELQFCSAITALDLSSNRLGGQIPPALCDWLPFVVNLDLSGNQLSGPIPAELANC  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             ++N L L+ N L+G IP+ +  L
Sbjct  149  KFINSLKLSANSLSGKIPASLVLL  172



>ref|XP_009385796.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=611

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 102/147 (69%), Gaps = 2/147 (1%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
            G AEDDV+CL GVK S  D    LG WNF N T GF+C FVGV+CWN  ENRV+ L L+ 
Sbjct  26   GAAEDDVRCLTGVKTSL-DRGHTLG-WNFSNATVGFVCSFVGVSCWNLQENRVLALNLKS  83

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            ++L G VP  LQ C +   LDLS N +SG IP+++C WLPYLVTLDLS+N  TG IPP L
Sbjct  84   MSLAGSVPSDLQYCSAANVLDLSSNTISGPIPNELCSWLPYLVTLDLSNNQFTGGIPPTL  143

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC +LN L+L  N+L G IP+ ++ L
Sbjct  144  SNCRFLNTLVLAGNQLQGAIPATLSQL  170



>ref|XP_009600980.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009600987.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009600992.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=584

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = +1

Query  130  ADFRMVGFGFSRFLKLSILLVLFGVGV---AEDDVKCLQGVKGSFRDPDGNLGLWNFDNT  300
             +FR   F F       +L++L  + V   AE+D  CL+ +K S +DP  NLG W+F+N 
Sbjct  4    TNFRTRSFFFICTFLGFLLILLSKISVCSAAENDFYCLKSIKDSLQDPFNNLGSWDFNNV  63

Query  301  TAGFICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIP  480
            T GFIC+F G+ CW+DNEN+V+ + L    L GE P  +++C SL NLDLSGN L G IP
Sbjct  64   TEGFICRFSGINCWHDNENKVLSITLSNYGLIGEFPRGVRNCTSLTNLDLSGNKLYGNIP  123

Query  481  SQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            S I   L Y+V LDLS N  +G IPPD+ NCTYLN L L++N L G IPS+I SL
Sbjct  124  SDISVILDYVVILDLSYNTFSGNIPPDIANCTYLNFLGLDNNNLEGEIPSRIGSL  178



>ref|XP_010098246.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74731.1| putative inactive receptor kinase [Morus notabilis]
Length=586

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+GV+ S  DP G L  W F N +   ICK  GV+CWN+ ENR+I ++L+ ++L
Sbjct  2    EDDMMCLEGVRKSLSDPLGKLRSWTFTNDSVASICKLAGVSCWNEKENRLISIQLQYMDL  61

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +L+ C SLQ LD S N LSG IP QIC WLPYLVTLDLS+N L+G I P++ NC
Sbjct  62   SGGLPESLKFCRSLQTLDFSNNHLSGPIPPQICTWLPYLVTLDLSNNRLSGSIAPEIVNC  121

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN LIL+ N+L+G IP ++  L
Sbjct  122  KFLNTLILDGNRLSGAIPYELGRL  145



>ref|XP_002446698.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor]
 gb|EES11026.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor]
Length=627

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+GVK    DP+G L  W+F NT+ G +C + G+ CWN  E+RV+ L L    L
Sbjct  35   EDDLRCLKGVKHDLSDPNGRLDDWDFKNTSGGAVCNYNGIGCWNMQESRVLSLSLSGFGL  94

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ C +   LDLS N L+GTI   +C WLP+LVTLDLSSN LTGPIP +L NC
Sbjct  95   VGSIPSSLQYCRAATTLDLSSNALAGTILPALCDWLPFLVTLDLSSNQLTGPIPAELANC  154

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+ N+L+G IP+ +A L
Sbjct  155  RFLNTLRLSGNQLSGQIPASLARL  178



>gb|ABR16056.1| unknown [Picea sitchensis]
Length=564

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             V EDD++CLQ +K + +DP G L  WNF+N T GFIC F+G+ CW+ NENRV+ ++L  
Sbjct  44   SVPEDDIRCLQTIKRTVKDPHGYLYTWNFNNKTDGFICSFLGIDCWHPNENRVLNIKLPG  103

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            ++L G  P   + C  +  LDLS N LSGTIP  + +WLPYL +LDLS N+  G IP ++
Sbjct  104  MSLQGSFPTGFEYCGRMTGLDLSDNNLSGTIPVNLSKWLPYLTSLDLSQNNFHGSIPAEI  163

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NCTYLN + L +N+L+G IP Q + L
Sbjct  164  ANCTYLNIIHLQENQLSGEIPWQFSRL  190



>ref|XP_010532925.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=612

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +1

Query  181  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVGVACWNDNE  354
            +L+  F     EDDV CL+G+K S +DP G LG W+F N+++    ICK  GV+CWN+ E
Sbjct  14   LLVCPFLCSSVEDDVLCLEGLKNSLQDPSGRLGGWSFSNSSSSAVSICKLTGVSCWNEKE  73

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            NR+I L+L+ + L G++P +L+ C SLQ LDLS NGLSG IPSQIC WLPYLVTLDLS N
Sbjct  74   NRIISLQLQSMQLAGQIPESLKFCRSLQYLDLSDNGLSGPIPSQICSWLPYLVTLDLSGN  133

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQ  633
             L G IP  +  C +LN LIL++NKL+G+IP +
Sbjct  134  KLGGSIPSQIVECKFLNSLILDENKLSGSIPME  166



>ref|XP_006653547.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Oryza 
brachyantha]
Length=602

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 92/144 (64%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV+CL+GVK S RDPDG L  W FDN ++  +C + GV CWN  E R+I L L    L
Sbjct  11   EDDVRCLRGVKKSLRDPDGRLSSWTFDNLSSSAVCSYSGVTCWNPQELRIIQLSLAGFGL  70

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P  LQ C     LDLSGN L G IPS +C W+P++V LDLS N L+GP+P +L NC
Sbjct  71   QGSIPSDLQFCSGATTLDLSGNALEGQIPSTLCDWIPFVVNLDLSGNQLSGPLPSELANC  130

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             ++N L L+ N  +G IP  +  L
Sbjct  131  RFVNSLKLSGNSFSGQIPDSLGRL  154



>gb|AEW22944.1| leucine-rich repeat receptor-like protein kinase, partial [Cenchrus 
ciliaris]
Length=597

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+GVK    DPD  L  W+F NT+A  +C F G+ CWN  E+RV+ L      L
Sbjct  4    EDDLRCLRGVKKELADPDDRLA-WDFSNTSAAAVCNFNGITCWNPQESRVMSLSFSGFGL  62

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ C +   LDLS N L G+IP  +C W+P+LV LDLSSN LTGP+P +L NC
Sbjct  63   QGSLPSSLQYCRAATTLDLSQNALDGSIPPALCDWVPFLVNLDLSSNKLTGPLPAELANC  122

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+ N+L+G IP+ +A L
Sbjct  123  RFLNSLKLSGNQLSGQIPASLARL  146



>ref|XP_010551471.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=604

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  157  FSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVG  330
            F  F  L IL+  F     EDDV CL+G+K S +DP G L  W+F N+++    +CK  G
Sbjct  6    FFTFFCLLILVSPFPCSSLEDDVLCLEGLKNSLKDPSGRLSGWSFSNSSSSAVSVCKLTG  65

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            V+CWN+ ENR+I L+L+ + L G++P +L+ C SLQ+LDLS N LSG IPSQIC WLPYL
Sbjct  66   VSCWNEKENRIISLQLQSMQLAGQIPESLKFCRSLQSLDLSDNDLSGPIPSQICSWLPYL  125

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQ  633
            VTLDLS N L G IP  + +C +LN L LNDNKL+G+IP++
Sbjct  126  VTLDLSGNKLGGSIPAQIVDCKFLNSLALNDNKLSGSIPTE  166



>ref|XP_010109951.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC24927.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=280

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 100/143 (70%), Gaps = 0/143 (0%)
 Frame = +1

Query  217  DDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  396
            +D+ CL+ +K SF DP G L  W+F+N T GFICKF+GV CW+ +EN+V+ + L ++ L 
Sbjct  26   NDIYCLKTIKKSFNDPYGYLASWDFNNNTEGFICKFIGVDCWHPDENKVLNIRLSDMGLR  85

Query  397  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  576
            GE P  +++C SL  LDLS N LSG IP  I + L Y+ +LDLSSN+ +G IP  L NCT
Sbjct  86   GEFPRGIENCTSLTGLDLSNNILSGPIPFDISKRLQYVTSLDLSSNNFSGEIPLSLANCT  145

Query  577  YLNKLILNDNKLTGNIPSQIASL  645
            YLN L L +NKLTGNIP Q+  L
Sbjct  146  YLNVLKLENNKLTGNIPLQLVQL  168



>ref|XP_009406402.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=599

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV+CL+GVK +  D DG L  WN  N T GF+C FVGV+CWN  ENRV+GL LR+++L
Sbjct  27   EDDVRCLRGVKATL-DRDGRLS-WNLSNGTVGFVCSFVGVSCWNPQENRVLGLNLRDMSL  84

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +   LQ C +   LDLS N +SG IP  +C WLPYLVTLDLS+N LTG IPP L  C
Sbjct  85   SGSIASDLQYCAAANVLDLSSNAISGAIPPDLCSWLPYLVTLDLSNNQLTGAIPPGLSGC  144

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+L  N+L G IP  +A L
Sbjct  145  RFLNTLVLAGNRLEGAIPPSLAQL  168



>ref|XP_008669246.1| PREDICTED: probable inactive receptor kinase At1g27190 [Zea mays]
 tpg|DAA37241.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=626

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD++CL+GVK    DP+  L  W+F NT+ G +C + G+ CWN  E+RV+ L L    L
Sbjct  34   EDDLRCLRGVKHDLADPNERLADWDFKNTSGGAVCNYNGIGCWNLQESRVLSLSLSGFGL  93

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ C +   LDLS N L GTI   +C WLP+LVTLDLSSN L GPIP +L NC
Sbjct  94   VGSIPSSLQYCRAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLNGPIPAELANC  153

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+ N+L+G IP+ +A L
Sbjct  154  RFLNSLRLSGNQLSGQIPASLARL  177



>dbj|BAK03355.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD +CL+GVK   RDP+G L  W   N +AG +C F G++CWN  E+R++ + L    L
Sbjct  34   EDDARCLKGVKAELRDPEGRLSSWT-TNASAGAVCDFSGISCWNPQESRILAVSLSGFGL  92

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P  LQ C +   LDLS N L G IP  +C WLP++VTLDLS N L+GP+P +L +C
Sbjct  93   QGKIPPDLQYCRAATTLDLSSNALEGPIPPALCDWLPFVVTLDLSGNRLSGPLPSELASC  152

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+DN  +G IP+ +A L
Sbjct  153  RFLNSLKLSDNAFSGQIPASLARL  176



>gb|KJB31374.1| hypothetical protein B456_005G188100 [Gossypium raimondii]
Length=611

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDD+ CL+G+K S    D  L  W+F N ++  +C+  GV+CWN+ ENR+I L L  + L
Sbjct  25   EDDIACLEGLKNSLTGADSPLSTWSFSNRSSTSVCQLTGVSCWNEKENRIISLHLPSMKL  84

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G++P +L+ C SLQ LDLS N LSG IPS IC WLPYLV LDLS N  +G IP  + +C
Sbjct  85   SGQLPDSLKYCRSLQILDLSNNSLSGPIPSDICSWLPYLVHLDLSGNLFSGSIPLQIVDC  144

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L+L+DNKL+G+IP ++A L
Sbjct  145  KFLNDLVLSDNKLSGSIPYELARL  168



>gb|AGI92776.1| RLP1.801.4 [Triticum aestivum]
Length=266

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D++CL  V+GS  DP G L  WNF+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLMSVQGSLADPGGVLRSWNFENETNGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
             TYLN L L  N+L+G IPSQ + L
Sbjct  143  MTYLNLLNLQHNQLSGQIPSQFSLL  167



>gb|AFW58657.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=632

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            +D ++CL+GVK    DP+G L  W+F NT+ G +C + G+ CWN  E+RV+ L L    L
Sbjct  34   QDGLRCLRGVKHDLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGL  93

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ C +   LDLS N L GTI   +C WLP+LVTLDLSSN LTG IP +L NC
Sbjct  94   VGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANC  153

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+ N+L+G IP+ +A L
Sbjct  154  RFLNSLTLSGNQLSGQIPASLARL  177



>emb|CDY11627.1| BnaC06g31120D [Brassica napus]
Length=595

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CL+G+K S  DP G L  W+F N+++  ICK  GV+CWN  ENR++ L L  + 
Sbjct  23   AEDDVLCLKGLKNSLTDPSGRLSNWSFPNSSSSSICKLTGVSCWNAKENRILSLHLPSMQ  82

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G++P +L+ C SLQ+LDLSGN +S  IP +IC WLPYLVTLDLS N L+G IP  + +
Sbjct  83   LAGKIPESLKLCRSLQSLDLSGNDISSEIPPEICSWLPYLVTLDLSGNKLSGSIPSQIAD  142

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C +LN L LN+NKLTG +P Q+  L
Sbjct  143  CKFLNGLALNENKLTGPVPFQLTRL  167



>ref|NP_001053144.1| Os04g0487200 [Oryza sativa Japonica Group]
 emb|CAD41324.2| OJ991113_30.7 [Oryza sativa Japonica Group]
 dbj|BAF15058.1| Os04g0487200 [Oryza sativa Japonica Group]
 gb|EAY94615.1| hypothetical protein OsI_16392 [Oryza sativa Indica Group]
Length=622

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            EDDV+CL+ VK   RDPDG L  W+F NT+AG +C   GV+CWN  E+R+IGL L    L
Sbjct  30   EDDVRCLKEVKAELRDPDGRLSAWSFGNTSAGALCLLSGVSCWNPQESRIIGLSLSGFGL  89

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P ALQ C +   LDLS N L G IP  +C W+P++V LDLS N L+G +P +L NC
Sbjct  90   QGGIPSALQFCSAATTLDLSNNALVGVIPPALCDWIPFVVNLDLSGNQLSGQLPSELANC  149

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
             +LN L L+ N  +G IP  +  L
Sbjct  150  RFLNSLKLSGNSFSGQIPDSLGRL  173



>ref|XP_004492888.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Cicer arietinum]
 ref|XP_004492889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Cicer arietinum]
Length=614

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = +1

Query  190  VLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIg  369
            ++FG    E D+ CL+ VK S  DP   L  WNF+N T GFICKF GV CW+  ENRV+ 
Sbjct  24   MIFGT---ESDIFCLKSVKSSLNDPYNYLQSWNFNNKTEGFICKFSGVECWHPEENRVLN  80

Query  370  lelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGP  549
            L+L  + L G+ P  +Q+C SL  LDLS N  S +IP  I   + ++ +LDLSSND TG 
Sbjct  81   LKLSNMGLKGQFPRGIQNCSSLTGLDLSSNSFSESIPEDISTLVFFMTSLDLSSNDFTGA  140

Query  550  IPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            IP  L NCTYLN L L+ N+LTG IP Q+A+L
Sbjct  141  IPVSLSNCTYLNILKLDQNQLTGQIPPQLATL  172



>ref|XP_007213020.1| hypothetical protein PRUPE_ppa023044mg, partial [Prunus persica]
 gb|EMJ14219.1| hypothetical protein PRUPE_ppa023044mg, partial [Prunus persica]
Length=147

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             V EDDVKCLQ +K S +DP G L  W+F NT+   +CKFVGV CWND ENR++ LELR+
Sbjct  25   AVVEDDVKCLQSLKQSLKDPLGKLVSWDFRNTSVVSMCKFVGVTCWNDRENRILNLELRD  84

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G +   ++ C SLQNLDL GN LSG+IP  IC WLP+LVTLD S+ND +G IP DL
Sbjct  85   MELSGAIAKDIEYCSSLQNLDLGGNKLSGSIPPDICTWLPFLVTLDFSNNDFSGSIPTDL  144



>gb|AES90509.2| LRR receptor-like kinase family protein, putative [Medicago truncatula]
Length=594

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D+ CL+ +K S  DP+G L  W+F+N T GFICKF GV CW+ +ENRV+ L+L  + 
Sbjct  8    TETDIFCLKSIKNSLEDPNGYLQNWDFNNRTEGFICKFTGVECWHPDENRVLNLKLSNMG  67

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P  L++C SL  LDLS N LSG+IPS I   L ++ + DLSSN+ TG IP  L N
Sbjct  68   LKGQFPRGLENCSSLTGLDLSVNDLSGSIPSDISTMLTFVTSFDLSSNEFTGEIPTALAN  127

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            CTYLN L L+ N L+G IP ++ +L
Sbjct  128  CTYLNTLKLSQNMLSGEIPKRLGTL  152



>ref|XP_003608312.1| Receptor-like-kinase [Medicago truncatula]
Length=592

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D+ CL+ +K S  DP+G L  W+F+N T GFICKF GV CW+ +ENRV+ L+L  + 
Sbjct  6    TETDIFCLKSIKNSLEDPNGYLQNWDFNNRTEGFICKFTGVECWHPDENRVLNLKLSNMG  65

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P  L++C SL  LDLS N LSG+IPS I   L ++ + DLSSN+ TG IP  L N
Sbjct  66   LKGQFPRGLENCSSLTGLDLSVNDLSGSIPSDISTMLTFVTSFDLSSNEFTGEIPTALAN  125

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            CTYLN L L+ N L+G IP ++ +L
Sbjct  126  CTYLNTLKLSQNMLSGEIPKRLGTL  150



>dbj|BAI94492.1| receptor-like kinase [Dianthus caryophyllus]
Length=619

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 109/163 (67%), Gaps = 2/163 (1%)
 Frame = +1

Query  163  RFLKLSI-LLVLFGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVA  336
            RFL +   LL+L  +   E+D++CL+ +K S  DP+  L   WNF+N T GF+C F G+ 
Sbjct  10   RFLVICTGLLLLSKLSYGENDIQCLKSIKQSLEDPNNILNSTWNFNNNTKGFVCSFNGID  69

Query  337  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  516
            CWN +ENRV+ + L ++ L G+ P  +  C  LQ LDLS N LSG IPS I   LPY+ +
Sbjct  70   CWNPSENRVLNIRLSDMGLKGKFPLGISMCSELQLLDLSSNNLSGVIPSNISAILPYITS  129

Query  517  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            LDLSSN  +G IP +L NCT+LNKL+L++N+L+G IP ++  L
Sbjct  130  LDLSSNSFSGHIPDNLANCTFLNKLVLDNNQLSGPIPPRLGQL  172



>ref|XP_011089586.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Sesamum indicum]
 ref|XP_011089587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Sesamum indicum]
Length=620

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 1/155 (1%)
 Frame = +1

Query  184  LLVLFGVG-VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  360
            LLV+   G  A+ D+ CL+ +K S  DP   L  WNFDNTT G+ICKF GV CW+ NEN+
Sbjct  25   LLVIESFGHAAQTDIDCLRAIKISLEDPFNYLSSWNFDNTTEGYICKFTGVECWHPNENK  84

Query  361  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  540
            VI + L ++ L GE P  +  C SL   DLS N + G IPS I + + ++ +LDLSSN  
Sbjct  85   VINIRLGDMGLRGEFPLGVSSCSSLTGFDLSSNSIRGNIPSNISKLIGFVTSLDLSSNRF  144

Query  541  TGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +G IP DL NC+YLN L L++N+LTG IP QI  L
Sbjct  145  SGEIPVDLANCSYLNILKLDNNQLTGQIPPQIGLL  179



>ref|XP_007028124.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007028125.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY08626.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY08627.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
Length=623

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 0/143 (0%)
 Frame = +1

Query  217  DDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  396
            +D++CL+ VK S  DP   L  WNF+N T GFICKF GV CW+ +EN+V+ + L +L L 
Sbjct  39   NDIECLKSVKASLEDPYSYLSSWNFNNGTEGFICKFTGVDCWHPDENKVLNIRLSDLGLK  98

Query  397  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  576
            G  P  +  C SL  LDLS N LSG IPS I   L Y+ TLDLS N+ +GPIPP L NC+
Sbjct  99   GRFPQGIGKCESLTGLDLSSNKLSGLIPSDISEKLKYVTTLDLSDNNFSGPIPPSLANCS  158

Query  577  YLNKLILNDNKLTGNIPSQIASL  645
            +LN L L +N+LTG IP Q+  L
Sbjct  159  FLNVLKLGNNRLTGAIPLQLGVL  181



>ref|XP_006584947.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Glycine max]
Length=613

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 106/172 (62%), Gaps = 4/172 (2%)
 Frame = +1

Query  133  DFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLW-NFDNTTAG  309
            D  M  F  S  L   +++V  GV   E D+ CL+ +K +  DP   L  W NF+N T G
Sbjct  8    DILMHAFWCSSLLSFYMVVVAHGV---ESDISCLKSIKNTLEDPHNKLSSWKNFNNKTNG  64

Query  310  FICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQI  489
            FIC FVGV CW+  EN+V+ L L  + L GE P  L+DC SL +L+LS N L+G IPS I
Sbjct  65   FICDFVGVECWHPGENKVLHLNLTNMGLKGEFPRDLRDCPSLTSLNLSHNELTGPIPSDI  124

Query  490  CRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
               LPY  ++DLS+N   G IPP LGNC+YL  L L++N L+G+IP ++  L
Sbjct  125  STLLPYATSIDLSNNKFNGEIPPSLGNCSYLTSLRLDNNMLSGHIPQELGQL  176



>gb|EYU46077.1| hypothetical protein MIMGU_mgv1a002955mg [Erythranthe guttata]
Length=622

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  166  FLKLSILLVLFG---VGVAEDDVKCLQGVKGSFRDPDGNLG-LWNFDNTTAGFICKFVGV  333
            FL  +++L L        A+ DV CL+ +K +  DP   L  LWNF+N+T G+ICKF GV
Sbjct  17   FLVTALILFLLTEPLSQAAQSDVDCLRAIKDTL-DPLNKLASLWNFNNSTEGYICKFTGV  75

Query  334  ACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLV  513
             CW++NEN+V+ + L ++ L GE P A+  C S+  LDLS N ++GTIP+ I + LP++ 
Sbjct  76   ECWHENENKVLNIRLPDIGLKGEFPQAISGCSSMTGLDLSSNNINGTIPTNISKLLPFVT  135

Query  514  TLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +LDLSSN+L+G IP DL NC++LN L L++N+LTG IP QI  L
Sbjct  136  SLDLSSNELSGEIPVDLANCSFLNILRLDNNQLTGQIPPQIGLL  179



>gb|KJB75784.1| hypothetical protein B456_012G058000 [Gossypium raimondii]
Length=564

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 101/171 (59%), Gaps = 38/171 (22%)
 Frame = +1

Query  133  DFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  312
            +F ++G+ F  +L LS         V EDD+KCL+GVK S +DPDG L  W FDN + G 
Sbjct  7    NFVVLGWMFLPWLVLS--------AVTEDDMKCLEGVKNSLKDPDGKLSGWRFDNNSVG-  57

Query  313  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  492
                                         ++P +L+ C SLQ LDLS N LSG IPSQIC
Sbjct  58   -----------------------------QLPQSLEYCQSLQTLDLSANKLSGNIPSQIC  88

Query  493  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             WLPYLVTLDLSSN L+GPIP +L  C YLN LIL++N+L+G IP Q++ L
Sbjct  89   SWLPYLVTLDLSSNYLSGPIPSELSKCAYLNNLILSNNRLSGPIPYQLSGL  139



>ref|XP_010242455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
Length=630

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             E D+ CL+ +K S +DP G L   WNF N T GFICKF G+ CW+ +E++V+ + L ++
Sbjct  34   TETDIYCLKTLKDSLKDPFGYLNTSWNFANKTEGFICKFTGIDCWHPDESKVLNIRLSDM  93

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N LSG IP  I + LP++ TLDLSSND +GPIP  L 
Sbjct  94   GLKGQFPKGIENCTSLTGLDLSSNNLSGPIPLDISKRLPFVTTLDLSSNDFSGPIPVSLA  153

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN L L++N+LTG+IP + + L
Sbjct  154  NCTYLNSLKLDNNQLTGSIPLEFSGL  179



>ref|XP_006342429.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=588

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             +E DV CL+ +K S  DP  +LG W+F N T GFICKF  V CW+ +EN+V+ L L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGFWDFSNATEGFICKFSEVLCWHPDENKVLSLSLSGY  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IPPD+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGDIPPDIA  145

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC YLN L L++N L G IPS+I  L
Sbjct  146  NCQYLNGLKLDNNYLEGEIPSRIGYL  171



>gb|AGI92774.1| RLP1.801.2 [Triticum aestivum]
Length=266

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D++CL  V+GS  DP G L  WNF+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLMSVQGSLADPGGVLRSWNFENETNGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P ALQ+C SL  LDLS N  SG IP  I + +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISQVMPYLTSLDLSYNSFSGSIPQNISN  142

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
             TYLN L L  N+L+G IP Q   L
Sbjct  143  MTYLNILNLQHNQLSGQIPPQFTLL  167



>ref|XP_003534491.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Glycine max]
 ref|XP_006587796.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Glycine max]
Length=617

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  181  ILLVLFG-VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  357
             LL+L G V   E D+ CL+ VK +  DP   L  WNF+N T G+ICKF+GV CW+ +EN
Sbjct  20   FLLILCGMVCGTESDLFCLKSVKSALEDPYNYLQSWNFNNNTEGYICKFIGVECWHPDEN  79

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            +V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L ++ TLDLSSND
Sbjct  80   KVLNLKLSNMGLKGPFPRGIQNCTSMTGLDFSLNRLSKTIPADISTLLTFVTTLDLSSND  139

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             TG IP  L NCTYLN L L+ N+LTG+IP+ ++ L
Sbjct  140  FTGEIPASLSNCTYLNTLRLDQNQLTGHIPANLSQL  175



>ref|XP_010471000.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=616

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF-ICKFVGVACWNDNENRVIglelrel  387
            AEDDV CL+G+K S +DP   L  W+F N+++   ICK  GV CWN  ENR+I L+L+ +
Sbjct  42   AEDDVLCLKGLKASLKDPSNQLSSWSFPNSSSSSSICKLTGVFCWNAKENRIISLQLQSM  101

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLVTL+LS N L G IP  + 
Sbjct  102  QLSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVTLNLSGNKLGGSIPSQIV  161

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            +C +LN L LN NKLTG+IPSQ+  L
Sbjct  162  DCKFLNTLALNKNKLTGSIPSQLTRL  187



>gb|KHN22142.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=617

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  181  ILLVLFG-VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  357
             LL+L G V   E D+ CL+ VK +  DP   L  WNF+N T G+ICKF+GV CW+ +EN
Sbjct  20   FLLILCGMVCGTESDLFCLKSVKSALEDPYNYLQSWNFNNNTEGYICKFIGVECWHPDEN  79

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            +V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L ++ TLDLSSND
Sbjct  80   KVLNLKLSNMGLKGPFPRGIQNCTSMTGLDFSLNRLSKTIPADISTLLTFVTTLDLSSND  139

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             TG IP  L NCTYLN L L+ N+LTG+IP+ ++ L
Sbjct  140  FTGEIPASLSNCTYLNTLRLDQNQLTGHIPANLSQL  175



>gb|AGI92775.1| RLP1.801.3 [Triticum aestivum]
Length=266

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D++CL+ V+ S  DP G L  W+F+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLKSVQRSLADPGGVLRSWDFENDTDGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
             TYLN L L  N+L+G IPSQ + L
Sbjct  143  MTYLNLLNLQHNQLSGQIPSQFSLL  167



>gb|AGI92772.1| RLP1.1 [Triticum aestivum]
Length=266

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D++CL+ V+ S  DP G L  W+F+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLKSVQRSLADPGGVLRSWDFENDTDGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
             TYLN L L  N+L+G IPSQ + L
Sbjct  143  MTYLNLLNLQHNQLSGQIPSQFSLL  167



>gb|AGI92777.1| RLP1.801.5 [Triticum aestivum]
Length=266

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
             E D++CL+ V+ S  DP G L  W+F+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLKSVQRSLADPGGVLRSWDFENDTDGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
             TYLN L L  N+L+G IPSQ + L
Sbjct  143  MTYLNLLNLQHNQLSGQIPSQFSLL  167



>ref|XP_009784192.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=599

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 106/175 (61%), Gaps = 3/175 (2%)
 Frame = +1

Query  130  ADFRMVGFGFSRFLKLSILLVLFGVGV---AEDDVKCLQGVKGSFRDPDGNLGLWNFDNT  300
             +FR   F F       +L+ L  + V    E D  CL+ +K S +DP  NL  W+F N 
Sbjct  4    TNFRTRSFFFICTFLGFLLMSLSRISVCCAVESDFYCLKSIKDSLQDPFNNLDTWDFSNA  63

Query  301  TAGFICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIP  480
            T G IC+F G+ CW+ NEN+V+ + L    L GE P  +++C SL  LDLSGN L G IP
Sbjct  64   TEGSICRFSGINCWHANENKVLSITLSNYGLIGEFPRGVRNCTSLTGLDLSGNKLYGNIP  123

Query  481  SQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            S I   L Y+ TLDLS+N  +G IPPD+ NCTYLN L L++N L G IPS+I SL
Sbjct  124  SDISVILDYVTTLDLSNNTFSGNIPPDIANCTYLNVLRLDNNNLEGEIPSRIGSL  178



>ref|XP_006301045.1| hypothetical protein CARUB_v10021437mg [Capsella rubella]
 gb|EOA33943.1| hypothetical protein CARUB_v10021437mg [Capsella rubella]
Length=596

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            AEDDV CL+G+K S  DP   L        ++  ICK  GV+CWN  ENR+I L+L+ + 
Sbjct  18   AEDDVLCLKGLKASLTDPSNQLSS-WSFPNSSSSICKLAGVSCWNAKENRIISLQLQSMQ  76

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLV LDLS N L G IP  + +
Sbjct  77   LSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVNLDLSGNKLGGSIPSQIVD  136

Query  571  CTYLNKLILNDNKLTGNIPSQ  633
            C +LN L LN+NKLTG+IPSQ
Sbjct  137  CKFLNTLALNENKLTGSIPSQ  157



>ref|XP_002267164.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Vitis vinifera]
Length=621

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+ +K S +DP+  L   WNF+N T GFICKF G+ CW+ +ENRV+ + L +
Sbjct  29   ATETDIYCLKTIKNSLQDPNNYLNFSWNFNNNTEGFICKFAGIDCWHPDENRVLNIRLSD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G+ P  +++C SL  LDLS N LSG+IPS I   L ++ TL+LSSN   G IPP L
Sbjct  89   MGLKGQFPRGIRNCSSLTGLDLSNNKLSGSIPSDISELLKFVTTLELSSNSFAGDIPPSL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN L L++N+LTG IP Q++ L
Sbjct  149  ANCSFLNVLKLDNNRLTGTIPLQLSQL  175



>emb|CBI23354.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+ +K S +DP+  L   WNF+N T GFICKF G+ CW+ +ENRV+ + L +
Sbjct  29   ATETDIYCLKTIKNSLQDPNNYLNFSWNFNNNTEGFICKFAGIDCWHPDENRVLNIRLSD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G+ P  +++C SL  LDLS N LSG+IPS I   L ++ TL+LSSN   G IPP L
Sbjct  89   MGLKGQFPRGIRNCSSLTGLDLSNNKLSGSIPSDISELLKFVTTLELSSNSFAGDIPPSL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN L L++N+LTG IP Q++ L
Sbjct  149  ANCSFLNVLKLDNNRLTGTIPLQLSQL  175



>ref|XP_010547175.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Tarenaya hassleriana]
Length=615

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = +1

Query  184  LLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  354
            LL+LF  G++   E D+ CL+ +K  F+DP+G L  W F N+T G+ICKF GV+CW+D+E
Sbjct  16   LLLLFCSGLSNASEADIACLKTLKEQFKDPNGYLSNWVFGNSTPGYICKFSGVSCWHDDE  75

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            NRV+ ++L    +GGE P  +++C SL  LDLS N LSGT+P+ I  ++    TLDLS N
Sbjct  76   NRVLSIKLPGYGVGGEFPRGVKECTSLTALDLSKNNLSGTLPTDISSFIGLATTLDLSYN  135

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
              +G IP  + N ++LN L+LNDN+ TG IP Q+A L
Sbjct  136  GFSGEIPVSVSNISFLNTLMLNDNRFTGQIPPQLALL  172



>ref|XP_007134301.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 ref|XP_007134302.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 gb|ESW06295.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 gb|ESW06296.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
Length=609

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             E D+ CL+ +K +  DP   L   W+F+N T GFICKF+GV CW+ +ENRV+ L+L  +
Sbjct  27   TETDIFCLRSIKEALEDPSNYLKFSWDFNNRTEGFICKFIGVECWHPDENRVLNLKLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P A+Q+C SL  LDLS N LSGTIP  I   +P++ +LDLSSND +G IP  L 
Sbjct  87   GLKGQFPRAIQNCSSLTGLDLSINKLSGTIPEDISTLVPFVTSLDLSSNDFSGAIPVTLS  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCT+LN L L+ N LTG IP Q+  L
Sbjct  147  NCTFLNSLKLDQNGLTGQIPLQLGIL  172



>ref|XP_010242501.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380, partial [Nelumbo nucifera]
Length=303

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            E D+ CL+ +K S  DP G L   WNF N T GFICKF G+ CW+ +E++V+ + L ++ 
Sbjct  29   ETDIYCLRTLKASLEDPFGYLNTSWNFANKTEGFICKFTGIDCWHPDESKVLNIRLSDMG  88

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P  +++C SL  LDLS N LSG +P  I + LP++ TLDLSSND +GPIP  L N
Sbjct  89   LKGQFPKGIENCTSLTGLDLSSNNLSGPVPLDISKRLPFVTTLDLSSNDFSGPIPASLAN  148

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C+YL  + L++N+LTG+IP + + L
Sbjct  149  CSYLASVKLDNNQLTGSIPIEFSGL  173



>ref|XP_008356285.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=281

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+G+K S  DP G L   W+F N T GFIC F+G+ CW+ +E++V+ ++L +
Sbjct  34   AVESDINCLKGIKDSLNDPLGYLNSSWDFXNXTEGFICNFLGIECWHPHESKVLNIKLSD  93

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            L L G+ P  + +C SL  LDLS N L+G +P+ I R+LP+L  LDLSSN  +G IP +L
Sbjct  94   LGLKGQFPXGVANCTSLTGLDLSSNMLNGPLPTDIGRFLPFLTYLDLSSNSFSGSIPANL  153

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NCTY+N L+L++NK TG IP Q++ L
Sbjct  154  SNCTYMNVLMLDNNKFTGKIPPQLSQL  180



>ref|XP_010512071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=594

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVGVACWNDNENRVIglelre  384
            AEDDV CL+G+K S +DP   L  W+F N+++    ICK  GV+CWN  ENR+I L+L+ 
Sbjct  18   AEDDVLCLKGLKASLKDPSNQLSSWSFPNSSSSSSSICKLTGVSCWNAKENRIISLQLQS  77

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLVTL+LS N L G IP  +
Sbjct  78   MQLSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVTLNLSGNKLGGSIPSQI  137

Query  565  GNCTYLNKLILNDNKLTGNIPSQ  633
             +C +LN L LN NKLTG+IPSQ
Sbjct  138  VDCKFLNTLALNKNKLTGSIPSQ  160



>ref|XP_006390935.1| hypothetical protein EUTSA_v10018330mg [Eutrema salsugineum]
 gb|ESQ28221.1| hypothetical protein EUTSA_v10018330mg [Eutrema salsugineum]
Length=582

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = +1

Query  175  LSILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  345
            +SI L +F +  +   EDDV CL+G+K S  D  G L  W+F N+++  IC  +GV+CWN
Sbjct  5    ISITLFIFLISSSSYGEDDVLCLKGLKNSLTDSSGRLRSWSFPNSSSSSICNLIGVSCWN  64

Query  346  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  525
              E+R+I L+L+ + L G++P +L+ C SLQ+LDLS N  SG+IPS+IC WLPYLV LDL
Sbjct  65   AKESRIISLQLQSMQLSGQIPESLKLCRSLQSLDLSDNDFSGSIPSEICSWLPYLVALDL  124

Query  526  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIA  639
            S N L G IP  + +C +LN + L+DNKLTG IPSQ+ 
Sbjct  125  SGNKLAGSIPSQIVDCKFLNSVALSDNKLTGPIPSQLT  162



>ref|XP_004510191.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Cicer arietinum]
 ref|XP_004510192.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Cicer arietinum]
 ref|XP_004510193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X3 [Cicer arietinum]
 ref|XP_004510194.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X4 [Cicer arietinum]
Length=618

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = +1

Query  151  FGFSRFLKLSILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKF  324
            F    F+   +L++ +G+    E D+ CL+ +K S +DP+G L   W+F+N T GFIC+F
Sbjct  9    FNSHVFVNFLLLIISWGITYGTETDILCLKSIKESLKDPNGYLKTSWDFNNKTEGFICRF  68

Query  325  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  504
             GV CW+ +ENRV+ L+L  + L G  P  + +C SL  LDLS N LSGTIP  I   L 
Sbjct  69   TGVECWHPDENRVLNLKLSNMGLKGPFPRGIINCSSLTGLDLSINYLSGTIPGDISSLLT  128

Query  505  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            ++ +LDLSSN+ +G IP  L NCTYLN L LN N+LTG IP ++ +L
Sbjct  129  FVTSLDLSSNEFSGEIPDSLANCTYLNTLKLNQNQLTGQIPLRLGTL  175



>ref|XP_009615340.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=576

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = +1

Query  160  SRFLKLSIL-LVLFG----VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKF  324
            S FL  +IL  +LFG        E D+ CL+ +K S +DP  +L  W+F N+T GFIC+F
Sbjct  10   SFFLVSNILGFLLFGRIYLCSATETDIHCLKSIKDSLQDPFNSLDSWDFSNSTEGFICRF  69

Query  325  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  504
            +G+ CW+ +EN+V+ + L ++ L GE P  +Q+C SL  L++S N L GTIPS I   L 
Sbjct  70   IGIECWHPDENKVLNIMLSKMGLIGEFPRGIQNCTSLTGLNISNNNLYGTIPSDISVILE  129

Query  505  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            ++ TLDLS+N  +G IPPD+ NC YLN L L +N L G IPS+I  L
Sbjct  130  HVTTLDLSNNTFSGNIPPDIANCAYLNILKLENNNLEGEIPSRIGDL  176



>ref|XP_002527290.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35134.1| ATP binding protein, putative [Ricinus communis]
Length=302

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+ +K S  DP  NL   W+F+N T G+ICKFVGV CW+ +EN+V+ L L  
Sbjct  33   ATETDIACLKSIKASLEDPLNNLNSSWDFNNKTEGYICKFVGVECWHPDENKVLNLRLSG  92

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G  P  LQ+C S+  +DLS N LSG+IP+ I   + Y+ +L+LSSN+ +G IP  L
Sbjct  93   MGLKGRFPIGLQNCTSITGVDLSSNELSGSIPADISHIIKYVTSLELSSNNFSGEIPVAL  152

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC+YLN L L+ N+LTG IP Q+  L
Sbjct  153  ANCSYLNVLKLDHNRLTGQIPPQLGLL  179



>ref|XP_010911215.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
Length=611

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             + D++CL+ ++ S RDP  +L   WNF N T G ICKF GV CW+ +ENRV+ L L  +
Sbjct  29   TQTDIECLRKIQLSLRDPLDSLKYSWNFSNKTEGAICKFNGVECWHPDENRVLNLHLSNM  88

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G  P  L++C SL  LDLS N LSG+IP+ I R +PY+ +LDLS N+ TG IP +L 
Sbjct  89   GLEGPFPSGLENCTSLTGLDLSSNNLSGSIPADISRKIPYITSLDLSFNNFTGEIPANLS  148

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC+YLN L L  N+L+G IP Q+ +L
Sbjct  149  NCSYLNVLSLQHNRLSGQIPGQLTTL  174



>ref|XP_009619663.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009619664.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=622

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLG-LWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              + D+ CL+ VK S  DP   LG  WNFDN T GFICKF G+ CW+ +E++V+ + L +
Sbjct  34   AVQSDIDCLKSVKESLEDPLNYLGSTWNFDNQTEGFICKFTGIQCWHPDESKVLSITLPD  93

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G  P  +Q+C S+ +LDLS N L+G+IPS I + + ++V LDLSSN+L+G IP DL
Sbjct  94   MGLKGRFPRGIQNCTSMTSLDLSSNELNGSIPSDISKIIGFVVILDLSSNNLSGQIPVDL  153

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN + L++N+LTG IP QI  L
Sbjct  154  ANCSFLNDIKLDNNQLTGQIPPQIGLL  180



>ref|XP_010101366.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB88313.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=2189

 Score =   143 bits (361),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = +1

Query  196  FGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgl  372
            FG   A  DD+ CL+ +K S  DP G L  W+F+N T GFICKF+GV CW+ +EN+V+ +
Sbjct  23   FGASRALVDDIHCLKAIKASLEDPYGYLASWDFNNNTEGFICKFIGVDCWHPDENKVLNI  82

Query  373  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  552
             + ++ L G  P  L  C SL  LDLS N L G IPS I   LP + +LDLSSN+ +G I
Sbjct  83   RITDMGLKGTFPRGLGRCRSLTGLDLSNNKLHGPIPSDIGTLLPSVTSLDLSSNNFSGEI  142

Query  553  PPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            P  L NCTYLN L L+ N+LTGN+P ++  L
Sbjct  143  PKSLANCTYLNVLKLDHNRLTGNLPKELGLL  173



>ref|XP_010088605.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB36746.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=618

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 8/164 (5%)
 Frame = +1

Query  175  LSILLVLFGVGVAE------DDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGV  333
            L + LVLF +G  +      DD+ CL+ +K SF DP G+L   W F+N T G IC+F GV
Sbjct  12   LHLFLVLF-IGSVDASLALGDDIPCLKAIKASFEDPFGHLSYSWKFNNQTEGSICRFKGV  70

Query  334  ACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLV  513
             CW+ +EN+V+ + L  + L G  P  ++ C SL  L+LS N L+GTIPS I   LP++ 
Sbjct  71   ECWHPDENKVLNINLSGMGLKGTFPRGIRYCTSLMGLNLSNNALAGTIPSDISMLLPFVT  130

Query  514  TLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +LDLSSN  +G IP +L NCTYLN L L+ N+LTGN+P ++  L
Sbjct  131  SLDLSSNSCSGEIPKNLANCTYLNVLRLDHNRLTGNLPEELGLL  174



>ref|XP_007139688.1| hypothetical protein PHAVU_008G050700g [Phaseolus vulgaris]
 gb|ESW11682.1| hypothetical protein PHAVU_008G050700g [Phaseolus vulgaris]
Length=614

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  181  ILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  357
             LLVL G+    D D+ CL+ VK + +DP   L  W+F+N T G+ICKF GV CW+ +EN
Sbjct  17   FLLVLCGMVCGTDNDISCLRSVKAALQDPYNYLQSWDFNNKTEGYICKFTGVECWHPDEN  76

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            RV+ L+L  + L GE P  +++C S+  LD S N LS TIP+ I   L ++ ++DLSSND
Sbjct  77   RVLNLKLSNMGLKGEFPRGVENCSSMTGLDFSLNRLSKTIPADISTLLTFVTSIDLSSND  136

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             TG IP  L NCTYLN L L+ N+L+G IP+ ++ L
Sbjct  137  FTGEIPASLSNCTYLNTLRLDQNQLSGQIPANLSQL  172



>gb|KDP45204.1| hypothetical protein JCGZ_15069 [Jatropha curcas]
Length=225

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             E D+ CL+ +K S  DP G L   WNF+N T GFIC+F GV CW+ +EN+V+ L L ++
Sbjct  27   TETDIACLKSIKASLEDPFGYLKSSWNFNNNTEGFICRFTGVDCWHPDENKVLNLRLSDM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  L++C S+  +DLS N L GTIP+ I    P+L +LDLSSN  +G IP DL 
Sbjct  87   ELKGQFPLGLRNCTSITGVDLSNNDLVGTIPTNISNITPFLTSLDLSSNSFSGTIPADLV  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC+YLN L L+ N+ TG IP++++ L
Sbjct  147  NCSYLNVLKLDRNRFTGQIPAELSLL  172



>ref|XP_006601824.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Glycine max]
Length=618

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 104/166 (63%), Gaps = 1/166 (1%)
 Frame = +1

Query  151  FGFSRFLKLSILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFV  327
            FG    +    LL+L G+    D D+ CL+ VK +  DP   L  WNF+N T G+ICKF 
Sbjct  10   FGAGVIIVSFFLLILCGMVCGTDSDIFCLKSVKRTLDDPYNYLQSWNFNNNTEGYICKFT  69

Query  328  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  507
            GV CW+ +EN+V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L +
Sbjct  70   GVECWHPDENKVLNLKLSNMGLKGPFPRGIQNCSSMTGLDFSLNRLSKTIPADISTLLTF  129

Query  508  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            + TLDLSSND TG IP  L NCTYLN + L+ N+LTG IP+ ++ L
Sbjct  130  VTTLDLSSNDFTGEIPASLSNCTYLNTIRLDQNQLTGQIPANLSQL  175



>ref|XP_010053967.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW78348.1| hypothetical protein EUGRSUZ_D02521 [Eucalyptus grandis]
Length=220

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 106/170 (62%), Gaps = 3/170 (2%)
 Frame = +1

Query  139  RMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFI  315
            R+   G + FL    LL    +   E D+ CL+ +K S +DP   L   WNFDN T GFI
Sbjct  6    RVSSLGAAGFLW--ALLSCCVIHCLETDINCLKTIKASVQDPLNYLNYTWNFDNDTEGFI  63

Query  316  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  495
            C+F GV CW+ +ENRV+ L+L ++ L G+ P  ++ C SL  LDLS N  SG IP  I  
Sbjct  64   CRFTGVECWHPDENRVLNLKLSDMGLKGQFPRGIEQCKSLTGLDLSSNEFSGPIPENISS  123

Query  496  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +PY  +LDLSSN+ +G IP ++ NC YLN L L+ N+L+G IP++++ L
Sbjct  124  IIPYATSLDLSSNNFSGQIPVNISNCRYLNSLRLDHNQLSGQIPAELSLL  173



>gb|KHN40510.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=616

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 104/166 (63%), Gaps = 1/166 (1%)
 Frame = +1

Query  151  FGFSRFLKLSILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFV  327
            FG    +    LL+L G+    D D+ CL+ VK +  DP   L  WNF+N T G+ICKF 
Sbjct  8    FGAGVIIVSFFLLILCGMVCGTDSDIFCLKSVKRTLDDPYNYLQSWNFNNNTEGYICKFT  67

Query  328  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  507
            GV CW+ +EN+V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L +
Sbjct  68   GVECWHPDENKVLNLKLSNMGLKGPFPRGIQNCSSMTGLDFSLNRLSKTIPADISTLLTF  127

Query  508  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            + TLDLSSND TG IP  L NCTYLN + L+ N+LTG IP+ ++ L
Sbjct  128  VTTLDLSSNDFTGEIPASLSNCTYLNTIRLDQNQLTGQIPANLSQL  173



>ref|XP_009406423.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406424.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=613

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  220  DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  396
            D++CL+ VK S +DP+ NL   W FDNT+ G ICKF GV CW+ +EN+V+ L L  + L 
Sbjct  32   DIECLRLVKLSLKDPENNLFYSWTFDNTSEGSICKFNGVECWHPDENKVLNLRLSNMGLQ  91

Query  397  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  576
            G+ P  L++C SL  LDLS N LSGTIP  I + +PY+ +LDLS ND +G IP +L +CT
Sbjct  92   GQFPSGLENCTSLTGLDLSNNNLSGTIPVNIAKKIPYVTSLDLSFNDFSGQIPVNLSDCT  151

Query  577  YLNKLILNDNKLTGNIPSQIASL  645
            YLN L L  N LTG IP Q++ L
Sbjct  152  YLNSLKLQHNNLTGQIPGQLSIL  174



>ref|XP_006343705.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=256

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 104/165 (63%), Gaps = 5/165 (3%)
 Frame = +1

Query  166  FLKLSILLVLFGVGV----AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVG  330
            +L L   +VL    +     + D+ CL  +K SF DP   L   W FDN T GFICKF G
Sbjct  8    YLVLPFFVVLCSFSLRCNAVQSDIDCLISIKDSFEDPLNFLNTTWKFDNQTEGFICKFAG  67

Query  331  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  510
            + CW+ +E RV+ + L ++ L GE P  +++C S+ +LDLS N L GTIPS I + + + 
Sbjct  68   IQCWHPDETRVLSISLPDMGLKGEFPRGIENCTSITSLDLSSNELYGTIPSDISKLIRFT  127

Query  511  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +TLDLSSN  +G IP D+ NC++LN L L++NKL G IP +IA L
Sbjct  128  ITLDLSSNQFSGAIPSDIANCSFLNSLRLDNNKLQGPIPPEIALL  172



>emb|CDP03993.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  220  DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlgg  399
            DV CL+ VK +  DP  +L  WNFDN T GFICKF G+ CW+ +EN+V+ + L  + L G
Sbjct  31   DVDCLRAVKQTLEDPLNSLSTWNFDNATEGFICKFTGIECWHPDENKVLNVRLSSMGLKG  90

Query  400  eVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTY  579
            + P  L +C +L  LDLS N +SG IPS I   + ++ TLDLSSN L+G IP  L NC++
Sbjct  91   QFPRDLANCSALTGLDLSSNNISGNIPSDISSIIKFVTTLDLSSNHLSGQIPEGLANCSF  150

Query  580  LNKLILNDNKLTGNIPSQIASL  645
            LN L L++N+LTG+IP +I  L
Sbjct  151  LNSLKLDNNQLTGHIPLEIGLL  172



>ref|XP_010673854.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
Length=615

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 112/168 (67%), Gaps = 4/168 (2%)
 Frame = +1

Query  145  VGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICK  321
            V FG  RFL   I L  +G+     DV CL+ +  S +DP+G L + WNF+N T G ICK
Sbjct  11   VVFGL-RFL--LIFLSSYGIYGTVTDVSCLRKIYRSLKDPNGYLNVTWNFNNGTEGAICK  67

Query  322  FVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWL  501
            F+G+ CW+ +ENRV+ ++L ++ L G+ P  ++DC SL  LDLS N L+G++PS + R++
Sbjct  68   FIGIECWHPDENRVLNIKLADMGLEGQFPVGIEDCTSLTGLDLSNNKLNGSLPSNMSRFI  127

Query  502  PYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            P++  LDLS+ND +G IP  L NC+YLN +  + N+ +G IP +I +L
Sbjct  128  PFVTELDLSNNDFSGVIPETLANCSYLNGVNFDQNRFSGQIPLEIGNL  175



>ref|XP_010053969.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW78346.1| hypothetical protein EUGRSUZ_D02519 [Eucalyptus grandis]
Length=220

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (62%), Gaps = 3/170 (2%)
 Frame = +1

Query  139  RMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFI  315
            R+ G G + FL    LL    +   E D+ CL+ +K S +DP   L   WNFDN T GFI
Sbjct  6    RVSGLGAAGFLW--ALLSCCVIHCLETDINCLKTIKASVQDPLNYLNYTWNFDNDTEGFI  63

Query  316  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  495
            C+F GV CW+ +ENRV+ L+L ++ L G+ P  ++ C SL  LDLS N  SG IP  I  
Sbjct  64   CRFTGVECWHPDENRVLNLKLSDMGLKGQFPRGIEQCKSLTGLDLSSNKFSGPIPENISS  123

Query  496  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             + Y  +LDLSSN  +G IP +L NC YLN L L+ N+L+G IP++++ L
Sbjct  124  IIQYATSLDLSSNSFSGQIPVNLSNCRYLNSLRLDHNQLSGQIPAELSLL  173



>ref|XP_009767841.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009767850.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009767856.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=622

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLG-LWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              + D+ CL+ VK S  DP   LG  WNFDN T GFICKF G+ CW+ +E++V+ + L +
Sbjct  34   AVQSDIDCLKSVKESLEDPLNYLGSTWNFDNQTEGFICKFTGIQCWHPDESKVLSITLPD  93

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G  P  +Q+C S+ +LDLS N L+G+IP  I + + ++V LDLSSN+L+G IP DL
Sbjct  94   MGLKGRFPRGIQNCTSMTSLDLSSNELNGSIPRDISKIIGFVVILDLSSNNLSGEIPVDL  153

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN + L++N+LTG IP QI  L
Sbjct  154  ANCSFLNDIKLDNNQLTGQIPPQIGLL  180



>ref|XP_010679004.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679005.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = +1

Query  181  ILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNE  354
            +LLV  G+   +E+DV CL+ +K S  DP+  L   WNF N T GFIC F G+ CW  NE
Sbjct  23   VLLVFSGLSYGSENDVSCLRSIKESLHDPNNILNSTWNFSNATQGFICSFTGIDCWAPNE  82

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
             RV+ + L  + L G  P  + +C SLQ+LDLS N L G IP+ I   +PY+  LDLSSN
Sbjct  83   YRVLNIRLSNMGLRGRFPLGISNCSSLQHLDLSSNDLDGAIPANISFIIPYVTVLDLSSN  142

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
              +G IP +L NC+YLN L L+ N+ +G IP Q+  L
Sbjct  143  RFSGEIPVNLANCSYLNSLQLDHNRFSGQIPPQLGQL  179



>gb|EMT19838.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=266

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 3/150 (2%)
 Frame = +1

Query  196  FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgle  375
            FG+   E D++CL+ V+GS  DP G L  W+F+N T GFIC+F GV CW+ +EN+++ L 
Sbjct  21   FGI---EQDIRCLKSVQGSLADPGGVLRSWDFENETNGFICRFTGVECWHPDENKILSLR  77

Query  376  lrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIP  555
            L  L L G+ P ALQ+C SL  LDLS N   G IP  I   +PYL +LDLS N  +G IP
Sbjct  78   LGNLGLEGQFPVALQNCSSLTGLDLSNNNFLGPIPQDISWVMPYLTSLDLSYNSFSGSIP  137

Query  556  PDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             ++ N TYLN L L  N+L+G IP Q   L
Sbjct  138  HNISNMTYLNVLNLQHNQLSGQIPPQFTLL  167



>ref|XP_009406422.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=672

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  220  DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  396
            D++CL+ VK S +DP+ NL   W FDNT+ G ICKF GV CW+ +EN+V+ L L  + L 
Sbjct  91   DIECLRLVKLSLKDPENNLFYSWTFDNTSEGSICKFNGVECWHPDENKVLNLRLSNMGLQ  150

Query  397  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  576
            G+ P  L++C SL  LDLS N LSGTIP  I + +PY+ +LDLS ND +G IP +L +CT
Sbjct  151  GQFPSGLENCTSLTGLDLSNNNLSGTIPVNIAKKIPYVTSLDLSFNDFSGQIPVNLSDCT  210

Query  577  YLNKLILNDNKLTGNIPSQIASL  645
            YLN L L  N LTG IP Q++ L
Sbjct  211  YLNSLKLQHNNLTGQIPGQLSIL  233



>ref|NP_001239701.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At5g48380-like [Glycine max]
 gb|ACM89483.1| leucine-rich repeat family protein [Glycine max]
Length=592

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            + D+ CL+ VK +  DP   L  WNF+N T G+ICKF GV CW+ +EN+V+ L+L  + L
Sbjct  6    DSDIFCLKSVKRTLDDPYNYLQSWNFNNNTEGYICKFTGVECWHPDENKVLNLKLSNMGL  65

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G  P  +Q+C S+  LD S N LS TIP+ I   L ++ TLDLSSND TG IP  L NC
Sbjct  66   KGPFPRGIQNCSSMTGLDFSLNRLSKTIPADISTLLTFVTTLDLSSNDFTGEIPASLSNC  125

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            TYLN + L+ N+LTG IP+ ++ L
Sbjct  126  TYLNTIRLDQNQLTGQIPANLSQL  149



>ref|XP_006372662.1| hypothetical protein POPTR_0017s036502g, partial [Populus trichocarpa]
 gb|ERP50459.1| hypothetical protein POPTR_0017s036502g, partial [Populus trichocarpa]
Length=343

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 100/156 (64%), Gaps = 2/156 (1%)
 Frame = +1

Query  184  LLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNEN  357
            LL  F V  A D D+ CL+ ++ S  DP+  L   WNF N T GFIC+F+GV CW+ +E+
Sbjct  4    LLATFTVTSATDTDIYCLKSIRDSMIDPNNYLSTTWNFTNKTEGFICRFMGVDCWHPDES  63

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            RV+ + L  + L G+ P  LQ+C SL  LDLS N L G IPS I R LPY+  LDLS N+
Sbjct  64   RVVNIRLSGMGLKGQFPLGLQNCTSLTGLDLSHNELQGPIPSHISRRLPYITNLDLSFNN  123

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +G IP  + N ++LN L L++N L G+IP+QI  L
Sbjct  124  FSGEIPSGIANLSFLNDLKLDNNNLAGHIPTQIGQL  159



>ref|XP_007159203.1| hypothetical protein PHAVU_002G217900g [Phaseolus vulgaris]
 gb|ESW31197.1| hypothetical protein PHAVU_002G217900g [Phaseolus vulgaris]
Length=611

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  175  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  354
            LS L+V  G GVA  D+ CL+ +K S  DP   L  W+FDN T GF+C FVGV+CW+  E
Sbjct  19   LSSLMV--GNGVA-SDISCLKSIKDSLEDPFSYLSSWSFDNQTEGFLCSFVGVSCWHPGE  75

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            N+V+ + L  + L GE P  +++C SL  L+LS N L+G IPS IC  +P+  ++DLS N
Sbjct  76   NKVLSISLENMGLKGEFPLGIRNCLSLTALNLSNNHLTGPIPSDICTLIPFATSIDLSHN  135

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
               G IPP L +CTYLN L L++N L+G+IP ++  L
Sbjct  136  RFNGNIPPTLAHCTYLNSLRLDNNNLSGHIPQELGQL  172



>ref|XP_009799665.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009799666.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=625

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            + D+ CL+ +K +  D   +L  WNF+N T GFICKF G+ CW+ +ENRV+ + L ++ L
Sbjct  36   QSDIDCLKSIKSALEDTSNSLASWNFNNQTEGFICKFTGIECWHPDENRVLSIRLPDMGL  95

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  +Q+C SL +LDLS N L+G+IPS I + + ++V LDLSSN L+G IP +L NC
Sbjct  96   KGEFPRGIQNCSSLTSLDLSNNKLNGSIPSNISKVIGFVVKLDLSSNLLSGEIPVNLANC  155

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            +YLN L L++N+L G IP +I  L
Sbjct  156  SYLNDLNLDNNRLRGQIPPEIGLL  179



>gb|KJB10818.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
 gb|KJB10819.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
Length=614

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              +DD++CL+ +K SF+D  G L   WNF+N T GFIC+F G+ CW+ +ENRV+ + L +
Sbjct  29   ATKDDIECLKSIKASFQDSFGYLNSSWNFNNDTEGFICRFTGIDCWHPDENRVLNIRLSD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G  P  +  C S+  LDLS N L G IPS I + +PY+ +LDLSSN+ +G IP +L
Sbjct  89   MGLKGVFPRDIIKCKSMTGLDLSSNKLYGKIPSDIAKLIPYVTSLDLSSNNFSGEIPKNL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN L L+ NKLTG IP ++  L
Sbjct  149  ANCSFLNILNLDHNKLTGPIPPELTLL  175



>ref|XP_003624238.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|ABN08998.1| Protein kinase [Medicago truncatula]
 gb|AES80456.1| LRR receptor-like kinase [Medicago truncatula]
Length=615

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  157  FSRFLKLSILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFV  327
            FS  + +S  L++   G+    E D+ CL+ VK S +DP+  L  W+F+N T G ICKF 
Sbjct  8    FSTPIIVSFSLLVISCGITYGTETDILCLKRVKESLKDPNNYLQNWDFNNKTEGSICKFT  67

Query  328  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  507
            GV CW+ +ENRV+ L+L  + L GE P  +Q+C SL  LD S N LS +IP+ +   + +
Sbjct  68   GVECWHPDENRVLNLKLSNMGLKGEFPRGIQNCSSLTGLDFSLNSLSKSIPADVSTLIGF  127

Query  508  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            + TLDLSSND TG IP  L NCTYLN + L+ N+LTG IP +   L
Sbjct  128  VTTLDLSSNDFTGEIPVSLANCTYLNSIKLDQNQLTGQIPLEFGGL  173



>ref|XP_006366814.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=620

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            + D+ CL+ +K SF DP   L   W FDN T GFICKF G+ CW+ +E RV+ + L ++ 
Sbjct  36   QSDIDCLKSIKDSFEDPLKFLNTTWKFDNQTEGFICKFAGIQCWHPDETRVLSISLPDMG  95

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P  L++C S+ +LDLS N L G+IP+ I + + ++VTLDLSSN+L+G IP +L N
Sbjct  96   LKGKFPRGLKNCTSITSLDLSSNKLHGSIPNDISKIIGFMVTLDLSSNNLSGDIPVNLAN  155

Query  571  CTYLNKLILNDNKLTGNIPSQIASL  645
            C++LN L L++N+ TG IP +IA L
Sbjct  156  CSFLNSLRLDNNQFTGQIPPEIALL  180



>ref|XP_010314784.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Solanum lycopersicum]
Length=611

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 97/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC YLN L L++N L G +P++I  L
Sbjct  146  NCQYLNGLKLDNNYLEGEVPARIGYL  171



>ref|XP_010314785.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Solanum lycopersicum]
Length=608

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 97/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC YLN L L++N L G +P++I  L
Sbjct  146  NCQYLNGLKLDNNYLEGEVPARIGYL  171



>ref|XP_004253035.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X4 [Solanum lycopersicum]
Length=591

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 97/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC YLN L L++N L G +P++I  L
Sbjct  146  NCQYLNGLKLDNNYLEGEVPARIGYL  171



>ref|XP_010037082.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW48706.1| hypothetical protein EUGRSUZ_K02357 [Eucalyptus grandis]
Length=618

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = +1

Query  160  SRFLKLSILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFV  327
            SR +   IL  L G  V    E D+ CL+ +K S +DP   L   WNFDN+T GFIC+F 
Sbjct  8    SRLVAAGILWALLGCCVIDCLETDINCLKTIKASVQDPLNYLNYTWNFDNSTEGFICRFT  67

Query  328  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  507
            GV CW+ +ENRV+ L+L ++ L G+ P  ++ C SL  LDLS N  SG IP  I   +P+
Sbjct  68   GVECWHPDENRVLNLKLSDMGLKGQFPRGIEQCKSLTGLDLSSNEFSGPIPENISHIIPF  127

Query  508  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQI  636
              +LDLSSN  +G IP +L  C YLN L L+ N+ +G IP+++
Sbjct  128  ATSLDLSSNSFSGQIPANLSECKYLNSLRLDHNQFSGQIPAEL  170



>ref|XP_010314786.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X3 [Solanum lycopersicum]
Length=600

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 97/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC YLN L L++N L G +P++I  L
Sbjct  146  NCQYLNGLKLDNNYLEGEVPARIGYL  171



>ref|XP_010251401.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
 ref|XP_010251402.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
 ref|XP_010251403.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
Length=617

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 93/142 (65%), Gaps = 0/142 (0%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  390
            ++ D+ CL+ +K S  DP   L  WNF+N T GFICKF G+ CW+ +ENRVI + L ++ 
Sbjct  29   SDADINCLKSLKSSLEDPFNYLSSWNFNNKTEGFICKFTGIDCWHPDENRVINIRLSDMG  88

Query  391  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  570
            L G+ P  +++C +L  LDLS N LSG IP  + + + Y  TLDLSSN  +G IP  L N
Sbjct  89   LKGQFPKGVENCTTLTGLDLSNNNLSGPIPLDVSKMIIYATTLDLSSNRFSGQIPVSLSN  148

Query  571  CTYLNKLILNDNKLTGNIPSQI  636
            CTYLN L L +N+LTG IP Q 
Sbjct  149  CTYLNTLKLENNQLTGEIPPQF  170



>gb|KFK25890.1| hypothetical protein AALP_AA8G175500 [Arabis alpina]
Length=254

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 0/157 (0%)
 Frame = +1

Query  175  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  354
            L  LLV    G  + ++ CLQ +K    DP+  L  W F NTT GFICKF GV+CW+D+E
Sbjct  11   LWFLLVSNFTGANQLNINCLQSIKSQVEDPNDYLSSWVFSNTTQGFICKFSGVSCWHDDE  70

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            +RV+ ++L    L GE P  ++DC  L  LDLS N  SG +PS +   +P L  LDLS N
Sbjct  71   SRVLSIKLSGYGLIGEFPQGIKDCSDLVGLDLSRNNFSGALPSNMTDLVPLLTILDLSYN  130

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
              +  IPP L N TYLN L+L  N+ TG +PS +A L
Sbjct  131  QFSDEIPPSLSNITYLNTLMLQHNQFTGPLPSLLAQL  167



>ref|XP_006372658.1| hypothetical protein POPTR_0017s036302g, partial [Populus trichocarpa]
 gb|ERP50455.1| hypothetical protein POPTR_0017s036302g, partial [Populus trichocarpa]
Length=211

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 100/173 (58%), Gaps = 1/173 (1%)
 Frame = +1

Query  130  ADFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTA  306
            +  +M    F      S+L         E D+ CL+ ++ S  DP   L   WNFDN T 
Sbjct  3    SQIQMANLFFIYSFMFSLLATFTVTSATETDLSCLKSIRASMIDPYNYLNTTWNFDNKTE  62

Query  307  GFICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQ  486
            GFIC+F+G+ CW+ +ENRV+ + L  + L G+    LQ+C SL  LDLS N L G IPS 
Sbjct  63   GFICRFMGLDCWHPDENRVLNIRLSGMGLKGQFHLGLQNCTSLTGLDLSHNELQGPIPSD  122

Query  487  ICRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            I R LPY+  LDLS N+ +G IP  + N ++LN L L++N L G+IP +I  L
Sbjct  123  ISRRLPYITNLDLSFNNFSGEIPSSIANLSFLNDLKLDNNNLAGHIPLEIGLL  175



>ref|XP_006372665.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
 gb|ERP50462.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
Length=556

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 1/156 (1%)
 Frame = +1

Query  181  ILLVLFGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  357
            +L  LF V  A E D+ CL+ +K S  DP  +   W+F N T GFICKF GV CW   E+
Sbjct  15   VLFCLFSVSSATEPDIYCLKSIKDSLEDPYNHFSSWDFANHTEGFICKFAGVDCWKPEES  74

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            RV+ L L  + L G+ P  +++C SL  LDLS N L G IPS I + LPY+  LDLS N+
Sbjct  75   RVLNLALSNMELKGQFPPGIENCTSLTGLDLSRNELQGPIPSDISKRLPYITNLDLSFNN  134

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +G IP  + N ++LN L L+ N+L GNIP QI  L
Sbjct  135  FSGEIPSSIANLSFLNVLQLDHNQLIGNIPPQIGLL  170



>ref|XP_006372666.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
 gb|ERP50463.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
Length=600

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 1/156 (1%)
 Frame = +1

Query  181  ILLVLFGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  357
            +L  LF V  A E D+ CL+ +K S  DP  +   W+F N T GFICKF GV CW   E+
Sbjct  15   VLFCLFSVSSATEPDIYCLKSIKDSLEDPYNHFSSWDFANHTEGFICKFAGVDCWKPEES  74

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            RV+ L L  + L G+ P  +++C SL  LDLS N L G IPS I + LPY+  LDLS N+
Sbjct  75   RVLNLALSNMELKGQFPPGIENCTSLTGLDLSRNELQGPIPSDISKRLPYITNLDLSFNN  134

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +G IP  + N ++LN L L+ N+L GNIP QI  L
Sbjct  135  FSGEIPSSIANLSFLNVLQLDHNQLIGNIPPQIGLL  170



>ref|XP_009416988.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Musa acuminata subsp. malaccensis]
 ref|XP_009416990.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Musa acuminata subsp. malaccensis]
Length=617

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = +1

Query  220  DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  396
            D++CL+ +  S +DP+ +L   WNFDN + G IC+F GV CW+ +ENRV+ L L  + L 
Sbjct  32   DIQCLELIHKSLKDPENSLTYSWNFDNKSEGAICRFAGVECWHPDENRVLNLRLSNMGLQ  91

Query  397  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  576
            GE P  L++C SL  LDLS N LSG IP+ I R +P++  LDLS N  +G IP +L +C+
Sbjct  92   GEFPSGLENCTSLTGLDLSSNSLSGPIPADISRKIPFVTALDLSFNGFSGEIPVNLSDCS  151

Query  577  YLNKLILNDNKLTGNIPSQIASL  645
            YLN L L  NKLTG IP Q+  L
Sbjct  152  YLNSLKLQHNKLTGQIPGQLIRL  174



>ref|XP_006378629.1| hypothetical protein POPTR_0010s18540g [Populus trichocarpa]
 gb|ERP56426.1| hypothetical protein POPTR_0010s18540g [Populus trichocarpa]
Length=621

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+ +K S  DP+  L   WNFDN T GFIC+F+G+ CW+ +ENRV+ + L +
Sbjct  32   ATETDLACLKSIKASLVDPNNYLNTTWNFDNNTEGFICRFMGIDCWHPDENRVLNIRLSD  91

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            L L G+ P  +Q+C SL  L+LS N LSG+IP+ I +++PY+  LDLS N+ +G IP +L
Sbjct  92   LGLEGQFPPGIQNCTSLTGLNLSQNQLSGSIPANIAKFIPYITNLDLSFNNFSGEIPQNL  151

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN L L++N+LT  IP +   L
Sbjct  152  ANCSFLNDLKLDNNRLTSKIPPEFGLL  178



>gb|AGI92778.1| RLP1.804.1 [Triticum aestivum]
Length=267

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            +E D++CL+ V  S  DP+G L   WNF++ T GFIC+F GV CW+ ++N V+ L L  L
Sbjct  23   SEQDIQCLKSVYQSVIDPNGVLKSSWNFEDGTVGFICRFTGVECWHPDKNMVLSLRLGNL  82

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G  P  LQDC S+  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ 
Sbjct  83   GLQGTFPQGLQDCASMTGLDLSNNKFSGPIPQDISRQVPYLTSLDLSYNSFSGSIPQNIS  142

Query  568  NCTYLNKLILNDNKLTGNIPSQI  636
            N TYLN LIL  N+L+G IP Q 
Sbjct  143  NMTYLNVLILQHNQLSGQIPPQF  165



>gb|EMS46984.1| hypothetical protein TRIUR3_06204 [Triticum urartu]
Length=269

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 95/148 (64%), Gaps = 3/148 (2%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNT--TAGFICKFVGVACWNDNENRVIglelr  381
            +E D++CL+ V+ S  DP+G L   WNF+N   T G+IC+F GV CW+ +ENRV+ L L 
Sbjct  23   SEADIQCLKSVQQSVIDPNGVLKSTWNFENPNPTDGYICRFTGVECWHPDENRVLSLRLG  82

Query  382  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  561
             L L    P  LQ+C S+  LDLS N  SG IPS+I R +PYL +LDL  N  +G IP +
Sbjct  83   NLGLESTFPQGLQNCSSMIGLDLSNNNFSGPIPSEIAREVPYLTSLDLLYNSFSGSIPQN  142

Query  562  LGNCTYLNKLILNDNKLTGNIPSQIASL  645
            + N TYLN LIL  N+L+G IP Q   L
Sbjct  143  ISNMTYLNILILQHNQLSGQIPPQFTLL  170



>emb|CDY07991.1| BnaC03g35320D [Brassica napus]
Length=259

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 102/161 (63%), Gaps = 2/161 (1%)
 Frame = +1

Query  166  FLKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  339
            F++  I L+L  +     E D+ CL+ +K   +DP   L  W F N + G+IC F GV C
Sbjct  12   FIRSCIWLLLLPILTRAMESDITCLRSLKSQLKDPHAYLSNWIFGNYSDGYICSFFGVYC  71

Query  340  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  519
            W    N+V+ + L    L GE P  ++ C  +++L+L+GN L+GT+PS     LPYLVTL
Sbjct  72   WRSKHNKVLSINLGGSGLEGEFPSGVKLCSFMESLNLTGNNLTGTLPSDTFSSLPYLVTL  131

Query  520  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIAS  642
            DLS+N+L G IP +L N +YLN L+L+ N+ TG+IPS++AS
Sbjct  132  DLSNNNLAGEIPANLPNMSYLNTLLLDHNRFTGSIPSELAS  172



>ref|XP_011004566.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=622

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = +1

Query  136  FRMVGFGFSRFLKLSILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAG  309
            F +  F FS       LL  F V  A D DV CL+ +K S  DP G L   W+F+N T G
Sbjct  11   FFIYSFMFS-------LLATFTVTSATDTDVYCLKSIKDSMIDPHGYLNTTWDFNNYTEG  63

Query  310  FICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQI  489
            FIC+F+GV CW+ +ENRV+ L L +L L G  P  +Q+C SL  LDLS N L G IPS I
Sbjct  64   FICRFLGVDCWHPDENRVLNLRLSDLGLEGRFPPGIQNCTSLSGLDLSHNELQGPIPSDI  123

Query  490  CRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             + L ++  LDLS N+L+G IP  + N ++LN L L++NKLTGNIP QI  L
Sbjct  124  FKRLLFITNLDLSYNNLSGEIPSSIANLSFLNVLKLDNNKLTGNIPPQIGLL  175



>gb|KEH18041.1| LRR receptor-like kinase [Medicago truncatula]
Length=618

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = +1

Query  181  ILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNE  354
            +LL+ FG+    E D+ CL+ +K S +DP+  L   WNF+N T GFIC+F GV CW+ +E
Sbjct  19   LLLISFGITYGTETDIFCLKSIKNSIQDPNNYLTSSWNFNNKTEGFICRFNGVECWHPDE  78

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            N+V+ L+L  + L G+ P  + +C S+  LDLS N LSGTIP  I   L ++ +LDLSSN
Sbjct  79   NKVLNLKLSNMGLKGQFPRGIVNCSSMTGLDLSVNDLSGTIPGDISTLLKFVTSLDLSSN  138

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            + +G IP  L NCTYLN L L+ N+LTG IP  + +L
Sbjct  139  EFSGEIPVSLANCTYLNVLKLSQNQLTGQIPLLLGTL  175



>dbj|BAJ86446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  196  FGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIgl  372
            F    +E D++CL+ V+ S  DP+G L   WNF+N T GFIC+F GV CW+ +E+RV+ L
Sbjct  18   FTCFASEADIQCLKSVQQSVNDPNGVLKSSWNFENVTVGFICRFTGVECWHPDEDRVLSL  77

Query  373  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  552
             L  L L G  P  LQ+C S+  LDLS N  SG IP  I R +PYL +LDLS N  +G I
Sbjct  78   RLGNLGLQGPFPRGLQNCSSMTGLDLSNNNFSGLIPQDISREIPYLTSLDLSYNSFSGAI  137

Query  553  PPDLGNCTYLNKLILNDNKLTGNIPSQI  636
            P ++ N TYLN L L  N+L+G IP Q 
Sbjct  138  PQNISNMTYLNLLNLQHNQLSGQIPLQF  165



>ref|NP_001238083.1| protein kinase precursor [Glycine max]
 gb|ACJ37414.1| protein kinase [Glycine max]
Length=572

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = +1

Query  184  LLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDN  351
             L+L G G+    + D+ CL+ +K S  DP   L   W+F+N T G+IC+F GV CW+ +
Sbjct  16   FLLLLGCGITYGTDTDIFCLKSIKESLEDPYNYLKFSWDFNNKTEGYICRFNGVECWHPD  75

Query  352  ENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSS  531
            ENRV+ L+L  + L G+ P  +Q+C SL  LDLS N LSGTIP  I   +P+  ++DLS+
Sbjct  76   ENRVLNLKLSNMGLKGQFPRGIQNCSSLTGLDLSINKLSGTIPGDISTLIPFATSIDLST  135

Query  532  NDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            N+ +G IP  L NCT+LN L L+ N+LTG IP Q   L
Sbjct  136  NEFSGAIPVSLANCTFLNTLKLDQNRLTGQIPPQFGVL  173



>ref|XP_010908584.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
 ref|XP_010908592.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
 ref|XP_010908599.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
Length=610

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 93/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             + D+KCL+ ++ S  DP+  L   W FDN T GF+CKF GV CW+ +E+RV+ L L  +
Sbjct  27   TQTDIKCLRTLQRSLNDPNNMLTYSWKFDNLTEGFMCKFNGVDCWHPDESRVLNLRLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  L+ C SL  LDLS N  SGTIP  I + LPY+ +LDLS N  +G IP  L 
Sbjct  87   GLQGQFPSGLEYCTSLTGLDLSNNNFSGTIPPDISKKLPYVTSLDLSFNSFSGEIPVSLS  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN L L  N+LTG IP QI  L
Sbjct  147  NCTYLNVLNLQHNRLTGQIPGQIGGL  172



>ref|XP_007049531.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
 gb|EOX93688.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
Length=619

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  217  DDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            +D+ CL+ ++ SF DP   L   WNF+N T GFIC+F GV CW+ +EN+V+ + L ++ L
Sbjct  32   EDINCLKSIRDSFEDPFNYLNSSWNFNNDTEGFICRFTGVECWHPDENKVLNIRLSDMGL  91

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  +++C SL  LDLS N L G+IP+ I  +LPY+ +LDLSSN+ +G IP  L NC
Sbjct  92   KGEFPRGIKNCKSLTGLDLSSNKLYGSIPTNISGFLPYVTSLDLSSNNFSGNIPKSLANC  151

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            ++LN L L+ NKLT  IP++++ L
Sbjct  152  SFLNILKLDHNKLTDQIPAELSLL  175



>ref|XP_008788252.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Phoenix dactylifera]
Length=610

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 96/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             E D+KCL+ ++ S +DP+  L   W FDN T GF+CKF GV CW+ +E+RV+ L L  +
Sbjct  27   TETDIKCLKTLQQSLKDPNNMLTYSWKFDNLTEGFMCKFNGVDCWHPDESRVLNLHLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  L+ C SL  LDLS N  SG IP+ I + LPY+ +LDLS N  +G IP +L 
Sbjct  87   GLQGQFPSGLEYCTSLTGLDLSSNNFSGPIPADISKKLPYVTSLDLSYNSFSGEIPVNLS  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NCTYLN L L  N+L+G IP Q++ L
Sbjct  147  NCTYLNILNLQHNRLSGQIPWQLSRL  172



>gb|KDP33138.1| hypothetical protein JCGZ_13530 [Jatropha curcas]
Length=616

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 97/158 (61%), Gaps = 1/158 (1%)
 Frame = +1

Query  175  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDN  351
             S L         E D+ CL+ VK S  DP G L   WNF+N T GFIC+F GV CW+ +
Sbjct  18   FSFLATFTATISTETDIACLKSVKASLEDPFGYLNSSWNFNNNTEGFICRFTGVDCWHFD  77

Query  352  ENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSS  531
            EN+V+ L L ++ L G+ P  LQ+C SL  LDLS N L G IP  I + LPY+  LDLSS
Sbjct  78   ENKVLNLRLSDMGLKGQFPRGLQNCTSLTGLDLSNNDLYGQIPFDIQKLLPYVTVLDLSS  137

Query  532  NDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            N+ +G IP  + NC+ LN L L+ N LTG+IP +I  L
Sbjct  138  NNFSGEIPLSIANCSNLNVLRLDQNSLTGHIPQEIGLL  175



>gb|KDO37775.1| hypothetical protein CISIN_1g042065mg, partial [Citrus sinensis]
Length=179

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 96/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             ++D+ CL+ +K S  DP   L   WNF+N T GFICKF GV CW+ +EN+V+ L L ++
Sbjct  22   TKEDIACLKSIKDSLEDPFNYLNSSWNFNNDTEGFICKFTGVECWHPDENKVLNLRLTDM  81

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C S+  LDLS N L G++P  I + + +L  LDLSSN+ +G IP +L 
Sbjct  82   GLKGQFPRGIRNCSSMTGLDLSSNKLYGSLPDDISKLVGFLTGLDLSSNNFSGSIPTNLA  141

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC+YLN L L+ N+ +G IP Q+  L
Sbjct  142  NCSYLNSLKLDHNRFSGQIPPQLGQL  167



>ref|XP_004242451.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
 ref|XP_004242452.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
 ref|XP_010323106.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
Length=620

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 106/167 (63%), Gaps = 3/167 (2%)
 Frame = +1

Query  154  GFSRFLKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKF  324
              + F  + I LVL        + D+ CL+ +K SF DP   L   W FDN T GFICKF
Sbjct  14   ALTTFAAILIYLVLSCAVCSAVQSDIDCLKSIKDSFEDPLNFLNTTWKFDNQTEGFICKF  73

Query  325  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  504
             G+ CW+ +E RV+ + L ++ L G+ P  L++C S+ +LDLS N L G+IP+ I + + 
Sbjct  74   AGIQCWHPDETRVLSISLPDMRLKGKFPRGLKNCTSITSLDLSSNELHGSIPNDISKIIG  133

Query  505  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            ++V LDLSSN+ +G IP +L NC++LN L L+DN+ TG IP++I  L
Sbjct  134  FVVMLDLSSNNFSGEIPVNLANCSFLNSLRLDDNQFTGPIPAEIGLL  180



>ref|XP_006598679.1| PREDICTED: protein kinase isoform X1 [Glycine max]
 gb|KHN16981.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=614

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = +1

Query  184  LLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDN  351
             L+L G G+    + D+ CL+ +K S  DP   L   W+F+N T G+IC+F GV CW+ +
Sbjct  16   FLLLLGCGITYGTDTDIFCLKSIKESLEDPYNYLKFSWDFNNKTEGYICRFNGVECWHPD  75

Query  352  ENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSS  531
            ENRV+ L+L  + L G+ P  +Q+C SL  LDLS N LSGTIP  I   +P+  ++DLS+
Sbjct  76   ENRVLNLKLSNMGLKGQFPRGIQNCSSLTGLDLSINKLSGTIPGDISTLIPFATSIDLST  135

Query  532  NDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            N+ +G IP  L NCT+LN L L+ N+LTG IP Q   L
Sbjct  136  NEFSGAIPVSLANCTFLNTLKLDQNRLTGQIPPQFGVL  173



>emb|CDX70708.1| BnaC03g07920D [Brassica napus]
Length=358

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E DVKCL+ +    +DP+G L  W F N TAG+ICKF GV CW+D+ENRV+ ++L    L
Sbjct  133  EADVKCLRTIHSQVKDPNGYLTSWVFGNKTAGYICKFSGVTCWHDDENRVLSIKLGGYGL  192

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  +++C  L  LDLS N  SG +PS I   +P +  LDLS N  +G IP  L N 
Sbjct  193  EGEFPQGIKNCTDLTALDLSRNNFSGVLPSDIASLVPTVTFLDLSYNQFSGEIPASLPNT  252

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            T+LN L+L  N+ TG +P ++ASL
Sbjct  253  TFLNTLMLQHNQFTGQLPPELASL  276


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +1

Query  175  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  330
            L  LLV    G  ED+V CL+ +K    DP+G L  W F N T G ICKF G
Sbjct  11   LCFLLVSTFTGADEDNVNCLRSIKSQVEDPNGYLSSWVFRNVTEGSICKFSG  62



>ref|XP_011010442.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
 ref|XP_011010516.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=623

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = +1

Query  202  VGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglel  378
            +     D++CL+ +K S  DP   L   W+F+N T GF+C+F+GV CW+ +ENRV+ + L
Sbjct  30   IDATATDIECLKSIKDSLVDPYNYLNTTWDFNNNTEGFLCRFMGVECWHPDENRVLNIRL  89

Query  379  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  558
             +L+L G+ P  +Q C SL  LDLS N L G+IP+ I + LPY+ TLDLS N+ +G IP 
Sbjct  90   SDLSLKGQFPLGIQKCTSLTGLDLSRNKLFGSIPANISKLLPYVTTLDLSFNNFSGGIPL  149

Query  559  DLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            DL NC++LN L L++N+LTGNIP +   L
Sbjct  150  DLANCSFLNDLKLDNNRLTGNIPLEFGLL  178



>gb|EMT17156.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=268

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 89/143 (62%), Gaps = 1/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             E D++CL+ V+ S  DP+G L   WNF+N T  FIC+F GV CW+ +E+RV+ L L  L
Sbjct  23   TEQDIQCLKSVQQSVTDPNGVLKSSWNFENNTVAFICRFTGVECWHPDEDRVLSLRLGNL  82

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G  P  LQ C S+ NLDLS N   G IP+ I R +PYL +LDLS N  +G IP ++ 
Sbjct  83   GLEGPFPRGLQYCTSMMNLDLSNNNFEGPIPANISREVPYLTSLDLSYNSFSGSIPQNIS  142

Query  568  NCTYLNKLILNDNKLTGNIPSQI  636
            N TYLN L L  N+  G IP + 
Sbjct  143  NMTYLNVLSLQHNQFIGEIPRKF  165



>gb|EMT26982.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=604

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +1

Query  196  FGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIgl  372
            F    +E D++CL+ V+ S  DP+G L   WNF+N TAGF C+F GV CW+ +E+RV+ L
Sbjct  18   FTCFASEADIQCLKSVQQSV-DPNGVLKSSWNFENDTAGFTCRFTGVECWHPDEDRVLSL  76

Query  373  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  552
             L  L L G  P  LQ+C S+  LDLS N  SG IP  I R +PYL +LDLS N  +G I
Sbjct  77   RLGNLGLQGSFPHGLQNCSSMTGLDLSNNNFSGPIPQDISREIPYLTSLDLSYNGFSGTI  136

Query  553  PPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            PP++ N TYLN L L  N+ +G IP Q + L
Sbjct  137  PPNISNMTYLNVLNLQHNQFSGEIPPQFSLL  167



>dbj|BAJ87832.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            +E D++CL+ V+ S  DP G L   WNF+N +AGFIC+F GV CW+ +ENRV  L L  L
Sbjct  23   SEFDIQCLKSVQQSVIDPFGVLKSSWNFENDSAGFICRFTGVECWHPDENRVSSLRLGNL  82

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G     LQ+C S+  LDLS N  SG IP++I R +PYL +LDLS N  +G IP  + 
Sbjct  83   GLEGPFLQGLQNCTSMSGLDLSNNYFSGPIPAEISRQMPYLTSLDLSYNSFSGSIPQSIS  142

Query  568  NCTYLNKLILNDNKLTGNIPSQI  636
              TYLN LI   N+L+G IP Q 
Sbjct  143  QMTYLNALIFQHNQLSGQIPPQF  165



>ref|XP_010095584.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB61157.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=602

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 108/169 (64%), Gaps = 7/169 (4%)
 Frame = +1

Query  160  SRFLKLS-----ILLVLFGVGVAE-DDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFIC  318
            SRFL +S      LL+   + +A  +D+ CL+ ++ S  DP G L   WNF+N T G+IC
Sbjct  12   SRFLDISGGILLWLLIHSSLSLASVNDINCLKSIQESLEDPYGYLNSSWNFNNNTEGYIC  71

Query  319  KFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRW  498
            KF+GV CW+ +EN+V+ + L ++ L G  P  + +C SL  LDLS N L G IP+ I R 
Sbjct  72   KFIGVECWHPDENKVLNIRLSDMGLKGLFPQGIVNCSSLTGLDLSNNKLFGPIPTNISRI  131

Query  499  LPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            + Y+ +LDLSSN+ +G IP  L NCTYLN L L+ N+LTG IP ++  L
Sbjct  132  MNYVTSLDLSSNNFSGSIPTLLSNCTYLNVLKLDHNRLTGQIPPELGLL  180



>ref|XP_006828241.1| hypothetical protein AMTR_s00023p00191140 [Amborella trichopoda]
 gb|ERM95657.1| hypothetical protein AMTR_s00023p00191140 [Amborella trichopoda]
Length=217

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 106/170 (62%), Gaps = 3/170 (2%)
 Frame = +1

Query  142  MVGFGFSRFLKLSILLV--LFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  315
            ++    S ++ L ++L   +F  G  E D++CL  +K S RDP   L  WNF+N +   I
Sbjct  2    LISVAPSMYIFLGVILQTWVFSHG-GETDIQCLLALKASLRDPFHYLSSWNFNNNSHVSI  60

Query  316  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  495
            C F+GV CW+ +EN+V+ + L  L L G+ P  L++C S+  LDLS N LSG +PS I +
Sbjct  61   CSFLGVECWHPDENKVLNIRLSGLGLQGQFPQGLENCTSMTGLDLSNNDLSGNLPSDISQ  120

Query  496  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +P + ++D SSN  +G IP  L NCTYLN + L++N+ +G IP+Q+  L
Sbjct  121  KIPMVTSVDFSSNKFSGQIPASLANCTYLNIIKLSENQFSGEIPAQLGGL  170



>gb|AGI92779.1| RLP1.804.2 [Triticum aestivum]
Length=267

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            +E D++CL+ V+ S  DP+G L   W F+N T G+IC F GV CW+ +ENR+  L L  L
Sbjct  23   SEADIQCLKSVQQSVNDPNGVLKSSWIFENATEGYICLFTGVECWHPDENRIFSLRLGNL  82

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G  P  LQ+C S+  +DLS N LSG IP +I R +PYL  LDLS N  +G IP ++ 
Sbjct  83   GLQGSFPRGLQNCSSVTGMDLSNNNLSGPIPQEISREMPYLTFLDLSYNSFSGSIPQNIS  142

Query  568  NCTYLNKLILNDNKLTGNIPSQI  636
            N TYLN L L  N+L+G IP Q 
Sbjct  143  NMTYLNLLNLQHNQLSGQIPPQF  165



>ref|XP_004161544.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
Length=225

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             AE D+ CL+ +K SF+DP+  L  W+F + + G IC+F+G+ CW+ +EN V+ + L  +
Sbjct  27   AAESDLSCLRSIKKSFQDPNKYLTSWDFSSRSEGAICRFIGIICWHPDENSVLSITLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N +SG IP+ +   +P+  TLDLSSN  TG IP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQISGEIPTNVGSLVPFATTLDLSSNKFTGRIPKSIA  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            N +YLN L L+ N+L+G IP +++ L
Sbjct  147  NISYLNVLKLDHNQLSGQIPPELSLL  172



>emb|CBI23562.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+G+K S  DP   L   W+F+N T GFIC+F G+ CW+ +ENRV+ ++L +
Sbjct  27   ATESDLYCLKGIKNSLDDPYRYLNSSWDFNNKTEGFICRFTGIECWHPDENRVLNIKLAD  86

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G+ P A+++C SL  LDLS N L G+IPS I   + ++ TLDLSSN+ +GPIP  L
Sbjct  87   MGLKGQFPRAIKNCTSLTGLDLSSNDLYGSIPSDINDIIKFMTTLDLSSNNFSGPIPLGL  146

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC+YLN L L++N+L+G IP ++  L
Sbjct  147  SNCSYLNVLKLDNNQLSGTIPLELGLL  173



>ref|XP_011013756.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=623

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = +1

Query  136  FRMVGFGFSRFLKLSILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAG  309
            F +  F FS       LL  F V  A D DV CL+ +K S  DP G L   W+F+N T G
Sbjct  11   FFIYSFMFS-------LLATFTVTSATDTDVYCLKSIKDSMIDPHGYLNTTWDFNNYTEG  63

Query  310  FICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQI  489
            FIC+F+GV CW+ +ENRV+ L L +L L G+ P  L++C SL  L+LS N L G IPS I
Sbjct  64   FICRFLGVDCWHPDENRVLNLILFDLGLKGQFPHGLKNCTSLSGLNLSHNELQGPIPSDI  123

Query  490  CRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             + LPY+  LDLS N  +G IP ++ N ++LN L L+ NKLTG+IP +I  L
Sbjct  124  SKRLPYITNLDLSFNKFSGEIPINIANLSFLNVLKLDKNKLTGHIPLEIGLL  175



>ref|XP_004161543.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At5g48380-like [Cucumis 
sativus]
Length=614

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
              E D+ CL+ +K SF+DP+  L  W+F N + G IC+F G+ CW+ +ENRV+ + L  +
Sbjct  27   ATESDLFCLRSIKNSFQDPNEYLTSWDFSNRSEGVICRFAGIMCWHPDENRVLSITLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N +SG IP+ I   + Y  TLDLSSND TGPIP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQMSGEIPTDIGSIVKYAATLDLSSNDFTGPIPKSIA  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            + +YLN L L+ N+L+G IP +++ L
Sbjct  147  DISYLNILKLDHNQLSGQIPPELSLL  172



>ref|XP_003635622.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Vitis vinifera]
Length=625

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+G+K S  DP   L   W+F+N T GFIC+F G+ CW+ +ENRV+ ++L +
Sbjct  33   ATESDLYCLKGIKNSLDDPYRYLNSSWDFNNKTEGFICRFTGIECWHPDENRVLNIKLAD  92

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G+ P A+++C SL  LDLS N L G+IPS I   + ++ TLDLSSN+ +GPIP  L
Sbjct  93   MGLKGQFPRAIKNCTSLTGLDLSSNDLYGSIPSDINDIIKFMTTLDLSSNNFSGPIPLGL  152

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC+YLN L L++N+L+G IP ++  L
Sbjct  153  SNCSYLNVLKLDNNQLSGTIPLELGLL  179



>ref|XP_004148961.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
Length=225

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             AE D+ CL+ +K SF+DP+  L  W+F + + G IC+F+G+ CW+ +EN V+ + L  +
Sbjct  27   AAESDLSCLRSIKKSFQDPNKYLTSWDFSSRSEGAICRFIGIICWHPDENSVLSITLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N +SG IP+ +   +P+  TLDLSSN  TG IP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQISGEIPTNVGSIVPFATTLDLSSNKFTGRIPKSIA  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            N +YLN L L+ N+L+G IP +++ L
Sbjct  147  NISYLNVLKLDHNQLSGQIPPELSLL  172



>ref|XP_007200419.1| hypothetical protein PRUPE_ppa011049mg [Prunus persica]
 gb|EMJ01618.1| hypothetical protein PRUPE_ppa011049mg [Prunus persica]
Length=225

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = +1

Query  178  SILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWND  348
            S+L +L   G +   E D+ CL+ +K S  D  G L  W+F+N T GFIC F+GV CW+ 
Sbjct  20   SVLWLLLSCGFSFGVESDINCLKSIKASLEDTLGYLNSWDFNNNTEGFICNFLGVECWHP  79

Query  349  NENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLS  528
            +E+RV+ ++L +L L G  P  + +C SL  LDLS N L+G +P+ I + + ++ +LDLS
Sbjct  80   HESRVLNIKLSDLGLKGSFPQGVANCTSLTGLDLSSNQLNGPLPTDIDKIITFITSLDLS  139

Query  529  SNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            SN  TG IP  L NC+YLN L L++NK +G IP ++  L
Sbjct  140  SNSFTGQIPMKLSNCSYLNVLKLDNNKFSGIIPPELGQL  178



>ref|XP_009124570.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
Length=235

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E D+ CL+ +K   +DP  +L  W F N + G+ICKF GV CW   +NRV+ + L    L
Sbjct  28   ETDINCLKSLKSQLQDPKAHLSNWIFGNYSEGYICKFFGVECWGSEQNRVLSINLGGYGL  87

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  +  C S+++L+L+GN L GTIPS+   ++PYLVTLDLS N+    IP  L N 
Sbjct  88   KGEFPSGVTLCTSMESLNLTGNNLYGTIPSEFFSFIPYLVTLDLSHNNFASNIPASLSNM  147

Query  574  TYLNKLILNDNKLTGNIPSQIAS  642
             YL  L+L+ N  TG++PS + S
Sbjct  148  YYLKTLLLDHNWFTGHLPSGLGS  170



>emb|CDM85413.1| unnamed protein product [Triticum aestivum]
Length=270

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 90/143 (63%), Gaps = 1/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            +E D++CL+ V+ S  DP+G L   W F N T G+IC F GV CW+ +ENR+  L L  L
Sbjct  26   SEADIQCLKSVQQSVNDPNGVLKSSWIFKNATEGYICLFTGVECWHPDENRIFSLRLGNL  85

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G  P  LQ+C S+  +DLS N LSG IP +I R +PYL  LDLS N  +G IP ++ 
Sbjct  86   GLQGSFPRGLQNCSSVTGMDLSNNNLSGPIPQEISREMPYLTFLDLSYNSFSGSIPQNIS  145

Query  568  NCTYLNKLILNDNKLTGNIPSQI  636
            N TYLN L L  N+L+G IP Q 
Sbjct  146  NMTYLNLLNLQHNQLSGQIPPQF  168



>gb|KDO43522.1| hypothetical protein CISIN_1g006982mg [Citrus sinensis]
Length=623

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  184  LLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNEN  357
            LL+ F +    ++D+ CL+ +K S  DP   L   WNF+N T GFICKF GV CW+ +EN
Sbjct  21   LLLCFSLSYGTKEDLACLKSIKDSLEDPFNYLNSSWNFNNDTEGFICKFTGVECWHPDEN  80

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            RV+ L L ++ L G+ P  +++C S+  LDLS N L G +P  I + + +L +LDLSSN+
Sbjct  81   RVLNLRLTDMGLKGQFPRGIRNCSSMTGLDLSSNKLYGPLPDDISKLVGFLTSLDLSSNN  140

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +G IP +L NCTYLN L L+ N+ +G IP Q+  L
Sbjct  141  FSGSIPSNLANCTYLNSLKLDHNRFSGQIPPQLGQL  176



>ref|XP_006447934.1| hypothetical protein CICLE_v10014610mg [Citrus clementina]
 ref|XP_006469354.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Citrus sinensis]
 gb|ESR61174.1| hypothetical protein CICLE_v10014610mg [Citrus clementina]
Length=623

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  184  LLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNEN  357
            LL+ F +    ++D+ CL+ +K S  DP   L   WNF+N T GFICKF GV CW+ +EN
Sbjct  21   LLLCFSLSYGTKEDLACLKSIKDSLEDPFNYLNSSWNFNNDTEGFICKFTGVECWHPDEN  80

Query  358  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  537
            RV+ L L ++ L G+ P  +++C S+  LDLS N L G +P  I + + +L +LDLSSN+
Sbjct  81   RVLNLRLTDMGLKGQFPRGIRNCSSMTGLDLSSNKLYGPLPDDISKLVGFLTSLDLSSNN  140

Query  538  LTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
             +G IP +L NCTYLN L L+ N+ +G IP Q+  L
Sbjct  141  FSGSIPSNLANCTYLNSLKLDHNRFSGQIPPQLGQL  176



>ref|XP_008447262.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Cucumis melo]
Length=614

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
              E D+ CL+ +K SF+DP+  L  W+F N + G ICKF G+ CW+ +EN+V+ + L  +
Sbjct  27   ATESDLSCLRSIKKSFQDPNEYLTSWDFSNRSEGVICKFAGIMCWHPDENKVLSITLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N +SG IP+ I   + +  TLDLSSND TGPIP  + 
Sbjct  87   GLKGQFPIGIKNCSSLTGLDLSFNQISGEIPTDIGSIVSFATTLDLSSNDFTGPIPESIA  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            + TYLN L L+ N+L+G IP +++ L
Sbjct  147  DITYLNVLKLDHNQLSGQIPPELSLL  172



>gb|KGN44709.1| hypothetical protein Csa_7G373520 [Cucumis sativus]
Length=225

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             AE D+ CL+ +K SF+DP+  L  W+F + + G IC+F+G+ CW+ +EN V+ + L  +
Sbjct  27   AAESDLSCLRSIKKSFQDPNKYLTSWDFSSRSEGAICRFIGIICWHPDENSVLSINLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N +SG IP+ +   +P+  TLDLSSN  TG IP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQISGEIPTNVGSIVPFATTLDLSSNKFTGRIPKSIA  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            N +YLN L L+ N+L+G IP +++ L
Sbjct  147  NISYLNVLKLDHNQLSGQIPPELSLL  172



>ref|XP_009132248.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
Length=248

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E +V CL+ +    +DP+G L  W F N TAGFICKF GV CW+D+ENRV+ ++L    L
Sbjct  24   EANVNCLRNIYSGVKDPNGYLASWVFGNQTAGFICKFTGVTCWHDDENRVLSIKLGGYGL  83

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  ++ C  L  LDLS N  SG +PS I   +P +  LDLS N  +G IP  L N 
Sbjct  84   EGEFPLGIKQCWDLTGLDLSRNNFSGVLPSNIASLIPSVTILDLSYNKFSGKIPAGLSNI  143

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            T+LN L+L  N+ TG +P ++ S+
Sbjct  144  TFLNTLMLQHNQFTGQLPPELVSM  167



>emb|CDY05685.1| BnaC02g38520D [Brassica napus]
Length=625

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E +V CL+ +    +DP+G L  W F N TAG+ICKF GV CW+D+ENRV+ ++L    L
Sbjct  31   EANVNCLRTIYKQVKDPNGYLTSWVFGNQTAGYICKFAGVTCWHDDENRVLSIKLGGYGL  90

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  +++C  L  LDLS N  SG +PS +  ++P +  LDLS N  +GPIPP + N 
Sbjct  91   EGEFPLGIKNCTDLTALDLSKNNFSGPLPSNVTSFIPLVTILDLSYNQFSGPIPPSISNI  150

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            T+LN L+L  N+ TG +P+++  L
Sbjct  151  TFLNSLMLQHNQFTGTLPAELVLL  174



>ref|XP_008382758.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=197

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+ +K + +DP G L   W+F+N T GFIC F+G+ CW+ +E++V+ ++L +
Sbjct  33   AVESDINCLKSLKATLQDPLGYLNSSWDFNNNTEGFICNFLGIECWHPHESKVLNIKLSD  92

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            L L G  P  + +C SL  LDLS N LSG +P  I R + ++ TLDLSSN  +G IP ++
Sbjct  93   LGLKGPFPHGIANCTSLTGLDLSSNKLSGPLPEDIGRIISFITTLDLSSNSFSGQIPTNI  152

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC+YLN L L+ N+ TGNIP  I  L
Sbjct  153  TNCSYLNVLKLDSNQFTGNIPLGIGQL  179



>ref|XP_004148962.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
 gb|KGN44710.1| hypothetical protein Csa_7G373530 [Cucumis sativus]
Length=614

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 95/146 (65%), Gaps = 0/146 (0%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
              E D+ CL+ +K SF+DP+  L  W+F N + G IC+F G+ CW+ +ENRV+ + L  +
Sbjct  27   ATESDLFCLRSIKNSFQDPNEYLTSWDFSNRSEGVICRFTGIMCWHPDENRVLSITLSNM  86

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N +SG IP  I   + Y  TLDLSSND TGPIP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQMSGEIPMDIGSIVKYAATLDLSSNDFTGPIPKSIA  146

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            + +YLN L L+ N+L+G IP +++ L
Sbjct  147  DISYLNILKLDHNQLSGQIPPELSLL  172



>emb|CAN63265.1| hypothetical protein VITISV_037939 [Vitis vinifera]
Length=619

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
              E D+ CL+ +K S  DP   L   W+F+N T GFIC+F G+ CW+ +ENRV+ ++L +
Sbjct  27   ATESDLYCLKAIKKSLDDPYRYLNSSWDFNNKTEGFICRFTGIECWHPDENRVLNIKLAD  86

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G+ P A+++C SL  LDLS N L G+IPS I   + ++ TLDLSSN+ +GPIP  L
Sbjct  87   MGLKGQFPRAIKNCTSLTGLDLSSNDLYGSIPSDINDIIKFMTTLDLSSNNFSGPIPLXL  146

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC+YLN L L++N+L+G IP ++  L
Sbjct  147  SNCSYLNVLKLDNNQLSGTIPLELGLL  173



>gb|KJB42638.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42639.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42640.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42641.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
Length=621

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
             +++D+ CL+ +K S  D  G L   WNFDNTT GFIC+F G+ CW+ +ENRV+ + L +
Sbjct  29   ASQEDIDCLRSIKDSLEDSLGYLNSSWNFDNTTEGFICRFTGIDCWHPDENRVLNIRLAD  88

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G  P  +  C S+  LDLS N L G IPS I + + Y+ +LDLSSN+ +G IPP L
Sbjct  89   MGLKGVFPQGIVKCKSITGLDLSSNKLYGPIPSNISQIIHYVTSLDLSSNNFSGEIPPAL  148

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             NC++LN L L+ N LTG+IP  ++ L
Sbjct  149  ANCSFLNILKLDYNSLTGSIPPVLSLL  175



>dbj|BAJ33754.1| unnamed protein product [Thellungiella halophila]
Length=622

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E +V CL+ +    +DP+G L  W F N T GFICKF+GV CW+D+ENRV+ + L    L
Sbjct  29   EANVNCLRSILSQVKDPNGYLSSWVFRNQTVGFICKFIGVTCWHDDENRVLSINLSGYGL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  ++ C  L  LDLS N  SGT+P+ I   +P + TLDLS N  +G IPP + N 
Sbjct  89   TGEFPLGIKQCSDLTGLDLSRNNFSGTLPTNISSLIPLVTTLDLSGNRFSGEIPPLISNI  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            T+LN L+L  N+ TG +P Q+  L
Sbjct  149  TFLNTLMLQQNQFTGPLPPQLVLL  172



>ref|XP_008779573.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At5g48380 [Phoenix dactylifera]
Length=612

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             + D++CL+ ++ S  DP   L   WNF N T GFICKF GV CW+ +ENRV+ L L  +
Sbjct  29   TKTDIECLRRIQDSLHDPFDYLKYSWNFTNKTEGFICKFNGVECWHPDENRVLFLRLSNM  88

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLS N LSG IP+ I R +P++ +LDLS N  +G IP +L 
Sbjct  89   GLEGQFPLGIENCTSLAGLDLSSNNLSGPIPADIARRIPFVTSLDLSFNTFSGEIPANLS  148

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC+YLN L L  N+L+G IP Q+  L
Sbjct  149  NCSYLNILNLQHNQLSGQIPGQLTIL  174



>ref|XP_002450551.1| hypothetical protein SORBIDRAFT_05g006860 [Sorghum bicolor]
 gb|EES09539.1| hypothetical protein SORBIDRAFT_05g006860 [Sorghum bicolor]
Length=604

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = +1

Query  220  DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlgg  399
            D++CL+ +K S  DPD  L  W F+N T G IC F GV CW+ NENRV+ L L    L G
Sbjct  29   DIQCLKKLKASV-DPDNKLE-WTFNNNTEGSICGFNGVECWHPNENRVLSLHLGSFGLKG  86

Query  400  eVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTY  579
            + P  L++C S+ +LDLS N LSG IP+ I + LP++  LDLS N  +G IP  L NC+Y
Sbjct  87   QFPDGLENCSSMTSLDLSSNNLSGPIPADISKRLPFITNLDLSYNSFSGEIPEALANCSY  146

Query  580  LNKLILNDNKLTGNIPSQIASL  645
            LN + L  NKLTG IP Q+A+L
Sbjct  147  LNIVSLQHNKLTGTIPGQLAAL  168



>ref|NP_001143239.1| uncharacterized protein LOC100275764 precursor [Zea mays]
 gb|ACG30073.1| hypothetical protein [Zea mays]
Length=467

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            +D ++CL+GVK    DP+G L  W+F NT+ G +  + G+ CWN  E+RV+ L L    L
Sbjct  34   QDGLRCLRGVKHDLADPNGRLADWDFKNTSGGAVYSYSGIGCWNLQESRVLSLSLSGFGL  93

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G +P +LQ C +   LDLS N L GTI   +C WLP+LVTLDLSSN LTG IP +L NC
Sbjct  94   VGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANC  153

Query  574  TYLNKLILNDNKLTGN  621
             +LN L L+ +   G 
Sbjct  154  RFLNSLTLSGSSRAGT  169



>ref|XP_009132249.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
Length=242

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 93/157 (59%), Gaps = 2/157 (1%)
 Frame = +1

Query  175  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  354
            L  LLV    G  E +V CL+ +K   +DP  +L  W F N  A +IC FVGV CW+  E
Sbjct  7    LWFLLVSSFTGANEVNVNCLRSIKSQVKDPKRSLSSWVFRNGNATYICSFVGVECWD--E  64

Query  355  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  534
            +RV+ + L    L GE P  L DC SL  LDLS N  SG +PS I   +P++ TLDLS N
Sbjct  65   DRVLTIYLSGYGLQGEFPLGLNDCSSLTGLDLSRNNFSGALPSNIASLIPFVTTLDLSYN  124

Query  535  DLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
              +G IP  L N T+LN L+L  N+ TG +P Q+ASL
Sbjct  125  QFSGEIPTGLLNVTFLNTLMLQHNQFTGQLPPQLASL  161



>ref|XP_006395190.1| hypothetical protein EUTSA_v10003825mg [Eutrema salsugineum]
 gb|ESQ32476.1| hypothetical protein EUTSA_v10003825mg [Eutrema salsugineum]
Length=622

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E +V CL+ +    +DP+G L  W F N T GFICKF GV CW+D+ENRV+ ++L    L
Sbjct  29   EANVNCLRSILSQVKDPNGYLSSWVFRNQTVGFICKFTGVTCWHDDENRVLSIKLSGFGL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             GE P  ++ C  L  LDLS N  SGT+P+ I   +P + TLDLS N  +G IPP + N 
Sbjct  89   TGEFPLGIKQCSDLTGLDLSRNNFSGTLPTNISSLIPLVTTLDLSGNRFSGEIPPLISNI  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            T+LN L+L  N+ TG +P Q+  L
Sbjct  149  TFLNTLMLQQNQFTGPLPPQLVLL  172



>ref|XP_004250582.1| PREDICTED: F-box protein At3g07870-like [Solanum lycopersicum]
Length=523

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 2/165 (1%)
 Frame = +1

Query  133  DFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  312
            DF  +     + LK   +L+L  V  A +D+KCLQG+K SF+DP+ N   WNF N + GF
Sbjct  336  DFLFLHHPVKKTLKKLDVLLLHNV-TASNDIKCLQGLKDSFKDPNVNFNSWNFSNYSMGF  394

Query  313  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  492
            ICKFVGV  WN+ ENR+I L L  +NL  ++P A + C SL  L LSGN  SG+IP+++ 
Sbjct  395  ICKFVGVIYWNNLENRMISLSLPNMNLSVQLPDAFKCCSSLATLHLSGNSFSGSIPAEL-  453

Query  493  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIP  627
            R   YL  L L++N L+G IPP++   T L  L L +N L+GNIP
Sbjct  454  RNCTYLNKLILNNNKLSGNIPPEISQLTRLKVLSLANNNLSGNIP  498



>ref|XP_007200215.1| hypothetical protein PRUPE_ppa015531mg, partial [Prunus persica]
 gb|EMJ01414.1| hypothetical protein PRUPE_ppa015531mg, partial [Prunus persica]
Length=247

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = +1

Query  169  LKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWN  345
            L L +L   F  GV E D+ CL+ +K S  D  G L   W+F+N T GFIC F+G+ CW+
Sbjct  2    LWLLLLSCSFSFGV-ESDINCLKSIKASLEDTLGYLNSSWDFNNNTEGFICNFLGIECWH  60

Query  346  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  525
             +E++V+ ++L EL L G+ P  +++C SL  LDLSGN LSG +P  I + L ++ +LDL
Sbjct  61   PHESKVLNIKLSELGLKGQFPRGVENCTSLTGLDLSGNMLSGPLPHDIDKILTWVTSLDL  120

Query  526  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            SSN  +G IP  L NC+Y+N L L++N+ +GNIP+++  L
Sbjct  121  SSNSFSGLIPATLSNCSYMNVLKLDNNQFSGNIPAEVNQL  160



>ref|XP_008235929.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Prunus mume]
Length=318

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 99/146 (68%), Gaps = 1/146 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
             E D+ CL+ +K SF D  G+L   W+F N T GFIC F G+ CW+ +E++V+ ++L EL
Sbjct  35   VESDINCLKSIKASFEDTLGSLNSSWDFSNNTEGFICNFRGIECWHPHESKVLNIKLSEL  94

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L G+ P  +++C SL  LDLSGN LSG +P  I + L ++ +LDLSSN  +G IP  L 
Sbjct  95   GLKGQFPRGVENCTSLTGLDLSGNMLSGPLPHDIDKILTWVTSLDLSSNSFSGLIPATLS  154

Query  568  NCTYLNKLILNDNKLTGNIPSQIASL  645
            NC+Y+N L L++N+ +GNIP+++  L
Sbjct  155  NCSYMNVLKLDNNQFSGNIPAEVYQL  180



>ref|XP_006379646.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 ref|XP_002312207.2| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|ERP57443.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|EEE89574.2| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
Length=630

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = +1

Query  202  VGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglel  378
            +     D++CL+ +K S  DP   L   W+F+N T GF+C+F+GV CW+ +ENRV+ + L
Sbjct  30   IDATATDIECLKSIKDSLVDPYNYLNTTWDFNNNTEGFLCRFMGVECWHPDENRVLNIRL  89

Query  379  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  558
             +L+L G+ P  +Q C SL  LDLS N L G+IP+ I + LPY+  LDLS N+ +G IP 
Sbjct  90   SDLSLKGQFPLGIQKCTSLTGLDLSRNKLFGSIPANISKLLPYVTNLDLSFNNFSGGIPL  149

Query  559  DLGNCTYLNKLILNDNKLTGNIPSQIASL  645
            +L NC++LN L L++N+LTGNIP +   L
Sbjct  150  NLANCSFLNDLKLDNNRLTGNIPLEFGLL  178



>gb|EMT01778.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=282

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 88/143 (62%), Gaps = 1/143 (1%)
 Frame = +1

Query  211  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  387
            +E D++CL+ V+ S  DP+G L   W F N T G+IC F GV CW+ +EN +  L L  L
Sbjct  111  SEADIQCLKSVQQSVNDPNGVLKSSWIFKNATEGYICLFTGVECWHPDENMIFSLRLGNL  170

Query  388  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  567
             L    P  LQ+C S+ +LDLS N  SG IP  I R +PYL  LDLS N  +GPI  ++ 
Sbjct  171  GLQAAFPRGLQNCSSVTDLDLSNNNFSGPIPQDISREMPYLTYLDLSYNSFSGPILQNIS  230

Query  568  NCTYLNKLILNDNKLTGNIPSQI  636
            N TYLN L L  N+L+G IPSQ 
Sbjct  231  NMTYLNVLNLQHNQLSGEIPSQF  253



>emb|CDY48749.1| BnaA02g30100D [Brassica napus]
Length=623

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +1

Query  214  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  393
            E +V CL+ +    +DP+G L  W F N TAG+ICKF GV CW+D+ENRV+ ++L    L
Sbjct  29   EANVNCLRTIYNQVKDPNGYLTSWVFGNQTAGYICKFTGVTCWHDDENRVLSIKLGGYGL  88

Query  394  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  573
             G  P  +++C  L  LDLS N  SG +PS I   +P +  LDLS N  +GPIPP + N 
Sbjct  89   TGGFPLGIKNCTDLTALDLSRNNFSGPLPSNITDSIPLVTILDLSYNQFSGPIPPSISNI  148

Query  574  TYLNKLILNDNKLTGNIPSQIASL  645
            T+LN L+L  N+ TG +P+++  L
Sbjct  149  TFLNSLMLQHNQFTGTLPAELVLL  172



>ref|XP_006372679.1| hypothetical protein POPTR_0017s03800g [Populus trichocarpa]
 gb|ERP50476.1| hypothetical protein POPTR_0017s03800g [Populus trichocarpa]
Length=485

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 89/147 (61%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  384
               E DV CL+ VK S  DP  +   W+F N T GFIC+F GV CW   E+RV+ L L  
Sbjct  24   SATEPDVYCLKSVKDSLEDPYNHFSSWDFANQTEGFICRFAGVDCWKPEESRVLNLALSN  83

Query  385  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  564
            + L G+ P  +++C SL  LDL  N L G IPS I + LPY+  LDLS N+ +G IP  +
Sbjct  84   MGLKGQFPPGIENCTSLTGLDLPRNELQGPIPSDISKRLPYITNLDLSFNNFSGEIPSSI  143

Query  565  GNCTYLNKLILNDNKLTGNIPSQIASL  645
             N ++LN L L+ N+L GNIP Q+  L
Sbjct  144  ANLSFLNVLKLDHNQLIGNIPPQVGLL  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000