BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016K03

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR00230.1|  flavonoid 3'-hydroxylase                                314   6e-104   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               318   5e-103   Ipomoea nil [qian niu]
gb|ABW69693.1|  flavonoid 3'-hydrogenase                                313   5e-101   Ipomoea purpurea
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                312   8e-101   Ipomoea purpurea
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               304   1e-97    Ipomoea tricolor [campanilla]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                285   3e-90    Ipomoea quamoclit [bejuco de cipres]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                285   4e-90    Ipomoea coccinea [red morning-glory]
gb|ACS71532.1|  flavonoid 3' hydroxylase                                283   2e-89    Ipomoea horsfalliae [Kuhio-vine]
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                280   2e-88    Ipomoea batatas [batate]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                279   5e-88    Ipomoea batatas [batate]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                279   8e-88    Ipomoea ternifolia
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                272   3e-85    Ipomoea batatas [batate]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                272   3e-85    Ipomoea batatas [batate]
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                268   7e-84    Ipomoea batatas [batate]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               265   3e-82    Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               262   2e-81    Calystegia soldanella
gb|AGM46642.1|  flavonoid 3'-hydroxylase protein                        239   5e-77    Apium graveolens
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               243   5e-74    Vitis vinifera
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               243   6e-74    Vitis vinifera
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    242   9e-74    Petunia x hybrida [garden petunia]
emb|CAN68303.1|  hypothetical protein VITISV_041731                     242   1e-73    Vitis vinifera
dbj|BAE47003.1|  flavonoid 3'-hydroxylase                               235   4e-73    Vitis vinifera
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              240   5e-73    Nicotiana sylvestris
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           240   5e-73    Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                240   6e-73    Vitis amurensis
emb|CAN62275.1|  hypothetical protein VITISV_007552                     238   1e-72    Vitis vinifera
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                239   1e-72    Gerbera hybrid cultivar
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              239   2e-72    Vitis vinifera
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              238   2e-72    Nicotiana tabacum [American tobacco]
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               237   9e-72    Vitis vinifera
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              236   3e-71    Nicotiana tomentosiformis
emb|CDP19009.1|  unnamed protein product                                236   3e-71    Coffea canephora [robusta coffee]
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                236   3e-71    Nicotiana tabacum [American tobacco]
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                235   5e-71    Nekemias grossedentata
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               235   7e-71    Vaccinium ashei
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         234   7e-71    Solanum tuberosum [potatoes]
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                234   8e-71    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AJO67965.1|  flavonoid-3'-hydroxylase                                225   2e-70    Prunus avium [gean]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       233   2e-70    Dahlia pinnata
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         233   3e-70    Solanum lycopersicum
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                233   3e-70    Osteospermum hybrid cultivar
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                233   3e-70    Iochroma cyaneum
emb|CDP19008.1|  unnamed protein product                                233   4e-70    Coffea canephora [robusta coffee]
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               232   6e-70    Antirrhinum kelloggii
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                232   8e-70    Ageratina adenophora
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                231   1e-69    Pyrus pyrifolia [sha li]
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                231   1e-69    Cosmos sulphureus [orange cosmos]
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         231   2e-69    Malus domestica [apple tree]
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                231   2e-69    Iochroma calycinum
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               231   2e-69    Gynura bicolor
gb|AHA49900.1|  flavonoid 3' hydroxylase                                231   2e-69    Malus hybrid cultivar
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            231   2e-69    Malus domestica [apple tree]
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                231   2e-69    Iochroma calycinum
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                231   2e-69    Bidens aurea
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                229   6e-69    Cichorium intybus [radicchio]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                228   1e-68    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                228   2e-68    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                228   2e-68    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                228   2e-68    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              228   4e-68    Pyrus x bretschneideri [bai li]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                227   4e-68    Chromolaena odorata
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              227   5e-68    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         227   5e-68    Jatropha curcas
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       227   6e-68    Dahlia pinnata
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                227   7e-68    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFI25037.1|  flavonoid 3'-hydroxylase                                217   9e-68    Populus deltoides x Populus tremuloides
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              226   9e-68    Sesamum indicum [beniseed]
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              226   2e-67    Nelumbo nucifera [Indian lotus]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   2e-67    
gb|ACR14867.1|  flavonoid 3' hydroxylase                                226   2e-67    Malus domestica [apple tree]
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       226   2e-67    Camellia sinensis [black tea]
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               226   2e-67    Dianthus caryophyllus [carnation]
gb|AGC29948.1|  CYP75B65                                                225   3e-67    Sinopodophyllum hexandrum [Himalayan mayapple]
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                225   3e-67    Dahlia pinnata
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              225   3e-67    Prunus avium [gean]
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             225   3e-67    Prunus persica
gb|AJA79074.1|  flavonoid 3' hydroxylase                                225   3e-67    Prunus persica
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             225   5e-67    Populus trichocarpa [western balsam poplar]
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 224   6e-67    
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                224   7e-67    Tagetes erecta [big marigold]
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 224   7e-67    Theobroma cacao [chocolate]
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              224   1e-66    Populus euphratica
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    223   1e-66    Nicotiana sylvestris
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               223   2e-66    Lobelia erinus
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              223   2e-66    Prunus mume [ume]
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                223   2e-66    Pilosella officinarum [mouse-ear hawkweed]
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             223   3e-66    Callistephus chinensis [Chinese aster]
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         223   3e-66    Eucalyptus grandis [rose gum]
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                222   3e-66    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         223   4e-66    Nelumbo nucifera [Indian lotus]
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                222   6e-66    Penstemon barbatus
gb|KDO54631.1|  hypothetical protein CISIN_1g020877mg                   216   8e-66    Citrus sinensis [apfelsine]
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                221   8e-66    Echinops bannaticus
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             220   2e-65    Eutrema salsugineum [saltwater cress]
gb|AEF30421.1|  flavonoid 3'-hydroxylase                                213   2e-65    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         220   3e-65    Camelina sativa [gold-of-pleasure]
gb|KDO37751.1|  hypothetical protein CISIN_1g042286mg                   214   3e-65    Citrus sinensis [apfelsine]
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       220   3e-65    Coreopsis grandiflora
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               219   4e-65    Rhododendron x pulchrum
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                220   4e-65    Antirrhinum majus [garden snapdragon]
gb|KJB51033.1|  hypothetical protein B456_008G198200                    217   6e-65    Gossypium raimondii
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      219   6e-65    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AJD25177.1|  cytochrome P450 CYP75B79                                219   6e-65    Salvia miltiorrhiza [Chinese salvia]
emb|CDX69984.1|  BnaA10g23330D                                          219   8e-65    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                219   8e-65    Brassica napus [oilseed rape]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                219   9e-65    Cynara cardunculus var. scolymus [artichoke]
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      218   1e-64    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                219   1e-64    Penstemon neomexicanus
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              218   1e-64    Brassica rapa
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         218   1e-64    Camelina sativa [gold-of-pleasure]
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               218   1e-64    Dianthus caryophyllus [carnation]
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             218   2e-64    
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             218   2e-64    Gossypium arboreum [tree cotton]
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                218   2e-64    Rudbeckia hirta
gb|AEN71546.1|  flavanone 3'-hydroxylase                                218   3e-64    Paeonia suffruticosa [moutan peony]
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                218   3e-64    Paeonia suffruticosa [moutan peony]
gb|KJB51032.1|  hypothetical protein B456_008G198200                    216   8e-64    Gossypium raimondii
gb|ACO35755.1|  chalcone 3-hydroxylase                                  216   9e-64    Cosmos sulphureus [orange cosmos]
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                216   1e-63    Centaurea cyanus [bachelor's-button]
emb|CDX99037.1|  BnaC09g47980D                                          219   1e-63    
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                216   1e-63    Erythranthe guttata [common monkey flower]
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             216   2e-63    
gb|AGL81348.1|  flavanone 3' hydroxylase                                215   2e-63    Pyrus communis
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                215   2e-63    Garcinia mangostana [mangosteen]
gb|EPS57881.1|  flavonoid 3'-hydroxylase                                213   2e-63    Genlisea aurea
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                215   2e-63    Gossypium hirsutum [American cotton]
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               215   3e-63    Gentiana triflora
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              214   4e-63    Camelina sativa [gold-of-pleasure]
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                214   4e-63    Gossypium hirsutum [American cotton]
gb|KEH32010.1|  flavonoid hydroxylase                                   214   7e-63    Medicago truncatula
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         214   7e-63    Citrus sinensis [apfelsine]
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              213   8e-63    Morus notabilis
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                214   9e-63    Camellia nitidissima
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         213   1e-62    Morus notabilis
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      213   1e-62    Trifolium pratense [peavine clover]
gb|AGI16386.1|  flavonoid 3' hydroxylase                                213   1e-62    Ribes nigrum [European black currant]
gb|AEX07282.1|  F3'H                                                    213   1e-62    Arachis hypogaea [goober]
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            213   1e-62    Daucus carota [carrots]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                212   2e-62    Viola x wittrockiana
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               212   3e-62    Perilla frutescens var. crispa
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              212   3e-62    Echinops bannaticus
gb|AAO47850.1|  defective flavonoid 3'-hydroxylase                      206   6e-62    Glycine max [soybeans]
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            211   7e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         211   8e-62    
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      211   8e-62    Matthiola incana
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                209   9e-62    Fagopyrum esculentum
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                211   1e-61    Paeonia lactiflora [common garden peony]
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                211   1e-61    Epimedium sagittatum
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             209   5e-61    Phaseolus vulgaris [French bean]
gb|AAO47844.1|  gray pubescence flavonoid 3'-hydroxylase                206   6e-61    Glycine max [soybeans]
gb|AJD25178.1|  cytochrome P450 CYP75B80                                208   1e-60    Salvia miltiorrhiza [Chinese salvia]
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           207   3e-60    Medicago truncatula
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      207   3e-60    Pelargonium x hortorum [bedding geranium]
gb|KEH33153.1|  flavonoid hydroxylase                                   207   4e-60    Medicago truncatula
gb|ACJ85671.1|  unknown                                                 204   6e-60    Medicago truncatula
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              206   9e-60    Osteospermum hybrid cultivar
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                205   1e-59    Glycine max [soybeans]
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              205   1e-59    Glycine soja [wild soybean]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           205   1e-59    Glycine max [soybeans]
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             205   1e-59    Capsella rubella
gb|AIB06740.1|  flavanone 3'-hydroxylase                                203   8e-59    Mangifera indica
gb|AES69199.2|  flavonoid hydroxylase                                   202   1e-58    Medicago truncatula
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                202   2e-58    Fragaria chiloensis
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              202   2e-58    Cichorium intybus [radicchio]
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         202   2e-58    
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               201   3e-58    Fragaria x ananassa
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                201   5e-58    Fragaria x ananassa
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                201   5e-58    Fragaria vesca [alpine strawberry]
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                201   5e-58    Fragaria x ananassa
ref|NP_001274347.1|  uncharacterized protein LOC101314754               201   5e-58    Fragaria vesca [alpine strawberry]
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                201   6e-58    Fragaria virginiana
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                200   9e-58    Fragaria x ananassa
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           202   9e-58    
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                199   2e-57    Meconopsis simplicifolia
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              199   2e-57    Billardiera heterophylla
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                198   3e-57    Meconopsis delavayi
gb|AGY55961.1|  flavonoid 3'-hydroxylase                                194   4e-57    Punica granatum [granado]
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   198   5e-57    Callistephus chinensis [Chinese aster]
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                197   7e-57    Meconopsis horridula [prickly blue-poppy]
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              197   1e-56    Pericallis cruenta
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         197   2e-56    Eucalyptus grandis [rose gum]
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                196   2e-56    Meconopsis lancifolia
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                196   3e-56    Meconopsis punicea [red poppywort]
ref|XP_010522799.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    193   4e-56    
ref|XP_010522791.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    194   9e-56    Tarenaya hassleriana [spider flower]
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             194   2e-55    Pericallis cruenta
ref|XP_010522758.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    193   3e-55    Tarenaya hassleriana [spider flower]
ref|XP_010522775.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    193   3e-55    Tarenaya hassleriana [spider flower]
emb|CDP16533.1|  unnamed protein product                                191   1e-54    Coffea canephora [robusta coffee]
ref|XP_010522740.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    193   2e-54    Tarenaya hassleriana [spider flower]
ref|XP_010522750.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    192   2e-54    
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               190   2e-54    Glandularia x hybrida [garden verbena]
emb|CDP16353.1|  unnamed protein product                                180   5e-54    Coffea canephora [robusta coffee]
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               190   6e-54    Lilium hybrid division I
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               189   1e-53    Torenia hybrid cultivar
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               187   2e-53    Torenia hybrid cultivar
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               189   2e-53    Lilium hybrid division I
gb|AFK73718.1|  cytochrome P450                                         186   7e-53    Papaver somniferum
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                186   1e-52    Iris x hollandica [Dutch iris]
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              186   2e-52    Glycine soja [wild soybean]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  185   2e-52    
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         186   3e-52    Morus notabilis
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         185   5e-52    Eucalyptus grandis [rose gum]
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         185   6e-52    Glycine max [soybeans]
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         184   2e-51    
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    183   3e-51    Glycine max [soybeans]
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              182   5e-51    Glycine soja [wild soybean]
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         181   2e-50    Oryza brachyantha
gb|AFW72123.1|  red aleurone1                                           179   1e-49    
gb|AFP95893.1|  F3'H                                                    179   1e-49    Narcissus tazetta
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                178   1e-49    Allium cepa
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                178   2e-49    Tulipa fosteriana
gb|ADX95997.1|  flavonoid 3'-hydroxylase                                168   2e-49    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         177   4e-49    Setaria italica
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                177   4e-49    Anthurium andraeanum [flamingo-lily]
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              177   6e-49    
ref|NP_001064338.1|  Os10g0320100                                       177   8e-49    
dbj|BAB17054.1|  unnamed protein product                                166   1e-48    Arabidopsis thaliana [mouse-ear cress]
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              175   2e-48    Morus notabilis
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               175   2e-48    Tricyrtis hirta
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               174   4e-48    Lilium hybrid division I
gb|AGG40645.1|  flavanone 3'-hydroxylase                                174   6e-48    Narcissus tazetta
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          174   8e-48    Sorghum bicolor [broomcorn]
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              173   2e-47    Cucumis melo [Oriental melon]
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         171   6e-47    Zea mays [maize]
gb|AII26680.1|  flavonoid 3'-hydroxylase                                171   7e-47    Indosasa hispida
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     170   1e-46    Eucalyptus grandis [rose gum]
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     170   1e-46    Eucalyptus grandis [rose gum]
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                169   2e-46    Meconopsis racemosa
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                169   2e-46    Meconopsis betonicifolia [Himalayan blue-poppy]
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                170   2e-46    Sorghum bicolor [broomcorn]
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                169   2e-46    Meconopsis henrici
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                169   2e-46    Meconopsis zangnanensis
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                169   3e-46    Meconopsis pseudohorridula
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          169   3e-46    Sorghum bicolor [broomcorn]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                169   3e-46    Sorghum bicolor [broomcorn]
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                168   3e-46    Papaver nudicaule [Arctic poppy]
gb|AEF33624.1|  flavonoid 3' hydroxylase                                169   4e-46    Zea mays [maize]
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                167   7e-46    Meconopsis integrifolia [Farrer's lampshade-poppy]
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                167   7e-46    Papaver radicatum
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                167   8e-46    Meconopsis quintuplinervia
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         168   1e-45    Cucumis sativus [cucumbers]
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                167   1e-45    Meconopsis wilsonii
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                168   1e-45    Sorghum bicolor [broomcorn]
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          168   1e-45    
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                167   1e-45    Cucumis sativus [cucumbers]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          168   1e-45    Sorghum bicolor [broomcorn]
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            171   2e-45    
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   4e-45    Glycine max [soybeans]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              166   4e-45    Indosasa hispida
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   6e-45    Elaeis guineensis
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              166   7e-45    Glycine soja [wild soybean]
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                166   9e-45    Sorghum bicolor [broomcorn]
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         165   2e-44    
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                162   4e-44    Meconopsis gracilipes
dbj|BAJ95115.1|  predicted protein                                      164   6e-44    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146311.1|  uncharacterized protein LOC100279887               163   9e-44    Zea mays [maize]
gb|ACG38346.1|  flavonoid 3-monooxygenase                               163   9e-44    Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         163   9e-44    
dbj|BAJ98136.1|  predicted protein                                      163   1e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         162   1e-43    Phoenix dactylifera
ref|NP_001141292.1|  uncharacterized protein LOC100273383               159   7e-43    
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         159   2e-42    Brachypodium distachyon [annual false brome]
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                158   2e-42    Meconopsis paniculata
gb|EAY78004.1|  hypothetical protein OsI_33044                          159   2e-42    Oryza sativa Indica Group [Indian rice]
ref|NP_001064333.1|  Os10g0317900                                       159   2e-42    
gb|AAO47856.1|  flavonoid 3'-hydroxylase                                149   4e-42    Glycine max [soybeans]
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         157   1e-41    Brachypodium distachyon [annual false brome]
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         156   3e-41    Brachypodium distachyon [annual false brome]
gb|EMS47585.1|  Flavonoid 3'-monooxygenase                              151   1e-40    Triticum urartu
dbj|BAJ93256.1|  predicted protein                                      153   3e-40    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      149   3e-39    Diospyros kaki [Japanese persimmon]
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    147   1e-38    
gb|ABR16821.1|  unknown                                                 147   4e-38    Picea sitchensis
ref|XP_007155246.1|  hypothetical protein PHAVU_003G1855000g            139   5e-38    Phaseolus vulgaris [French bean]
gb|EMS66050.1|  Flavonoid 3'-monooxygenase                              142   3e-37    Triticum urartu
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         144   7e-37    
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              144   8e-37    Iris x hollandica [Dutch iris]
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              143   1e-36    
gb|ABV53919.1|  flavonoid 3'-hydroxylase                                132   9e-36    
gb|EEE50732.1|  hypothetical protein OsJ_31043                          140   2e-35    
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            137   1e-34    
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 137   1e-34    
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             137   2e-34    
ref|XP_003636773.1|  Flavonoid 3' 5'-hydroxylase                        132   2e-34    
gb|AFD04990.1|  flavonoid 3'5'-hydroxylase                              131   3e-34    
ref|XP_010247486.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      135   3e-34    
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      135   8e-34    
gb|ACN60403.1|  flavonoid-3',5'-hydroxylase                             134   9e-34    
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      134   1e-33    
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      134   2e-33    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            134   2e-33    
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            134   2e-33    
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    134   2e-33    
gb|AFD05017.1|  flavonoid 3'5'-hydroxylase                              129   2e-33    
gb|AFD05037.1|  flavonoid 3'5'-hydroxylase                              129   2e-33    
gb|AFD05065.1|  flavonoid 3'5'-hydroxylase                              129   2e-33    
gb|AFD05051.1|  flavonoid 3'5'-hydroxylase                              129   2e-33    
gb|AFD04986.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05019.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                134   3e-33    
gb|AFD05046.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05035.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04984.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04980.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04973.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04975.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05023.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05005.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05026.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05008.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05012.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04985.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05024.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04970.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05042.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04969.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD05011.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AFD04971.1|  flavonoid 3'5'-hydroxylase                              129   3e-33    
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             133   3e-33    
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             133   3e-33    
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             133   4e-33    
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         133   4e-33    
gb|AAV85472.1|  flavonoid 3',5'-hydroxylase                             130   4e-33    
gb|AFD05020.1|  flavonoid 3'5'-hydroxylase                              128   7e-33    
gb|AFD05057.1|  flavonoid 3'5'-hydroxylase                              128   7e-33    
gb|AFD05052.1|  flavonoid 3'5'-hydroxylase                              128   7e-33    
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             132   7e-33    
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   7e-33    
gb|AFD05064.1|  flavonoid 3'5'-hydroxylase                              128   7e-33    
gb|AFD05050.1|  flavonoid 3'5'-hydroxylase                              128   8e-33    
gb|AFD04978.1|  flavonoid 3'5'-hydroxylase                              128   8e-33    
gb|ADV39281.1|  flavonoid 3',5'-hydroxylase                             129   8e-33    
gb|ADV39279.1|  flavonoid 3',5'-hydroxylase                             129   8e-33    
gb|ADV39277.1|  flavonoid 3',5'-hydroxylase                             129   8e-33    
gb|AFD05010.1|  flavonoid 3'5'-hydroxylase                              128   8e-33    
gb|ADV39278.1|  flavonoid 3',5'-hydroxylase                             129   8e-33    
gb|ADV39275.1|  flavonoid 3',5'-hydroxylase                             129   8e-33    
gb|AGC30728.1|  flavonoid 3',5'-hydroxylase                             130   8e-33    
gb|AFD05032.1|  flavonoid 3'5'-hydroxylase                              128   8e-33    
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     132   9e-33    
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     132   9e-33    
gb|AFD04991.1|  flavonoid 3'5'-hydroxylase                              127   1e-32    
gb|ADV39282.1|  flavonoid 3',5'-hydroxylase                             129   1e-32    
gb|ADV39273.1|  flavonoid 3',5'-hydroxylase                             129   1e-32    
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             132   1e-32    
gb|AFD04994.1|  flavonoid 3'5'-hydroxylase                              127   1e-32    
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           132   1e-32    
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   1e-32    
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            132   1e-32    
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          131   2e-32    
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        131   2e-32    
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    131   2e-32    
gb|KEH33357.1|  flavonoid hydroxylase                                   131   2e-32    
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            131   2e-32    
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            131   2e-32    
gb|ADV39276.1|  flavonoid 3',5'-hydroxylase                             128   2e-32    
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            131   2e-32    
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            131   2e-32    
gb|AFD04977.1|  flavonoid 3'5'-hydroxylase                              126   3e-32    
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    130   3e-32    
dbj|BAF64483.1|  flavonoid-3',5'-hydroxylase                            129   3e-32    
gb|ADV39274.1|  flavonoid 3',5'-hydroxylase                             127   4e-32    
gb|AFD05049.1|  flavonoid 3'5'-hydroxylase                              126   4e-32    
gb|AFD05059.1|  flavonoid 3'5'-hydroxylase                              126   4e-32    
gb|KJB09328.1|  hypothetical protein B456_001G134900                    130   4e-32    
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             130   4e-32    
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             130   5e-32    
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            130   5e-32    
gb|AFD05054.1|  flavonoid 3'5'-hydroxylase                              125   5e-32    
gb|AGA82781.1|  flavonoid 3' hydroxylase 1                              127   5e-32    
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            130   5e-32    
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              130   6e-32    
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   130   6e-32    
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      129   7e-32    
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            129   8e-32    
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             129   8e-32    
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            129   9e-32    
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
dbj|BAF64482.1|  flavonoid-3',5'-hydroxylase                            128   1e-31    
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             129   1e-31    
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            129   1e-31    
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            129   1e-31    
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        129   2e-31    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    129   2e-31    
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             129   2e-31    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            129   2e-31    
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             129   2e-31    
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              128   2e-31    
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            128   2e-31    
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              128   2e-31    
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             128   2e-31    
gb|AFD05053.1|  flavonoid 3'5'-hydroxylase                              124   2e-31    
emb|CAA50442.1|  P450 hydroxylase                                       127   2e-31    
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             128   2e-31    
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             128   3e-31    
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           128   3e-31    
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             128   3e-31    
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    128   3e-31    
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            128   3e-31    
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            127   3e-31    
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    127   4e-31    
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            127   4e-31    
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             127   4e-31    
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            127   4e-31    
gb|ABY77007.1|  flavonoid 3',5'-hydroxylase                             127   4e-31    
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             127   4e-31    
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          127   4e-31    
gb|AJD25176.1|  cytochrome P450 CYP75A57                                127   4e-31    
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             127   5e-31    
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             127   5e-31    
dbj|BAK74845.1|  mutated flavonoid 3', 5' hydroxylase                   125   5e-31    
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            127   5e-31    
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            127   6e-31    
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             127   8e-31    
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             127   9e-31    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             126   1e-30    
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            126   1e-30    
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             126   1e-30    
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            125   2e-30    
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         125   3e-30    
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              125   3e-30    
gb|AEX12304.1|  hypothetical protein 0_8089_01                          119   3e-30    
gb|ABR18019.1|  unknown                                                 123   3e-30    
gb|ABQ96219.1|  flavonoid 3'5' hydroxylase                              124   5e-30    
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           124   5e-30    
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       124   6e-30    
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              124   6e-30    
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              124   6e-30    
gb|AEX12309.1|  hypothetical protein 0_8089_01                          118   6e-30    
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    124   6e-30    
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        124   6e-30    
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             124   6e-30    
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             124   6e-30    
sp|O04773.1|C75A6_CAMME  RecName: Full=Flavonoid 3',5'-hydroxylas...    124   7e-30    
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      124   7e-30    
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            124   9e-30    
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      124   1e-29    
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    123   1e-29    
ref|NP_001268164.1|  uncharacterized protein LOC100261319               123   1e-29    
emb|CAN82588.1|  hypothetical protein VITISV_038260                     123   1e-29    
dbj|BAF49320.1|  flavonoid 3',5'-hydroxylase                            124   1e-29    
dbj|BAF49322.1|  flavonoid 3',5'-hydroxylase                            124   1e-29    
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             123   1e-29    
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             123   1e-29    
dbj|BAF49319.1|  flavonoid 3',5'-hydroxylase                            123   2e-29    
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            123   2e-29    
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            123   2e-29    
ref|XP_007146175.1|  hypothetical protein PHAVU_006G018800g             122   2e-29    
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             122   2e-29    
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      122   3e-29    
emb|CAN81079.1|  hypothetical protein VITISV_007550                     122   3e-29    
emb|CAN61852.1|  hypothetical protein VITISV_020443                     122   3e-29    
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           122   3e-29    
ref|XP_010910221.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      122   3e-29    
emb|CAN82604.1|  hypothetical protein VITISV_005589                     122   3e-29    
ref|XP_007146174.1|  hypothetical protein PHAVU_006G018800g             122   4e-29    
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           122   4e-29    
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           122   4e-29    
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             122   4e-29    
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            121   4e-29    
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             122   4e-29    
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           122   4e-29    
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             122   4e-29    
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            122   5e-29    
gb|AEX12307.1|  hypothetical protein 0_8089_01                          115   5e-29    
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            122   5e-29    
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            121   6e-29    
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            121   6e-29    
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      121   9e-29    
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             121   9e-29    
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      121   1e-28    
emb|CAN60738.1|  hypothetical protein VITISV_042284                     119   1e-28    
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   120   1e-28    
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    120   1e-28    
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    120   1e-28    
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            120   2e-28    
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              120   2e-28    
gb|EAZ09260.1|  hypothetical protein OsI_31533                          120   2e-28    
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         120   3e-28    
gb|ABR16345.1|  unknown                                                 119   3e-28    
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         119   4e-28    
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           119   5e-28    
gb|AEX12305.1|  hypothetical protein 0_8089_01                          113   6e-28    
emb|CAN80142.1|  hypothetical protein VITISV_038979                     118   6e-28    



>gb|AAR00230.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=323

 Score =   314 bits (804),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 180/184 (98%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ERYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 180/184 (98%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 180/184 (98%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLI CTLVFAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLVFAICLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QSYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLI CTL+FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLI CTL+FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 2/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLI CT VFA+FLYFL LR+K RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A
Sbjct  1    MATLTLILCTSVFAVFLYFL-LRLK-RYPLPLPPGPKPWPVVGNLPHLGQKPHQSIAALA  58

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  59   QSYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPY  118

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATL RSLASAGKTPVKLGQLLNVCTTNA
Sbjct  119  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLARSLASAGKTPVKLGQLLNVCTTNA  178

Query  553  LARV  564
            L RV
Sbjct  179  LGRV  182



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 175/184 (95%), Gaps = 2/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLIFCT+VF IFLY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A
Sbjct  1    MATLTLIFCTIVFTIFLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALA  58

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  59   QSYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPY  118

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR LRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  119  GPRWRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNA  178

Query  553  LARV  564
            LARV
Sbjct  179  LARV  182



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 174/183 (95%), Gaps = 2/183 (1%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            ATLTLI CT+VF IFLYFL LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTIVFTIFLYFL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQ  60

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYG  120

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  555
            PRWR LRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  556  ARV  564
            ARV
Sbjct  181  ARV  183



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MATLTLI CTL+FAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAISLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   KKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKITSVHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 172/183 (94%), Gaps = 2/183 (1%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            ATLTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQ  60

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYG  120

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  555
            PRWRMLRKITSVHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  556  ARV  564
            ARV
Sbjct  181  ARV  183



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 172/183 (94%), Gaps = 2/183 (1%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            ATLTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQ  60

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYG  120

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  555
            PRWRMLRKITSVHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  556  ARV  564
            ARV
Sbjct  181  ARV  183



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 171/183 (93%), Gaps = 2/183 (1%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            ATLTLI CT V  I LY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KP+QS+AA+A+
Sbjct  3    ATLTLILCTSVITISLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPNQSLAALAQ  60

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYG  120

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  555
            PRWRMLRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  556  ARV  564
            ARV
Sbjct  181  ARV  183



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 168/187 (90%), Gaps = 3/187 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  183
            MA LTL   T +FAIFLYFL+ ++    +RYPL LPPGP PWPV+GNLPHLG KPHQ++A
Sbjct  1    MAILTLFLFTSIFAIFLYFLVCQLLISNKRYPLLLPPGPSPWPVVGNLPHLGPKPHQTLA  60

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
            A+A+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  61   ALAQNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVF  120

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  543
            APYGPRWRMLRKITSVHLFS+KALDDF HVRQEE+  LTR+LASAGKTPVKLGQLLNVCT
Sbjct  121  APYGPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGKTPVKLGQLLNVCT  180

Query  544  TNALARV  564
            TNAL+RV
Sbjct  181  TNALSRV  187



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 169/187 (90%), Gaps = 3/187 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  183
            MA LTL   T +FAIF+YFL+ ++    +RYPLPLPPGP PWPV+GNLPHLG KPHQ++A
Sbjct  1    MAILTLFLFTSIFAIFIYFLVCQLLISNKRYPLPLPPGPSPWPVVGNLPHLGPKPHQTLA  60

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
            A+A+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  61   ALAQNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVF  120

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  543
            APYGPRWRMLRKITSVHLFS+KALDDF HVRQEE+  LTR+LASAG+TPVKLGQLLNVCT
Sbjct  121  APYGPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGRTPVKLGQLLNVCT  180

Query  544  TNALARV  564
            TNAL+RV
Sbjct  181  TNALSRV  187



>gb|AGM46642.1| flavonoid 3'-hydroxylase protein, partial [Apium graveolens]
Length=153

 Score =   239 bits (610),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG KPH S+AA+A+ YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  6    GNLPHLGAKPHHSLAALAKNYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFSSRPPN  65

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDF HVRQEEV  LTR+LASA
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFRHVRQEEVGILTRALASA  125

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GKTPVKLGQLLNVCTTNALARV
Sbjct  126  GKTPVKLGQLLNVCTTNALARV  147



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 149/184 (81%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L LIFCT +F + LY  + R   R P  L P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCVLLYHFLTRRSVRLPPGLKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 3/186 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILR--VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  186
            M  L+LI  T++F+  L F ILR   ++RYPLPLPPGPKPWP++GNL HLG KPHQS AA
Sbjct  1    MEILSLILYTVIFSFLLQF-ILRSFFRKRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAA  59

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            MA+ YGPLM+L++GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGAEH+AYNYQDLVFA
Sbjct  60   MAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFA  119

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGPRWRMLRKI SVHLFS KALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTT
Sbjct  120  PYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTT  179

Query  547  NALARV  564
            NALARV
Sbjct  180  NALARV  185



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L LIFCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>dbj|BAE47003.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=334

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALSFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA  +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI  VHLFSAKALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICFVHLFSAKALDDFSHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            ALARV
Sbjct  181  ALARV  185



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  LTL+  T V  +FLY L+ R   R P  LPPGP PWPV+GNLPHLG  PH S+AAMA
Sbjct  1    MTPLTLLIGTCVTGLFLYVLLNRC-TRNPNRLPPGPTPWPVVGNLPHLGTIPHHSLAAMA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFADRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF HVRQEEVA L R+L  AGK+PVKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGKSPVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA  +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            ALA+V
Sbjct  181  ALAQV  185



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA  G+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALAREGQTPVKLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA  +LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            ALA+V
Sbjct  181  ALAQV  185



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 158/185 (85%), Gaps = 2/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+TLTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTN  549
            GPRWR+LRKI S+HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTN
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTN  179

Query  550  ALARV  564
            AL RV
Sbjct  180  ALGRV  184



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA  +LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            ALA+V
Sbjct  181  ALAQV  185



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M +L L+FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNSLALLFCTALFCVLLYRFLTRRSPRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLR+GFVDVVVAASA+VA+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI S+HLFS KALDDF H+RQEE++ LT +LA AG  PV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSIHLFSGKALDDFRHIRQEEISVLTSALARAGPAPVNLGQLLNVCTTNA  176

Query  553  LARV  564
            L RV
Sbjct  177  LGRV  180



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MA+L  I  +L+  IFLYF++  ++ RYP PLPPGPKPWPV+GNLPHLG  PH SIAA+A
Sbjct  1    MASLAFIIYSLLIGIFLYFVLSLLRNRYPRPLPPGPKPWPVIGNLPHLGTMPHHSIAALA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPLMHL +G V VVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   RTYGPLMHLWMGSVHVVVAASASVAXQFLKTHDQNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTT  546
            GPRWRMLRKI SVHLFSAKALDDF HVRQEEVA LTR+LASA   KT V LGQLLN+CTT
Sbjct  121  GPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALASAAKSKTTVNLGQLLNLCTT  180

Query  547  NALARV  564
            NA+ RV
Sbjct  181  NAIGRV  186



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA  +LI  T++ +  L+F++ L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+M
Sbjct  1    MAIFSLILYTIISSFILHFILSLFFRKRYPVPLPPGPKPWPIIGNIVQLGPKPHQSTASM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANAGQKPIKLGQLLNVCTTN  180

Query  550  ALARV  564
            ALARV
Sbjct  181  ALARV  185



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 4/187 (2%)
 Frame = +1

Query  4    DPSMATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  183
            D  +   T IF  L++AI    L L  ++     LPPGPKPWP++GNLPHLG KPHQ++A
Sbjct  6    DSPLVVYTAIFSLLIYAI----LKLLRRENRRPSLPPGPKPWPIIGNLPHLGTKPHQTLA  61

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
            AMA+ YGPLMHL+LGFVDVVVAASA+VA QFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  62   AMAKTYGPLMHLKLGFVDVVVAASASVAEQFLKKHDANFSNRPPNSGAKHIAYNYQDLVF  121

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  543
            APYGPRWR+LRKI SVHLFSAKALDDF HVRQEEV  LTRS+ASAG+ P+ LGQLL VCT
Sbjct  122  APYGPRWRLLRKICSVHLFSAKALDDFQHVRQEEVGILTRSIASAGENPINLGQLLGVCT  181

Query  544  TNALARV  564
            TNALARV
Sbjct  182  TNALARV  188



>gb|AJO67965.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=215

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  207
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  208  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  387
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  388  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            MLRKI+SVHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RV
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRV  181



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ LTL+    + A+ LY L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MSILTLLLYASITALPLYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            E+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPNSGAEHIAYNYQDLVFAPY
Sbjct  60   EKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPNSGAEHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR LA AG + VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGAGNSTVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYF-LILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA   LI  T++ +I L+F L L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+M
Sbjct  1    MAIFFLILYTIISSIILHFSLSLFFRKRYPVPLPPGPKPWPIIGNIIQLGPKPHQSTASM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFS KALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSTKALDDFRHVRQEEVRTLTRALANAGQNPIKLGQLLNVCTTN  180

Query  550  ALARV  564
            ALARV
Sbjct  181  ALARV  185



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 158/185 (85%), Gaps = 2/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L L+  + +  + +Y L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AAMA
Sbjct  1    MTILPLVLYSCITGLVIYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGVVPHHSLAAMA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP-  369
            E+YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NF++RPPNSGA+HIAYNYQDLVFAP 
Sbjct  60   EKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFS+KALDDF HVRQEEVA LTR+L  AG +PVKLGQLLNVCTTN
Sbjct  120  YGPRWRMLRKICSVHLFSSKALDDFRHVRQEEVAILTRALIGAGDSPVKLGQLLNVCTTN  179

Query  550  ALARV  564
            ALARV
Sbjct  180  ALARV  184



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA   +I CT++ +  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQS A M
Sbjct  1    MAIFFIILCTIIISFLLHTILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSTADM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            +LARV
Sbjct  181  SLARV  185



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 157/185 (85%), Gaps = 2/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+TLTLIF + + A FL + I +        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSIHKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTN  549
            GPRWR+LRKI S+HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTN
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTN  179

Query  550  ALARV  564
            AL RV
Sbjct  180  ALGRV  184



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +1

Query  19   TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  198
            ++TLI  TL+    L ++ L  K +   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  
Sbjct  4    SITLIASTLILGFLLLYIFLNRKAKAAAPLPPGPKPWPIVGNLPHLGPKPHQSMAALARV  63

Query  199  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  378
            +GPL+HL++GFV VVVAASA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGP
Sbjct  64   HGPLIHLKMGFVHVVVAASASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGP  123

Query  379  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  558
            RWRMLRKI ++HLFSAKAL DF HVRQEEV  LTR+LA AGKTPVKLGQ+LN C TNA+A
Sbjct  124  RWRMLRKICALHLFSAKALTDFTHVRQEEVGILTRALADAGKTPVKLGQMLNTCATNAIA  183

Query  559  RV  564
            RV
Sbjct  184  RV  185



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   232 bits (591),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  LTL+  T + A+  Y L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTILTLLLYTSISALAFY-LLLNLRTRHPKRLPPGPTPWPIVGNLPHLGTVPHHSLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   TKYGPLMHLRLGFVDVVVAASASVASQFLKSHDANFASRPPNSGAKHIAYNYHDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR L SAG+T VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRVLISAGETTVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LIF T+V A FLY L    + R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGRSRHGLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTTPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEH+AYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR+LA A
Sbjct  102  SGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALAGA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GK+PVKLGQLL+VCTTNALARV
Sbjct  162  GKSPVKLGQLLSVCTTNALARV  183



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA   +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA M
Sbjct  1    MAIFFIILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGP MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            +LARV
Sbjct  181  SLARV  185



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  LTL+  T + A+ LY L L +  R+P  LPPGP PWP++GNLPHLG  PH  +AA+A
Sbjct  1    MTILTLVLYTSIIALVLYVL-LNLFTRHPNRLPPGPTPWPIVGNLPHLGSIPHHGLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFS+KALDDF HVRQEEVA LTR L  A K+PVKLGQLLNVCTTNA
Sbjct  120  GPRWRLLRKICSVHLFSSKALDDFRHVRQEEVAILTRDLVGAKKSPVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LIF T+V A FLY L      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHALPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVSLGQLLNVCTVNALGRV  182



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA   +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA M
Sbjct  1    MAIFFIILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGP MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            +LARV
Sbjct  181  SLARV  185



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTVPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDD+ HVRQEEVA LTR+L  A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDYRHVRQEEVAILTRALVGA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GK PVKLGQLLNVCTTNALARV
Sbjct  162  GKAPVKLGQLLNVCTTNALARV  183



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTLLTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPSGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRV  182



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ L  +  T + A+ +++L+L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MSILISLLYTFITAL-VFYLLLNLRPRHSKRLPPGPSPWPIVGNLPHLGTIPHHSLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   KKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHIAYNYHDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR L  AG++ VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSTKALDDFRHIRQEEVAILTRVLVGAGESTVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ L L F T+  AIF+Y+LI  +  RYP PLPPGPKPWP++GNLPH+G  PHQ +A +A
Sbjct  1    MSPLELTFYTIALAIFIYYLITTIFSRYPGPLPPGPKPWPIVGNLPHMGPVPHQGLAKLA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL+HLRLG+V VVVAASA+VAA+FLK HD+NFS+RPPNSGA++IAYNYQDLVFAPY
Sbjct  61   QKYGPLLHLRLGYVHVVVAASASVAAEFLKAHDANFSSRPPNSGAKYIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTN  549
            GPRWRMLRKI+S+HLFSAKAL+D+  +RQEEVA LT++LA +G   P++LGQLLNVCTTN
Sbjct  121  GPRWRMLRKISSLHLFSAKALEDYKPIRQEEVAILTKALAKSGSNNPIQLGQLLNVCTTN  180

Query  550  ALAR  561
            AL+R
Sbjct  181  ALSR  184



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG KPHQS+AA+A  YGPLMHLR+GFVDVVVAASAAVA QFLKVHD+NFS+RPPN
Sbjct  39   GNLPHLGPKPHQSLAALARSYGPLMHLRMGFVDVVVAASAAVATQFLKVHDANFSSRPPN  98

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
             GA+++AYNYQDLVFAPYGPRWRMLRKI+SVHLFS KALDDF H+RQ+EV+ LTR+LASA
Sbjct  99   CGAKYVAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDFRHIRQQEVSVLTRALASA  158

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G TPV LGQLLNVCT NAL RV
Sbjct  159  GPTPVNLGQLLNVCTANALGRV  180



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH S+AA+AE+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR LA A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G + VKLGQLLNVCTTNALARV
Sbjct  162  GNSTVKLGQLLNVCTTNALARV  183



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFSAKALDDF HVRQE+VA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEKVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|AFI25037.1| flavonoid 3'-hydroxylase, partial [Populus deltoides x Populus 
tremuloides]
Length=201

 Score =   217 bits (553),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 152/173 (88%), Gaps = 3/173 (2%)
 Frame = +1

Query  55   IFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  228
            IF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ YGPLMHLR G
Sbjct  1    IFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPVPHHSMAALAKTYGPLMHLRFG  60

Query  229  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  408
            FVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+S
Sbjct  61   FVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISS  120

Query  409  VHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALARV  564
            VHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL RV
Sbjct  121  VHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALGRV  173



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 3/182 (2%)
 Frame = +1

Query  19   TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  198
            TLTLI  T +  +FLY  + R   R  + LPPGP+PWP++GNL  LG KPHQS+AA+A  
Sbjct  4    TLTLIVYTSILCLFLYSFLRR---RRSVRLPPGPRPWPIVGNLLQLGPKPHQSMAALARV  60

Query  199  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  378
            YGPLMHL++GFV+VVVAASA VA QFLKVHD+NFSNRPPN+GAE++AYNYQD+VFAPYGP
Sbjct  61   YGPLMHLKMGFVNVVVAASAGVAEQFLKVHDANFSNRPPNAGAEYVAYNYQDMVFAPYGP  120

Query  379  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  558
            RWR+LRKI +VH+FSAKALDDF HVRQEEV  LTR+LASAG+TP +LGQ+LNVC TNA+A
Sbjct  121  RWRLLRKICAVHVFSAKALDDFRHVRQEEVGILTRALASAGQTPARLGQMLNVCATNAIA  180

Query  559  RV  564
            RV
Sbjct  181  RV  182



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +  TL  A  +YFL   +  RYP PLPPGPKPWP++GNLPHLG  PH S+AAMA
Sbjct  1    MTLLAFVSFTLFVAFLIYFL-FNLLNRYPRPLPPGPKPWPIIGNLPHLGTVPHHSLAAMA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPL+HLRLG V VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   RTYGPLLHLRLGSVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA L R+LA AGK  V +GQLL+VCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLIRALAGAGKAAVNVGQLLSVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            R+LRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRV  182



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            R+LRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRV  182



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIA  183
            M +L  +  +L+ A+FLY L+ LR     R+P PLPPGP PWPV+GNLPHLG  PH SIA
Sbjct  1    MTSLAFVLYSLLIAVFLYCLLNLRTLLFNRHPRPLPPGPTPWPVIGNLPHLGTMPHHSIA  60

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
             MA  YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF
Sbjct  61   TMARTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVF  120

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-TPVKLGQLLNVC  540
            APYGPRWRMLRKI SVHLFS KALDDF HVRQEE+A LTR+L SAG+   V LGQLLNVC
Sbjct  121  APYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALESAGQAAAVNLGQLLNVC  180

Query  541  TTNALARV  564
            TTNAL RV
Sbjct  181  TTNALGRV  188



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ L L F T+V A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A
Sbjct  1    MSPLELTFYTIVLATILYYLITTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   QKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GP+WRMLRKI S+H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQLLNVCTTNA
Sbjct  121  GPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLNVCTTNA  180

Query  553  LARV  564
            L+RV
Sbjct  181  LSRV  184



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ + LI  TLV    +Y +I ++  R PLPLPPGPKPWP++GNLPHLG  PH S+A++A
Sbjct  1    MSPIELILSTLVIGTIVYTIISKLINRTPLPLPPGPKPWPIVGNLPHLGPVPHHSLASLA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             +YGPLMHLRLG V+V+VAAS++VA Q  K HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   SKYGPLMHLRLGSVNVIVAASSSVAVQIFKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GP+WRMLRKI SVHLFSAKALDDF H+RQEEV  LT+ L  AGK PV L +LLNVCTTNA
Sbjct  121  GPKWRMLRKICSVHLFSAKALDDFRHIRQEEVMVLTKVLLGAGKAPVDLAKLLNVCTTNA  180

Query  553  LARV  564
            L RV
Sbjct  181  LGRV  184



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MA LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MAILTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   VKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  207
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  208  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  387
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  388  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            MLRKI+SVHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RV
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRV  181



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  207
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  208  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  387
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  388  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            MLRKI+SVHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RV
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRV  181



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  207
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  9    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  67

Query  208  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  387
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  68   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  127

Query  388  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            MLRKI+SVHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RV
Sbjct  128  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRV  186



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 3/182 (2%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            LI  + + AIF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALLAIFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALA  558
            WRMLRKI+SVHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  559  RV  564
            RV
Sbjct  184  RV  185



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRV  181



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MSILTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   VKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RMLRKI+SVHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRV  181



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 157/182 (86%), Gaps = 3/182 (2%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            LI  + + A+F+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALVAVFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALA  558
            WRMLRKI+SVHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  559  RV  564
            RV
Sbjct  184  RV  185



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            MA  +LI  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQSIAAM
Sbjct  1    MAIFSLILYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSIAAM  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A  YGPLMHL++GFVDVVVAASA+VAAQFLK HD+NFS+RP NS  +H+AYN QDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVAASASVAAQFLKTHDANFSSRPQNSCTKHLAYNSQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI SVHLFSAK LDDF HVRQ EV  LTR+LASAG+ PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKPLDDFRHVRQNEVRILTRALASAGQKPVKLGQLLNVCTTN  180

Query  550  ALARV  564
            AL +V
Sbjct  181  ALTQV  185



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 151/188 (80%), Gaps = 7/188 (4%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLI-------LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  180
            ++LIF T + A  LY L+       L        PLPPGPKPWP++GNLPHLG  PHQ++
Sbjct  1    MSLIFYTCIIAFLLYVLLSTLRTFLLNRNPASRKPLPPGPKPWPIVGNLPHLGTMPHQTM  60

Query  181  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  360
            AA+A  YGPLMHLRLG VDVVVAAS AVA QFLKVHD+NF NRPPNSGA HIAYNYQDLV
Sbjct  61   AALARTYGPLMHLRLGSVDVVVAASGAVAEQFLKVHDANFLNRPPNSGAVHIAYNYQDLV  120

Query  361  FAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVC  540
            FAPYGPRWR+LRK+++VHLFSAKALDDF HVRQEEVA LTR LASAG  PV L QLL+VC
Sbjct  121  FAPYGPRWRLLRKVSAVHLFSAKALDDFRHVRQEEVAVLTRDLASAGNAPVHLNQLLSVC  180

Query  541  TTNALARV  564
            TTNAL+RV
Sbjct  181  TTNALSRV  188



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  207
            LIF T+VFA FLY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLFS-GNRHFLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  208  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  387
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  388  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            MLRKI+SVHLFS KALDD  HVRQEE+A L   LA AG   V L QLLNVCT NAL RV
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEIAVLAHGLAGAGSKTVNLAQLLNVCTVNALGRV  181



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L+LI    +  +  Y L+  ++ R    LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MTLLSLIIYLCITGVTAYVLV-NLRTRRANRLPPGPTPWPIVGNLPHLGTIPHHSLADLA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ VKLGQLL+VCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVGAGKSTVKLGQLLHVCTTNA  179

Query  553  LARV  564
            L RV
Sbjct  180  LVRV  183



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH S+AA+A++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGMIPHHSLAALAQKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVR+EEVA LTR L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLVHA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G++ VKLGQLLNVCTTNALARV
Sbjct  162  GESAVKLGQLLNVCTTNALARV  183



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MA L+LI  T+  + FLY L L    R   PLPPGP+PWP++GNLPHLG  PH SIAA+A
Sbjct  1    MALLSLILATVAISAFLYSL-LGYLSRPARPLPPGPRPWPLVGNLPHLGPVPHHSIAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPLMHLRLGFVDVVVAASA+VAA+FLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   RTYGPLMHLRLGFVDVVVAASASVAAEFLKTHDTNFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI+SVHLFS KAL+D+ HVRQEEVA LT +LA AG  P  L QLLNVCT NA
Sbjct  120  GPRWRMLRKISSVHLFSGKALEDYRHVRQEEVAILTSALARAGSAPANLAQLLNVCTVNA  179

Query  553  LARV  564
            L RV
Sbjct  180  LGRV  183



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL HLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAP 
Sbjct  60   KKYGPLTHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPC  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L L+  T  F  FL +  L    RYP PLPPGPKPWP++GNLPHLG  PH +IAA+A
Sbjct  1    MTPLALVALT-SFVAFLIYFFLNFSNRYPRPLPPGPKPWPIIGNLPHLGPVPHHTIAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPL+HLRLG V VVVAASA+VA+QFLK HD+NFS+RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   RVYGPLLHLRLGSVHVVVAASASVASQFLKTHDANFSSRPPNSGAKHIAYNYHDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI SVHLFS KALDDF HVRQEEVA LTR+L+ +G +P+ +GQLLNVCTTNA
Sbjct  120  GPRWRLLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALSRSGTSPLNVGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 153/186 (82%), Gaps = 3/186 (2%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplpl---ppgpkpwpvlGNLPHLGKKPHQSIAA  186
            A +TL+ CT +    L + I +  QR        PPGP+PWP++GNLP LG KPHQ++AA
Sbjct  3    AAITLLICTSILGFLLLYWIFQRPQRKAKSTLPLPPGPRPWPIIGNLPQLGPKPHQTMAA  62

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            +A  +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFA
Sbjct  63   LARVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFA  122

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGPRWR+LRKI ++HLFSAKALDDF HVRQEEV  LTR+LASAG+  +KLGQ+LN+C T
Sbjct  123  PYGPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMKLGQMLNICAT  182

Query  547  NALARV  564
            NALARV
Sbjct  183  NALARV  188



>gb|KDO54631.1| hypothetical protein CISIN_1g020877mg [Citrus sinensis]
Length=320

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A LTR+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  166

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G  PV L Q LN+C  NAL RV
Sbjct  167  GTEPVNLAQRLNLCVVNALGRV  188



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG+ PH S+A +A +YGPL+HLRLGFVDVVVA SA+VAAQFLKVHD+NF++RPPN
Sbjct  44   GNLPHLGRVPHHSLADLATKYGPLLHLRLGFVDVVVAGSASVAAQFLKVHDANFASRPPN  103

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+H+AYNYQD+VFAPYGP+WRMLRKI SVHLFS KALDDF HVRQEEVA L R+L  A
Sbjct  104  SGAKHMAYNYQDMVFAPYGPKWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGA  163

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G++ VKLGQLLNVCTTNALARV
Sbjct  164  GESTVKLGQLLNVCTTNALARV  185



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T +F T++ A F++ L+L    R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFITILLATFIFLLVLLFSLRRNHRLPPGPNPWPIIGNLPHMGHKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP+++LRLGF DVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILYLRLGFADVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R L+ AG  PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELSRAGTKPVNLGQLVNMCVINALGR  180



>gb|AEF30421.1| flavonoid 3'-hydroxylase, partial [Fagopyrum tataricum]
Length=277

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LTR+L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTRALSKA  125

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GK  V+LGQLLNVCTTNAL RV
Sbjct  126  GKNAVQLGQLLNVCTTNALGRV  147



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEVAT+TR LA  G   V LGQL+N+C  NAL+R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVATMTRELAQVGTKAVNLGQLVNMCVVNALSR  180



>gb|KDO37751.1| hypothetical protein CISIN_1g042286mg, partial [Citrus sinensis]
Length=303

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G  PV L Q LN+C  NAL RV
Sbjct  167  GTEPVNLAQRLNLCVVNALGRV  188



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTLLTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RP +SG +H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPLSSGGKHMAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI SVHLF AK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFPAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH SIAA+A  YGPLMHL +G V VVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  7    GNLPHLGTMPHHSIAALAREYGPLMHLWMGSVHVVVAASASVAAQFLKTHDANFSSRPPN  66

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSAKALDDF HVRQEEVA LTR+LA+A
Sbjct  67   SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALANA  126

Query  499  GK-TPVKLGQLLNVCTTNALARV  564
            GK T V LGQLLN+CTTNA+ARV
Sbjct  127  GKSTTVNLGQLLNLCTTNAIARV  149



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 155/187 (83%), Gaps = 4/187 (2%)
 Frame = +1

Query  4    DPSMATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  183
            D S+ +L L+ CT +    L +  L    R   PLPPGPKPWP++GNLPHLG KPHQS+A
Sbjct  13   DISITSL-LVPCTFILGFLLLYSFL---NRKVKPLPPGPKPWPIVGNLPHLGPKPHQSMA  68

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
            A+A  +GPL+HL++GFV VVVA+SA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVF
Sbjct  69   ALARVHGPLIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVF  128

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  543
            APYGPRWRMLRKI ++HLFSAKAL+DF HVRQ+EV  LTR LA AG+TP+KLGQ++N C 
Sbjct  129  APYGPRWRMLRKICALHLFSAKALNDFTHVRQDEVGILTRVLADAGETPLKLGQMMNTCA  188

Query  544  TNALARV  564
            TNA+ARV
Sbjct  189  TNAIARV  195



>gb|KJB51033.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=422

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            R+LRKI+S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLVRELARANTKPVNLGQLVNMCVLNALGR  180



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  10   SMATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
             M++LTL+ C+ V    L + IL   +R P  LPPGP+PWP++GNLP LG KPHQS+AA+
Sbjct  2    QMSSLTLLVCSAVLGFLLLYSIL--VRRRPEKLPPGPRPWPIVGNLPQLGPKPHQSMAAL  59

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A+ YGPLMHL++GFV VVVAASAAVA QFLK HD+NFS+RPPN+GA+++AYNYQDLVFAP
Sbjct  60   AQVYGPLMHLKMGFVHVVVAASAAVAQQFLKAHDANFSSRPPNAGAKYVAYNYQDLVFAP  119

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWR+LRKI ++HLFSAKALDDF HVRQEE   L  +LASAG+ PV+LGQ+LNVC TN
Sbjct  120  YGPRWRLLRKICALHLFSAKALDDFRHVRQEEAGILCGALASAGQMPVRLGQMLNVCATN  179

Query  550  ALARV  564
            A++RV
Sbjct  180  AISRV  184



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG+ PH ++AAMA +YGPLMHLRLG VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  42   GNLPHLGRIPHHALAAMATKYGPLMHLRLGVVDVVVAASASVAAQFLKVHDANFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAY+YQDLVFAPYGP+WRMLRKI SVHLFS KALDDF HVR+EEVA L R+LA A
Sbjct  102  SGAKHIAYDYQDLVFAPYGPKWRMLRKICSVHLFSNKALDDFRHVREEEVAILARALAGA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G++ V LGQLLNVCTTNALARV
Sbjct  162  GRSTVALGQLLNVCTTNALARV  183



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 3/186 (2%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIAA  186
            A +TL+ CT +    L + I +  QR      P P       ++GNLP LG KPHQ++AA
Sbjct  3    AAITLLICTSILGFLLLYWIFQRPQRKAKLTLPLPPGPRPWPIIGNLPQLGPKPHQTMAA  62

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            +A  +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFA
Sbjct  63   LARVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFA  122

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGPRWR+LRKI ++HLFSAKALDDF HVRQEEV  LTR+LASAG+  + LGQ+LN+C T
Sbjct  123  PYGPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMILGQMLNICAT  182

Query  547  NALARV  564
            NALARV
Sbjct  183  NALARV  188



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRTLTAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKALDDF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALDDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGR  180



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ L L F T+  A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A
Sbjct  1    MSPLELTFYTIALATILYYLIPTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   QKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ-LLNVCTTN  549
            GP+WRMLRKI S+H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQ LLNVCTTN
Sbjct  121  GPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLLNVCTTN  180

Query  550  ALARV  564
            AL+RV
Sbjct  181  ALSRV  185



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            LT++  T++F   L    LR  + + + LPPGP PWP++GNLPH+G KPH+++AAM   Y
Sbjct  6    LTILLATVIFLFLLRVFSLRRNRSHNIRLPPGPNPWPIIGNLPHMGPKPHRTLAAMVSTY  65

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  66   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  125

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WR+LRKI+SVHLFSAKAL+DF HVRQEEV TLTR LA  G  PV LGQL+N+C  NAL R
Sbjct  126  WRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELARVGTKPVNLGQLVNMCVVNALGR  185



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            + +  +++  +FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSTVFLYFVFIISRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            R+LRKI+SVHLFS KALDDF H+R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSVHLFSGKALDDFRHIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH S+A +A +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLARLAAKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G++ VKLGQLLNVCTTNALARV
Sbjct  162  GESTVKLGQLLNVCTTNALARV  183



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  186
            M  +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A+
Sbjct  1    MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            +A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFA
Sbjct  61   LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA LT +LASA  + V LGQLLNVCTT
Sbjct  121  PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLLNVCTT  180

Query  547  NALARV  564
            NALARV
Sbjct  181  NALARV  186



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  186
            M  +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A+
Sbjct  1    MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            +A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFA
Sbjct  61   LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA LT +LASA  + V LGQLLNVCTT
Sbjct  121  PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLLNVCTT  180

Query  547  NALARV  564
            NALARV
Sbjct  181  NALARV  186



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            R+LRKI+S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PHQS+A +A +YGPLM+LRLGFVDVVVAASA+VAAQFLKVHD NF++RP +
Sbjct  42   GNLPHLGASPHQSLATLAAKYGPLMYLRLGFVDVVVAASASVAAQFLKVHDLNFASRPLS  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SG ++IAYNYQD+VFAPYGPRWRMLRKI SVH+FSAKA+D F HVRQEEVA LTR+L SA
Sbjct  102  SGGKYIAYNYQDMVFAPYGPRWRMLRKICSVHMFSAKAMDGFRHVRQEEVAILTRTLVSA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GK+PVKLGQ+LNVCTTNALARV
Sbjct  162  GKSPVKLGQILNVCTTNALARV  183



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLGK PH ++AAMA++YGPLMHLR G VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  43   GNLPHLGKMPHHALAAMADKYGPLMHLRFGVVDVVVAASASVAAQFLKVHDANFASRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+H+AY+YQDLVFAPYG +WRMLRKI SVHLFS KALDDF HVR+EEVA LTR+LA A
Sbjct  103  SGAKHLAYDYQDLVFAPYGLKWRMLRKICSVHLFSNKALDDFRHVREEEVAVLTRALAGA  162

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G + V LGQLLNVCTTNALARV
Sbjct  163  GGSTVALGQLLNVCTTNALARV  184



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPHQS+A +A+ +GPLMHL++G V VVVAASA VA QFLKVHD+NFS+RPPN
Sbjct  65   GNLPQLGPKPHQSMATLAQVHGPLMHLKMGVVHVVVAASAGVAEQFLKVHDANFSSRPPN  124

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+++AYNYQDLVFAPYGPRWRMLRKI ++HLFS KALDDF HVRQEEV  LTRSLASA
Sbjct  125  SGAKYMAYNYQDLVFAPYGPRWRMLRKICTLHLFSTKALDDFRHVRQEEVGILTRSLASA  184

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GKT   +GQ+LNVCTTNA+ARV
Sbjct  185  GKTAASIGQMLNVCTTNAIARV  206



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 154/189 (81%), Gaps = 4/189 (2%)
 Frame = +1

Query  10   SMATLTL-IFCTLVFAI---FLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQS  177
            +M+TL L I  T + AI   FL+ L+   ++     LPPGPKPWP++GNLPHLG  PHQS
Sbjct  22   AMSTLPLLILYTSLLAIVISFLFSLLRNRRRHSSHRLPPGPKPWPIVGNLPHLGPMPHQS  81

Query  178  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  357
            IA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPNSGA+HIAYNYQD+
Sbjct  82   IAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPNSGAKHIAYNYQDI  141

Query  358  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  537
            VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A LTR+LASAG  PV L Q LN+
Sbjct  142  VFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAQRLNL  201

Query  538  CTTNALARV  564
            C  NAL RV
Sbjct  202  CVVNALGRV  210



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
             LI  T+VFA FLY +      R+ LPLPPGPKPWP+ GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGWSRHSLPLPPGPKPWPIXGNLPHLGPVPHHSLAALARQYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVA SA+VA+QF K  D NFS+RPPNSGA+H+AYNYQ LVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAXSASVASQFXKTXDXNFSSRPPNSGAKHLAYNYQXLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            RM RKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RMXRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRV  182



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  31   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  210
            I  +++ AI +Y LI          LPPGP+P P++GNLPHLG  PHQSIA++ ++YGPL
Sbjct  5    ILYSILIAILVYVLIKLGSLSSGRRLPPGPRPLPLVGNLPHLGSMPHQSIASLVKKYGPL  64

Query  211  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  390
            M+LRLG+VDVVVAASA+VAAQ  K HD+NFS+RPPNSGA+++AYNY DLVFAPYGPRWRM
Sbjct  65   MYLRLGYVDVVVAASASVAAQIFKNHDANFSSRPPNSGAKYVAYNYHDLVFAPYGPRWRM  124

Query  391  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            LRKI+SVHLFS KALDDF H+R+ E+A LT++LASAGK PV LGQLLNVCTTNAL RV
Sbjct  125  LRKISSVHLFSNKALDDFRHIREAELAVLTQTLASAGKAPVNLGQLLNVCTTNALGRV  182



>gb|EPS57881.1| flavonoid 3'-hydroxylase, partial [Genlisea aurea]
Length=425

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  52   AIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGF  231
            A+FL+     +++R     PPGP PWP+LGN+P LG KPHQS+AA+A  YGPL+HL++GF
Sbjct  10   ALFLFLAYAFIRRRATKRFPPGPTPWPLLGNIPQLGVKPHQSMAALAGVYGPLLHLKMGF  69

Query  232  vdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSV  411
              VVVAASA+VA QFLKVHD+NFS+RPPN+G +++AYNYQDLVFAPYGPRWR+LRKI ++
Sbjct  70   QHVVVAASASVAEQFLKVHDANFSSRPPNAGGKYVAYNYQDLVFAPYGPRWRLLRKICAL  129

Query  412  HLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            HLFSAKALDDF HVRQEEV  L R L SAGK PV LGQ+LNVC TNA+ARV
Sbjct  130  HLFSAKALDDFVHVRQEEVGILGRVLVSAGKNPVALGQVLNVCATNAIARV  180



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            R+LRK++S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 2/182 (1%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRY--plplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  198
            T +F   V  IF++  ++  K+ +   LPLPPGP+PWP+LGN+PHLG KPHQ++A MA+ 
Sbjct  12   TAVFGLFVVFIFIFLKLVSRKKGHGRSLPLPPGPRPWPILGNIPHLGSKPHQTLAEMAKT  71

Query  199  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  378
            YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFAPYGP
Sbjct  72   YGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFAPYGP  131

Query  379  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  558
            RWR+LRKI SVHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTTNALA
Sbjct  132  RWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTTNALA  191

Query  559  RV  564
            RV
Sbjct  192  RV  193



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +1

Query  31   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  210
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRALTAMVTTYGPI  63

Query  211  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  390
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  391  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            LRKI+SVHLFSAKAL+DF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGR  180



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = +1

Query  31   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  210
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP +GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPSIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  211  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  390
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  391  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            LRK++S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  125  LRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ L ++F T+  AI +Y L L +  +  LPLPPGP PWP++GNLPH+G  PH ++A +A
Sbjct  1    MSPLIIVFATIAAAILIYRL-LNLITKPSLPLPPGPSPWPIVGNLPHMGPVPHHALAVLA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             ++GPLMHLRLG+VDV+VAASA+VA QFLKVHD+NFS+RP NSGA+++AYNYQDLVFAPY
Sbjct  60   LKHGPLMHLRLGYVDVIVAASASVAEQFLKVHDTNFSSRPTNSGAKYLAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI+ VH+FS+KALD+F H+RQEEVA L R+LAS+G   V LGQ+LNVCTTNA
Sbjct  120  GPRWRLLRKISYVHMFSSKALDEFRHIRQEEVARLIRNLASSGSKAVNLGQMLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G  PV L Q LN+C  NAL RV
Sbjct  167  GTEPVNLAQRLNLCVVNALGRV  188



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MA++T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A
Sbjct  1    MASITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             ++GPLMHLRLG VDVVVAASA++AAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PY
Sbjct  60   RKHGPLMHLRLGQVDVVVAASASMAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            G RWR+LRKITSVHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NA
Sbjct  120  GQRWRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNA  179

Query  553  LAR  561
            L R
Sbjct  180  LGR  182



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 151/188 (80%), Gaps = 4/188 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIA  183
            M +L  +  +L+   FLY L+ LR     R+P PLPPGPKPWPV+GNLPHLG  PH SIA
Sbjct  1    MTSLAFVLYSLLIGFFLYCLLNLRTLLFNRHPRPLPPGPKPWPVIGNLPHLGTMPHHSIA  60

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
            AMA  YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF
Sbjct  61   AMARTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVF  120

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTR-SLASAGKTPVKLGQLLNVC  540
            APYGPRWRMLRKI SVHLFS KALDDF HVRQEE+A LTR   ++     V LGQLLNVC
Sbjct  121  APYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALASAGQAAAVNLGQLLNVC  180

Query  541  TTNALARV  564
            TTNAL RV
Sbjct  181  TTNALGRV  188



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MA++T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A
Sbjct  1    MASITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             ++GPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PY
Sbjct  60   RKHGPLMHLRLGQVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            G RWR+LRKITSVHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NA
Sbjct  120  GQRWRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNA  179

Query  553  LAR  561
            L R
Sbjct  180  LGR  182



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   ++F T+V AI +  L+  +K +  LPLPPGP PWP++GNLPH+G  PH ++AA+A
Sbjct  1    MSLWIIVFVTIVAAILINRLLNLIK-KPTLPLPPGPSPWPIVGNLPHMGPVPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             ++GPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPNSGA++IAYNYQDLVFAPY
Sbjct  60   LKHGPLMHLQLGFVDVIVAASASVAEQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI+ VH+FS+KALDDF H+RQ+EVA L R+L+++G     LGQ+LNVCTTNA
Sbjct  120  GPRWRLLRKISYVHMFSSKALDDFRHIRQDEVARLIRNLSNSGSKAANLGQMLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG KPHQSIA +A  YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RP N
Sbjct  51   GNLPHLGTKPHQSIAELARTYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPQN  110

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS KALDDF HVRQEEVA LTR++ + 
Sbjct  111  SGAKYIAYNYQDLVFAPYGPRWRMLRKISQVHLFSNKALDDFRHVRQEEVAVLTRAIVNE  170

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G   V L +LLNVCTTNALARV
Sbjct  171  GDASVDLPRLLNVCTTNALARV  192



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 154/182 (85%), Gaps = 3/182 (2%)
 Frame = +1

Query  25   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            ++ F T+  AI +Y  I++   R  LPLPPGPKPWP++GNLPHLG  PH +IAA+A+ +G
Sbjct  6    SIAFATIALAILIY-RIVKFVTRPSLPLPPGPKPWPIIGNLPHLGPVPHHAIAALAKVHG  64

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            PLMHLRLG VDVVVAASA VA QFLKVHD+NFS+RPPN+GA++IAYNYQDLVFAPYGPRW
Sbjct  65   PLMHLRLGMVDVVVAASAKVAEQFLKVHDANFSSRPPNAGAKYIAYNYQDLVFAPYGPRW  124

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP--VKLGQLLNVCTTNALA  558
            RMLRKI+S+HLFSAKALDDF H+RQ EVA LT+++AS+  T   V LGQLLNVCTTNALA
Sbjct  125  RMLRKISSLHLFSAKALDDFKHLRQGEVARLTKNIASSTDTSKAVNLGQLLNVCTTNALA  184

Query  559  RV  564
            RV
Sbjct  185  RV  186



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 140/186 (75%), Gaps = 7/186 (4%)
 Frame = +1

Query  28   LIFCTLVFAIFLYFLIL-------RVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  186
            LI  TLV A+ +Y L+        R       P P GPKPWP++GNLPHLG  PH S+A 
Sbjct  8    LILYTLVLALLIYCLLNLRTLFFNRRSSHPLPPGPKGPKPWPIIGNLPHLGAIPHHSLAE  67

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            MA+ YGPL+HLRLG V VVVA+SA VAAQFLK HD+ FSNRPPNSGA+HIAYNYQDLVFA
Sbjct  68   MAQTYGPLLHLRLGLVHVVVASSAGVAAQFLKTHDAKFSNRPPNSGAKHIAYNYQDLVFA  127

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGP+WR LRKI SVHLFSAKALDDF HVRQEEV  L   LA AGK  V LGQLLN+C T
Sbjct  128  PYGPKWRKLRKICSVHLFSAKALDDFRHVRQEEVGVLVSGLAGAGKRAVHLGQLLNICAT  187

Query  547  NALARV  564
            NAL RV
Sbjct  188  NALGRV  193



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH++IAA+A  YGPLMHLRLG V+VVVAASA+VAAQFLK HDSNFS+RPPN
Sbjct  40   GNLPHLGPAPHRNIAALARTYGPLMHLRLGSVNVVVAASASVAAQFLKTHDSNFSSRPPN  99

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFS KALDD  +VRQEEVA LTR+LASA
Sbjct  100  SGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDGRYVRQEEVALLTRTLASA  159

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G   V L QLLN+C  NAL RV
Sbjct  160  GDAAVNLAQLLNICAANALGRV  181



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            A ++LI CT +  + +YFL LR        PLPPGP+PWP++GNLP LG KPHQS+AA+A
Sbjct  4    AAVSLIICTSILGVLVYFLFLRRGGGSNGRPLPPGPRPWPIVGNLPQLGPKPHQSMAALA  63

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              +GPLMHL++GFV VVVAASA VA +FLKVHD+NF +RPPNSGAEHIAYNY DLVFAP+
Sbjct  64   RVHGPLMHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRPPNSGAEHIAYNYNDLVFAPH  123

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI ++HLFS+KALDDF HVR+EEV  L R+LAS G+ P  +GQ++ VC TNA
Sbjct  124  GPRWRLLRKICALHLFSSKALDDFRHVREEEVGILIRNLASVGEMPASIGQMMYVCATNA  183

Query  553  LARV  564
            ++RV
Sbjct  184  ISRV  187



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFL-ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            M  LTL+  T +  +  Y L +L ++  +P  LPPGP PWP++GNLPH+G  PHQS+AA+
Sbjct  1    MTILTLLLYTCITGLVFYVLQLLNLRTPHPNRLPPGPTPWPIVGNLPHIGTAPHQSLAAL  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A +YGPLMHLRLGFVDVVVA SA+VAAQ  K HD NFSNRP  SG +HIAYNYQDLVFAP
Sbjct  61   ATKYGPLMHLRLGFVDVVVAGSASVAAQIFKAHDVNFSNRPRVSGGKHIAYNYQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGP+WRMLRKI SVHLFS KALDDF HVRQEE A L  +LA AG++ VKLG+L+NVC TN
Sbjct  121  YGPKWRMLRKICSVHLFSTKALDDFRHVRQEEAAILAGTLAGAGESTVKLGELVNVCITN  180

Query  550  ALARV  564
            ALARV
Sbjct  181  ALARV  185



>gb|AAO47850.1| defective flavonoid 3'-hydroxylase [Glycine max]
Length=298

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQLLNVCTTNALAR
Sbjct  162  DTKAVNLGQLLNVCTTNALAR  182



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 150/188 (80%), Gaps = 9/188 (5%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQS  177
            MATL   F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++
Sbjct  1    MATL---FLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRT  56

Query  178  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  357
            ++AM   YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDL
Sbjct  57   LSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDL  116

Query  358  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  537
            VFAPYG RWR+LRKI+SVHLFSAKAL+DF HVRQEEV TLTR L   G  PV LGQL+N+
Sbjct  117  VFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNM  176

Query  538  CTTNALAR  561
            C  NAL R
Sbjct  177  CVVNALGR  184



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+     F T+  AI +Y  I ++  R  +PLPPGP+PWP++GNLPH+G  PH ++AA+A
Sbjct  1    MSNWISAFATIAAAILIY-RIFKLITRPSIPLPPGPRPWPIVGNLPHMGPVPHHALAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
             ++GPLMHLRLGFVDV+VAASA VA QFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPY
Sbjct  60   HKHGPLMHLRLGFVDVIVAASATVAEQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRKI  VH+FS KALDD  H+RQEEV  L R+LAS+G   V L Q+LNVCTTNA
Sbjct  120  GPRWRLLRKIAYVHMFSTKALDDVRHLRQEEVGRLIRNLASSGSKAVNLSQMLNVCTTNA  179

Query  553  LARV  564
            LARV
Sbjct  180  LARV  183



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G KPHQ++AAM   YGP++HLRLGFV+VVVAAS +VA QFLK+HD+NF++RPPN
Sbjct  43   GNLPHMGPKPHQTLAAMVTTYGPILHLRLGFVNVVVAASKSVAEQFLKIHDANFASRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+DF HVRQEE+  LTR +A A
Sbjct  103  SGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDFKHVRQEEIGRLTREVARA  162

Query  499  GKTPVKLGQLLNVCTTNALAR  561
               PV LGQL+N+C  NAL R
Sbjct  163  DTKPVNLGQLVNMCVVNALGR  183



>gb|ADT63065.1| flavonoid 3'-hydroxylase, partial [Fagopyrum esculentum]
Length=457

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LT +L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTGALSKA  125

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GK  V+LGQLLNVCTTNAL RV
Sbjct  126  GKNAVQLGQLLNVCTTNALGRV  147



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  +T +      A F+Y L   V   +P  LPPGP+PWP++GNLPHLG KPHQS+A++A
Sbjct  1    MTPVTFLLTNFAVASFVYLL---VNNGHPHRLPPGPRPWPIVGNLPHLGPKPHQSLASLA  57

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPLMHLRLG VDVVVAASA+VAAQFLK +D+NF NRPPNSGA++IAYNYQDLVFAPY
Sbjct  58   RSYGPLMHLRLGSVDVVVAASASVAAQFLKTNDANFVNRPPNSGAKYIAYNYQDLVFAPY  117

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRK++S+HLFS KALDDF H+RQEEVA L  +L SA  + V LGQLLNVCTTNA
Sbjct  118  GPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLVHALTSASNSLVNLGQLLNVCTTNA  177

Query  553  LARV  564
            LARV
Sbjct  178  LARV  181



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L L+  TL+ +  LY LI  +    P  LPPGPKPWP++GNL HLG+ PH S+AA+A
Sbjct  1    MTPLELVLATLIISTILYTLINSLLNPAPRGLPPGPKPWPIIGNLLHLGRVPHHSLAALA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPLMHLRLG V V+VAAS++VA Q  K HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   KKYGPLMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GP+WRMLRKI SVHLFSAKALDDF H+RQEEV  L  +L  AGK P  L +LLNVCTTN 
Sbjct  121  GPKWRMLRKICSVHLFSAKALDDFRHIRQEEVLVLINALFQAGKAPTDLAKLLNVCTTNV  180

Query  553  LARV  564
            L RV
Sbjct  181  LGRV  184



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   + F T+   I ++ LI  + +   LPLPPGPKPWPV+GN PH+G  PH S+AA+ 
Sbjct  1    MSPFMVAFATVAAVILVHRLIKFLTRNSSLPLPPGPKPWPVVGNFPHMGPVPHHSLAALV  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + +GPLMHLRLGFVD+VVAASA+VA QFLK+HDSNFS+RPPN+GA++IAYNYQDLVFAPY
Sbjct  61   QVHGPLMHLRLGFVDMVVAASASVAEQFLKIHDSNFSSRPPNAGAKYIAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR+LRK+TSVHLFS KALD F H+R+EEV  LTR+L S+    V LGQ+LNVCTTNA
Sbjct  121  GPRWRLLRKLTSVHLFSGKALDVFRHLREEEVGRLTRNLGSSDAKAVNLGQVLNVCTTNA  180

Query  553  LARV  564
            LARV
Sbjct  181  LARV  184



>gb|AAO47844.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47845.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
Length=394

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQLLNVCTTNALAR
Sbjct  162  DTKAVNLGQLLNVCTTNALAR  182



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 139/183 (76%), Gaps = 5/183 (3%)
 Frame = +1

Query  16   ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            AT +LI CT +  +  Y    + ++  P P P         GNLP LG KPHQS+AA+A 
Sbjct  3    ATASLIICTSILGLLFYLFFQKRRRLPPGPRPWPIV-----GNLPQLGAKPHQSMAALAR  57

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             +GPL+HL++GFV VVVAASA VA QFL+VHD+NF +RPPN+GAEH+AYNYQDLVFAPYG
Sbjct  58   VHGPLLHLKMGFVHVVVAASAGVAEQFLRVHDTNFLSRPPNAGAEHVAYNYQDLVFAPYG  117

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  555
            PRWR+LRKI ++HLFSAKALDDF HVR+EEV  + R+LA AG  PV++ + ++VC TNA+
Sbjct  118  PRWRLLRKICALHLFSAKALDDFRHVREEEVGIIVRTLADAGHKPVRISETVHVCATNAI  177

Query  556  ARV  564
            ARV
Sbjct  178  ARV  180



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  496  -AGKTPVKLGQLLNVCTTNALARV  564
             +    V LGQLLNVCTTNALARV
Sbjct  163  YSNTKAVNLGQLLNVCTTNALARV  186



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PHQ++AAMA  YGPL++LRLGFVDVVVA SA++A+QFLK HDSNFS+RPPN
Sbjct  44   GNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMASQFLKTHDSNFSSRPPN  103

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA+HIAYNY DLVFAPYGPRWR+ RKITS+HLFS KALDD+ HVRQEEV  L  +LA A
Sbjct  104  AGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYRHVRQEEVGVLASNLARA  163

Query  499  GKTPVKLGQLLNVCTTNALAR  561
              T V LGQLLN+C TNAL R
Sbjct  164  VSTIVNLGQLLNICATNALGR  184



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  496  -AGKTPVKLGQLLNVCTTNALARV  564
             +    V LGQLLNVCTTNALARV
Sbjct  163  YSDTKAVNLGQLLNVCTTNALARV  186



>gb|ACJ85671.1| unknown [Medicago truncatula]
Length=418

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTT  546
            GPRWR+LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTT
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTT  180

Query  547  NALAR  561
            NALAR
Sbjct  181  NALAR  185



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            MA +  +       + +++++L ++ R+P  LPPGP PWP++GNLPHLG  PH ++AA A
Sbjct  1    MAIIMTLLMDTCITVLVFYVLLNLRTRHPNRLPPGPTPWPIVGNLPHLGPLPHHTLAAFA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL+HLR GFVDVVVA+S  VA+QFL+ +D NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  61   KKYGPLIHLRFGFVDVVVASSPTVASQFLRDNDLNFASRPPNSGAKHMAYNYQDLVFAPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRW MLRKI   HLFS+KALD+F HVR+EEVA LTR LASAG++ VKL QLLNVCT N 
Sbjct  121  GPRWTMLRKICKDHLFSSKALDNFRHVREEEVAILTRILASAGESTVKLSQLLNVCTANT  180

Query  553  LARV  564
            LAR+
Sbjct  181  LARM  184



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQLLNVCTTNALAR
Sbjct  162  DTKAVNLGQLLNVCTTNALAR  182



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQLLNVCTTNALAR
Sbjct  162  DTKAVNLGQLLNVCTTNALAR  182



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQLLNVCTTNALAR
Sbjct  162  DTKAVNLGQLLNVCTTNALAR  182



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            +T +F T+V A  L+ L+     R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTPLFLTIVLATVLFCLLFLFSLRRNHRLPPGPNPWPIVGNLPHMGTKPHQTLAAMVTTY  60

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GP++HLRLGFVDVVVAAS +VA QFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WRMLRKI+SVHLFSAKAL+DF H+RQEEV TL+  LA  G   V LGQL+N+C  N+L R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHIRQEEVGTLSGELARVGTKAVNLGQLVNMCVINSLGR  180



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 4/182 (2%)
 Frame = +1

Query  31   IFCTLVFAIFLYFL--ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  204
            I  +L+F + +YFL  I     R  L LPPGPKP P++GNLPH+G  PH S+AA+A  YG
Sbjct  5    ILVSLLFGVLIYFLFNIRSFFNRKSLRLPPGPKPRPIIGNLPHMGPMPHHSLAALARTYG  64

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+MHLRLGFVDV+VAASA+VAAQFLKVHD+NFS+RPPNSGA++IAYNYQDLVF PYG +W
Sbjct  65   PIMHLRLGFVDVIVAASASVAAQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFRPYGAKW  124

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTTNALA  558
            R+LRKITSVHLFS KALDD+  VRQ EVA LTR+LASAG     V L QLLNVCT NAL+
Sbjct  125  RLLRKITSVHLFSGKALDDYRLVRQGEVAVLTRALASAGLKSELVNLAQLLNVCTVNALS  184

Query  559  RV  564
            RV
Sbjct  185  RV  186



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTT  546
            GPRWR+LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTT
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTT  180

Query  547  NALAR  561
            NALAR
Sbjct  181  NALAR  185



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTANALGRV  183



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG+ PH+S+AA+A +YGPL+HLRLGF+DVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGQSPHRSLAALATKYGPLIHLRLGFIDVVVAASASVAAQFLKAHDANFASRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNY D+VF PYGPRWRMLRK+  VHLFS KAL+DF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYNDMVFEPYGPRWRMLRKLCLVHLFSNKALNDFRHIRQEEVAILTRALGGA  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G++ V+L +LLN+C +NAL+RV
Sbjct  162  GQSIVQLDKLLNLCISNALSRV  183



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GN+PHLG  PH S+AA+A+ YGPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPN
Sbjct  42   GNIPHLGPVPHHSLAALAKTYGPLMHLKLGFVDVIVAASASVAEQFLKVHDANFSSRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            +GA+++AYNYQDLVFA YGPRWR+LRK++S+HLFS K+LD+F H+RQEEV+ LTR LA +
Sbjct  102  AGAKYMAYNYQDLVFASYGPRWRLLRKLSSIHLFSNKSLDEFKHMRQEEVSRLTRYLADS  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
                V LG LLNVCTTNAL+RV
Sbjct  162  DPKSVNLGPLLNVCTTNALSRV  183



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            L  +   LV  +   FL     QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++
Sbjct  3    LIAVITLLVALVLFRFLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKH  62

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GPLMHLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPR  122

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WR  RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL R
Sbjct  123  WRQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGR  182

Query  562  V  564
            V
Sbjct  183  V  183



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRV  183



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKPQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRV  183



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRV  183



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRV  183



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRV  183



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  216
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  217  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  396
            LR G+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRFGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  397  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGRV  183



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTT  546
            GPRWR+LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTT
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTT  180

Query  547  NALAR  561
            NALAR
Sbjct  181  NALAR  185



>gb|AGT50310.1| flavonoid 3'-hydroxylase, partial [Meconopsis simplicifolia]
Length=468

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 121/146 (83%), Gaps = 4/146 (3%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHL S KALD+F HVR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLLSGKALDEFRHVREEEVAVLTKALAQS  122

Query  499  GK----TPVKLGQLLNVCTTNALARV  564
             K    +PV L  LLNVCTTNALARV
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARV  148



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 146/183 (80%), Gaps = 4/183 (2%)
 Frame = +1

Query  19   TLTLIFCTLVFAIFLYFLILRVK---QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            TL  I C  + A+   + IL ++    R+P  LPPGP+PWP++GNLPHLG KPH SIAAM
Sbjct  4    TLEFILCFTITALPFLYCILNMRILLNRHPRSLPPGPRPWPIVGNLPHLGTKPHHSIAAM  63

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A +YGPL+HLR+G V VVVAASA VAAQFLK +D+NFS+RPPNSGA+H+AYNY D+VFAP
Sbjct  64   ARKYGPLLHLRMGIVHVVVAASADVAAQFLK-NDANFSSRPPNSGAKHMAYNYHDMVFAP  122

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGPRWRMLRKI ++H+FSAKALDDF  VR+EEVA L R+LA AG+ PV LGQL + C  N
Sbjct  123  YGPRWRMLRKICALHIFSAKALDDFHRVREEEVAILARTLAHAGQKPVNLGQLFSTCNAN  182

Query  550  ALA  558
            AL+
Sbjct  183  ALS  185



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 122/146 (84%), Gaps = 4/146 (3%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  499  GK----TPVKLGQLLNVCTTNALARV  564
             K    +PV L  LLNVCTTNALARV
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARV  148



>gb|AGY55961.1| flavonoid 3'-hydroxylase, partial [Punica granatum]
Length=332

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  271  QFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCH  450
            QFLK+HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFSAKALDDF H
Sbjct  14   QFLKIHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSAKALDDFRH  73

Query  451  VRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  564
            VRQEEVA LTR+LASAGKTPVKLGQLLNVCTTNALARV
Sbjct  74   VRQEEVAILTRALASAGKTPVKLGQLLNVCTTNALARV  111



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH ++AA+A +YGPL++LRLGFV VVVA+S +VAAQFLKVHD  F++RPPN
Sbjct  43   GNLPHLGAIPHHTLAALATKYGPLVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQD+VFAPYGP+W M RKI   HLFS+KALDDF HVRQEEVA L R LA A
Sbjct  103  SGAKHIAYNYQDMVFAPYGPQWTMFRKICKDHLFSSKALDDFRHVRQEEVAILARGLAGA  162

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G++ V LGQ LN+CT N LAR+
Sbjct  163  GRSKVNLGQQLNMCTANTLARM  184



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 122/146 (84%), Gaps = 4/146 (3%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  499  GK----TPVKLGQLLNVCTTNALARV  564
             K    +PV L  LLNVCTTNALARV
Sbjct  131  NKNSKGSPVNLADLLNVCTTNALARV  156



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 2/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A
Sbjct  1    MSILTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLA  58

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPY
Sbjct  59   KKYGPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPY  118

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRK+ S+HLFSAKAL DF  VRQEEV  LTR LA  G++ VKL Q LNVC  N 
Sbjct  119  GPRWRMLRKMCSMHLFSAKALTDFRQVRQEEVTILTRVLARTGQSAVKLDQQLNVCFANT  178

Query  553  LARV  564
            L+R+
Sbjct  179  LSRM  182



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M   +LI  T+  ++ LY L L    R   PLPPGPKPWP++GNLPHLG  PHQS+AA+A
Sbjct  1    MTPSSLILATIAISVILYSL-LSYLARPARPLPPGPKPWPLVGNLPHLGPMPHQSMAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPL+HLRLG VDVVVA+SA+VA+QFLK H++NF +RPP+S A+H++YNYQDLV  PY
Sbjct  60   RAYGPLLHLRLGLVDVVVASSASVASQFLKTHEANFLSRPPHSAAKHLSYNYQDLVSLPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRKI+S+HLFS KALDD+ HVR EEV  LT +LA    TP KL QLLNVCT N 
Sbjct  120  GPRWRMLRKISSIHLFSGKALDDYRHVRHEEVVVLTHALAHVSSTPKKLAQLLNVCTANV  179

Query  553  LARV  564
            L RV
Sbjct  180  LGRV  183



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 4/146 (3%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYN+QDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNHQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  499  GK----TPVKLGQLLNVCTTNALARV  564
             K    +PV L  LLNVCTTNALARV
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARV  148



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 5/147 (3%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+HIAYNYQDLVFAPYG RWRM RKI ++HLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  499  GK-----TPVKLGQLLNVCTTNALARV  564
             K     +PV L  LLNVCTTNALARV
Sbjct  131  NKNSKAGSPVNLADLLNVCTTNALARV  157



>ref|XP_010522799.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X6 [Tarenaya 
hassleriana]
Length=391

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  154  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  333
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  334  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  513
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  514  KLGQLLNVCTTNALARV  564
             L QL+NVC  NAL RV
Sbjct  121  NLSQLVNVCVVNALGRV  137



>ref|XP_010522791.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X5 [Tarenaya 
hassleriana]
Length=469

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  154  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  333
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  334  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  513
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  514  KLGQLLNVCTTNALARV  564
             L QL+NVC  NAL RV
Sbjct  121  NLSQLVNVCVVNALGRV  137



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+ LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A
Sbjct  1    MSILTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLA  58

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            ++YGPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPY
Sbjct  59   KKYGPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPY  118

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWRMLRK+ S+HLFSAKAL DF  VRQEEV  LTR LA   ++ VKL Q LNVC  N 
Sbjct  119  GPRWRMLRKMCSMHLFSAKALADFRQVRQEEVMILTRVLAGTEQSAVKLDQQLNVCFANT  178

Query  553  LARV  564
            L+R+
Sbjct  179  LSRM  182



>ref|XP_010522758.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010522767.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
Length=489

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  154  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  333
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  334  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  513
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  514  KLGQLLNVCTTNALARV  564
             L QL+NVC  NAL RV
Sbjct  121  NLSQLVNVCVVNALGRV  137



>ref|XP_010522775.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010522783.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
Length=488

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  154  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  333
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  334  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  513
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  514  KLGQLLNVCTTNALARV  564
             L QL+NVC  NAL RV
Sbjct  121  NLSQLVNVCVVNALGRV  137



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +1

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            MA+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFA
Sbjct  1    MAKTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHMAYNYQDLVFA  60

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCT  543
            PYGPRWR+LRKI SVHLFSAKALDDF  VR+EEVA LTR+ LAS GK  V LGQLLNVCT
Sbjct  61   PYGPRWRLLRKICSVHLFSAKALDDFHLVREEEVAILTRTLLASVGKDSVNLGQLLNVCT  120

Query  544  TNALARV  564
            TNAL RV
Sbjct  121  TNALGRV  127



>ref|XP_010522740.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Tarenaya 
hassleriana]
Length=589

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  154  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  333
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  334  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  513
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  514  KLGQLLNVCTTNALARV  564
             L QL+NVC  NAL RV
Sbjct  121  NLSQLVNVCVVNALGRV  137



>ref|XP_010522750.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  154  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  333
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  334  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  513
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  514  KLGQLLNVCTTNALARV  564
             L QL+NVC  NAL RV
Sbjct  121  NLSQLVNVCVVNALGRV  137



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  357
            +AA++  YGPLMHL++GFV VVVAASA  A QFLKV+D+NFSNRPPN+GA+++AYNYQDL
Sbjct  1    MAALSRVYGPLMHLKMGFVHVVVAASAGAAEQFLKVNDANFSNRPPNAGAKYVAYNYQDL  60

Query  358  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  537
            VFAPYGPRWR+LRKI ++HLFSAKAL+DF  VRQEEV  LTR+LASAG+TP  LGQ+LNV
Sbjct  61   VFAPYGPRWRLLRKICALHLFSAKALEDFRTVRQEEVGILTRALASAGQTPASLGQMLNV  120

Query  538  CTTNALARV  564
            C TNA+ARV
Sbjct  121  CATNAIARV  129



>emb|CDP16353.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   180 bits (457),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+TLTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEV  468
            GPRWR+LRKI S+HLFSAKALDDF  VRQ ++
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQVKI  151



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  499  GKTPVKLGQLLNVCTTNALAR  561
             + PV LG+ LNVC TNAL+R
Sbjct  163  SR-PVNLGETLNVCATNALSR  182



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG KPH S+A +A  YGPLMHL++GFV VVVA+SA+ A Q L+VHD+NF +RPPN
Sbjct  45   GNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPN  104

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGA+H+AYNY+DLVF PYGP+WR+LRKI + H+FS KA+DDF  VR+EEVA L+R+L  A
Sbjct  105  SGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL--A  162

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            GK  V +GQ+LNVC TNAL+RV
Sbjct  163  GKRAVPIGQMLNVCATNALSRV  184



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  187  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  366
            MA+ YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFA
Sbjct  1    MAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFA  60

Query  367  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  546
            PYGPRWR+LRKI SVHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTT
Sbjct  61   PYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTT  120

Query  547  NALARV  564
            NALARV
Sbjct  121  NALARV  126



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA +A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASAPIASEFLRTHDTNFSNRPPN  102

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRTLRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  499  GKTPVKLGQLLNVCTTNALAR  561
             + PV LG+ LNVC TNAL+R
Sbjct  163  CR-PVNLGETLNVCATNALSR  182



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%), Gaps = 4/136 (3%)
 Frame = +1

Query  169  HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNY  348
            HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNY
Sbjct  4    HQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNY  63

Query  349  QDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVK  516
            QDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV 
Sbjct  64   QDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAKSNKNGQGSPVN  123

Query  517  LGQLLNVCTTNALARV  564
            L  LLNVCTTNALARV
Sbjct  124  LADLLNVCTTNALARV  139



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 3/144 (2%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPHQ++AAM++ YGPL  LR G VDVVVAAS+ VAAQFL+ +D+NFSNRPPN
Sbjct  46   GNLPQLGTKPHQTLAAMSKLYGPLFRLRFGSVDVVVAASSTVAAQFLRTYDANFSNRPPN  105

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSL---  489
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ ++HLFS KALDD   VRQ EVA L  +L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSLKALDDLRLVRQGEVAALAANLHRH  165

Query  490  ASAGKTPVKLGQLLNVCTTNALAR  561
            A+ G  PV LG+ LNVC TNALAR
Sbjct  166  AANGHPPVNLGRALNVCATNALAR  189



>gb|KHN18348.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=519

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  201
            L +   T+V AI  Y L+  + +R  L LPPGP+PWPV+GNLPH+G   H+++A +A  Y
Sbjct  5    LIIGLATIVAAILSYRLLKLIIRRPSLHLPPGPRPWPVVGNLPHIGPLLHRALAVLARTY  64

Query  202  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  381
            GPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP NS   ++ YN +DL FAPYGPR
Sbjct  65   GPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLNSMTTYMTYNQKDLAFAPYGPR  124

Query  382  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            WR LRKI+SVH+FS KALDDF  +RQEEV  LT +LAS+G T V LGQL+NVCTTN LAR
Sbjct  125  WRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASSGSTAVNLGQLVNVCTTNTLAR  184

Query  562  V  564
            V
Sbjct  185  V  185



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  178  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  357
            +AA+A+ YGPLMHLR+GFVDV+VAASA+VAAQFLK HD NFS+RP N+GA+++AYN+QDL
Sbjct  1    MAALAQVYGPLMHLRMGFVDVIVAASASVAAQFLKTHDVNFSSRPTNAGAKYVAYNHQDL  60

Query  358  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  537
            VFAPYGPRWR+LRKI+SVHLFSAKALDDF HVR++EV  LT +LA A +TP+ LG+LLN 
Sbjct  61   VFAPYGPRWRLLRKISSVHLFSAKALDDFRHVREQEVGILTHALADACETPINLGRLLNT  120

Query  538  CTTNALARV  564
            CTTNAL RV
Sbjct  121  CTTNALGRV  129



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIA  183
            M ++  I  +++ A+ L+ L  +++ R  +P    P       ++GNLP LG  PHQ+IA
Sbjct  1    MPSIFTILGSILLAVLLFCLFNQLRSRRSVPGRRLPPGPRPWPIIGNLPQLGPAPHQTIA  60

Query  184  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  363
            A+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+H+ YNY DLV 
Sbjct  61   ALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAKHVGYNYHDLVL  120

Query  364  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  543
            APYGPRWR++RKI SVHL S KAL+DF +VRQEE A L R LA+AG T + L QLL++CT
Sbjct  121  APYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTAINLAQLLHLCT  180

Query  544  TNALAR  561
            TN L R
Sbjct  181  TNTLGR  186



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M  L+ I   +  +IFL  L L    R    LPPGPKPWP++GNLPHLG  PH+S+AA+A
Sbjct  1    MMPLSFILAAIAISIFLRSL-LGYLTRPTRALPPGPKPWPLVGNLPHLGPMPHRSMAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
              YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN+Q +   PY
Sbjct  60   RSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYNHQGIGAVPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            G RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L QLLNVCT NA
Sbjct  120  GSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQLLNVCTANA  179

Query  553  LARV  564
            L RV
Sbjct  180  LGRV  183



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 144/185 (78%), Gaps = 1/185 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQ-RYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  189
            M+T  + F T++ A+ +Y ++  + +    LPLPPGP+PWP++GNLPH+G  PHQ +A +
Sbjct  1    MSTWVIGFATIIAAVLIYRVLKPISRPSSSLPLPPGPRPWPIVGNLPHMGPAPHQGLANL  60

Query  190  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  369
            A+ +GPLMHLRLGFVDVVVAASA+VA QFLK+HD+NF +RP N    ++AYN QDLVFAP
Sbjct  61   AQTHGPLMHLRLGFVDVVVAASASVAEQFLKIHDANFCSRPLNFRTTYLAYNKQDLVFAP  120

Query  370  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  549
            YGP+WR LRK+T+VH+FSAKA+DDF  +RQEEVA LT  LA +    V L QLLNVCTTN
Sbjct  121  YGPKWRFLRKLTTVHMFSAKAMDDFSQLRQEEVARLTCKLARSSSKAVNLRQLLNVCTTN  180

Query  550  ALARV  564
            AL R+
Sbjct  181  ALTRI  185



>ref|XP_003550701.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=526

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPH+G   H+++A +A  YGPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP N
Sbjct  51   GNLPHIGPLLHRALAVLARTYGPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLN  110

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            S   ++ YN +DL FAPYGPRWR LRKI+SVH+FS KALDDF  +RQEEV  LT +LAS+
Sbjct  111  SMTTYMTYNQKDLAFAPYGPRWRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASS  170

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G T V LGQL+NVCTTN LARV
Sbjct  171  GSTAVNLGQLVNVCTTNTLARV  192



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   QTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR LRK+++VH+FSAKA+DDF  +RQEEV  LT +LA +    V L QLLNVCTTN 
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARSSSKVVNLRQLLNVCTTNI  179

Query  553  LARV  564
            LAR+
Sbjct  180  LARI  183



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   KTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR LRK+++VH+FSAKA+DDF  +RQEEV  LT +LA +    V L QLLNVCTTN 
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARSSSKVVNLRQLLNVCTTNI  179

Query  553  LARV  564
            LAR+
Sbjct  180  LARI  183



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPHQ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+VHD+NFSNRPPN
Sbjct  46   GNLPQLGDKPHQTMCALAREYGPLFRLRFGCAEVVVAASADVAAQFLRVHDANFSNRPPN  105

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  492
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKAL+D   VR+ EVA + R+LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALEDLRAVREGEVALMVRNLARQ  165

Query  493  SAGKTPVKLGQLLNVCTTNALAR  561
            +A   PV LGQ  NVC TN LAR
Sbjct  166  AAATAPVVLGQEANVCATNTLAR  188



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP +G KPH ++ AMA  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCAMAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  492
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARQ  165

Query  493  -SAGKTPVKLGQLLNVCTTNALAR  561
               G+  V LGQ+ NVC TN LAR
Sbjct  166  GERGRAAVALGQVANVCATNTLAR  189



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 133/189 (70%), Gaps = 3/189 (2%)
 Frame = +1

Query  4    DPSMATLTLIFCTLVFAIFL-YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  180
            +  MA L +   TL F+ FL Y    R       P PPGPK WP+LGNL  LG KPHQ++
Sbjct  17   EAGMAPLLVFLSTLFFSSFLCYISFKRSINGRSPPRPPGPKGWPILGNLLQLGAKPHQTL  76

Query  181  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  360
             A++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPNSGAEH+ YNYQDLV
Sbjct  77   CALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPNSGAEHVVYNYQDLV  136

Query  361  FAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKT--PVKLGQLLN  534
            FAPYGPRWRMLRK+ ++HLFSAKALDDF  VR  EVA L  +L S  ++     LG+LL 
Sbjct  137  FAPYGPRWRMLRKLCALHLFSAKALDDFRPVRAGEVAILANTLYSHAQSRREANLGELLT  196

Query  535  VCTTNALAR  561
            +CTTNAL++
Sbjct  197  ICTTNALSK  205



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPHQS+  ++  YGPL  LR G+VDVVVAASA VA QFL+VHD NFSNRPPN
Sbjct  42   GNLPQLGAKPHQSLCELSRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSL---  489
            SGAEHIAYNYQDLVFAPYGPRWRMLRK+ ++HLFS KAL+D   VR  EVATL  +L   
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLYLR  161

Query  490  ASAGKTPVKLGQLLNVCTTNALAR  561
            A + +  V L Q+L  CTTNAL++
Sbjct  162  AQSDQPTVNLAQMLTTCTTNALSK  185



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPHQ++ A+++ +GPL  L+LG  +VVVAAS+ VAA+FL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGTKPHQTMHALSKVHGPLFRLKLGSAEVVVAASSTVAAEFLRSHDANFSNRPPN  104

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D  +VR++EV  L   LAS 
Sbjct  105  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLRYVREQEVGILAGDLAST  164

Query  499  GKTPVKLGQLLNVCTTNALAR  561
             + PV LG+ LNVC TNAL+R
Sbjct  165  SR-PVNLGEALNVCATNALSR  184



>gb|ADX95997.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=132

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLPHLG  PH ++AA+A++YGPLMHLRLG+VDVVVAA+A+VAAQFLKVHD+NF++RPPN
Sbjct  26   GNLPHLGPIPHHALAALAQKYGPLMHLRLGYVDVVVAATASVAAQFLKVHDANFASRPPN  85

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQ  459
            SGA+H+AYNYQDLVFAPYGPRWR+LRKI SVHLFSAKALDDF HVRQ
Sbjct  86   SGAKHVAYNYQDLVFAPYGPRWRLLRKICSVHLFSAKALDDFRHVRQ  132



>ref|XP_004983036.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=515

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPH ++AAMA  +GPL  LR G  +VVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQLGAKPHHTMAAMAREHGPLFRLRFGSAEVVVAASAAVAAQFLRAHDANFSNRPPN  105

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSARALDDLRAVREGEVALMVRELARQ  165

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQ  NVC TN LAR
Sbjct  166  RGPAVALGQAANVCATNTLAR  186



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPH ++AA++  YGPL+HLRLG V  VVA+SA+VAA FLK HD+NFS+RPPN
Sbjct  46   GNLPQLGAKPHHTLAALSRAYGPLLHLRLGRVHAVVASSASVAAAFLKTHDANFSSRPPN  105

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEH+AYNYQDLVFAPYGPRWR LRK+ SVHLF  +AL+ F HVR+EE   L R+L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRTLRKLCSVHLFCTRALEGFRHVREEEAGVLARALLGR  165

Query  499  GKTPVKLGQLLNVCTTNALAR  561
              +   +G+ +NVC  NALAR
Sbjct  166  RGSAADVGEEVNVCAANALAR  186



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPH+++ A+A+ +GPL  LR G VDVVVAASAAVA+Q L+ HD+ F +RPPN
Sbjct  42   GNLPQLGPKPHRTLHALAKVHGPLFRLRFGSVDVVVAASAAVASQLLRAHDAIFCDRPPN  101

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ SVHLFSAKALDD   VRQ EV  L  +L + 
Sbjct  102  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCSVHLFSAKALDDLRWVRQGEVGLLVHALRAC  161

Query  499  GKTPVKLGQLLNVCTTNALARV  564
            G  PV LG  +NVC TNALAR 
Sbjct  162  GDAPVNLGYAVNVCATNALARA  183



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG KPH ++ A+A +YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  52   GNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRPPN  111

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R+LA  
Sbjct  112  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQ  171

Query  499  GKTPVKLGQLLNVCTTNALAR  561
                V LGQ  NVC TN LAR
Sbjct  172  QAASVALGQEANVCATNTLAR  192



>dbj|BAB17054.1| unnamed protein product [Arabidopsis thaliana]
Length=151

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQS  177
            MATL   F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++
Sbjct  1    MATL---FLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRT  56

Query  178  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  357
            ++AM   YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDL
Sbjct  57   LSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDL  116

Query  358  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQ  459
            VFAPYG RWR+LRKI+SVHLFSAKAL+DF HVRQ
Sbjct  117  VFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQ  150



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +1

Query  151  HLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAE  330
             LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+
Sbjct  23   QLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAK  82

Query  331  HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP  510
            H+ Y+Y DLV APYGPRWR++RKI SVHL S KAL+DF +VRQEE A L R LA+AG T 
Sbjct  83   HVGYDYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTA  142

Query  511  VKLGQLLNVCTTNALAR  561
            + L QLL++CTTN L R
Sbjct  143  INLAQLLHLCTTNTLGR  159



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 127/174 (73%), Gaps = 6/174 (3%)
 Frame = +1

Query  40   TLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHL  219
            TLVFA  LY L+     R P      P      GNLP LG KPHQ++ A+++ +GPL  L
Sbjct  11   TLVFASLLYHLLSGPAHRLPPGPRGWPIL----GNLPQLGPKPHQTLHALSKAHGPLFLL  66

Query  220  RLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRK  399
            RLG VDVVVAASAAVAA FL+ HD+ FSNRPPNSGAEHIAYNYQDLVFAPYGPRWR LRK
Sbjct  67   RLGSVDVVVAASAAVAAAFLRQHDAIFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRHLRK  126

Query  400  ITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  561
            + S+HLFS+KALDD   +R++E+  LTRSL      PV LG+ +NVC TNALAR
Sbjct  127  LCSLHLFSSKALDDLRPIREQEIQRLTRSLLVG--RPVNLGEAVNVCATNALAR  178



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +1

Query  166  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  345
            PHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPNSGAEHIAYN
Sbjct  1    PHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPNSGAEHIAYN  60

Query  346  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  525
            Y DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA + + PV LG+
Sbjct  61   YNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVALLARDLAGSSR-PVNLGE  119

Query  526  LLNVCTTNALAR  561
             LNVC TNAL+R
Sbjct  120  TLNVCATNALSR  131



>gb|AGG40645.1| flavanone 3'-hydroxylase [Narcissus tazetta]
Length=529

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 132/189 (70%), Gaps = 3/189 (2%)
 Frame = +1

Query  4    DPSMATLTLIFCTLVFAIFL-YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  180
            +  MA L +   TL F+ FL Y    R       P PPGPK WP+LG+L  LG KPHQ++
Sbjct  17   EAGMAPLLVFLSTLFFSSFLCYISFKRSINGRSPPRPPGPKGWPILGSLLQLGAKPHQTL  76

Query  181  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  360
             A++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPNSGAEH+AYNYQDLV
Sbjct  77   CALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPNSGAEHVAYNYQDLV  136

Query  361  FAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKT--PVKLGQLLN  534
            FAPYGPRWRMLRK+ ++HLFS KALDD   VR  EVA L  +L +  +T     LG+LL 
Sbjct  137  FAPYGPRWRMLRKLCALHLFSPKALDDLRPVRAGEVAILANTLYNHAQTHGEANLGELLT  196

Query  535  VCTTNALAR  561
            +CTTNAL++
Sbjct  197  ICTTNALSK  205



>ref|XP_002439914.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
 gb|EES18344.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
Length=535

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 111/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG K HQ++  + + YGPL+ LR G  DVVVA SAAVA QFL+VHD+NFS RPPN
Sbjct  58   GNLPQLGGKTHQTLHELTKVYGPLLRLRFGSSDVVVAGSAAVAEQFLRVHDANFSCRPPN  117

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  498
            SG E +AYNYQD+VFAPYGPRWR +RK+ +V+LFSA+ALDD C VR+ E A + RSLA  
Sbjct  118  SGGELMAYNYQDVVFAPYGPRWRAMRKVCAVNLFSARALDDICDVREREAALMVRSLAEQ  177

Query  499  G----KTPVKLGQLLNVCTTNALAR  561
                  TPV LG+ +NVCTTNAL+R
Sbjct  178  AARDRNTPVALGKAVNVCTTNALSR  202



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +1

Query  139  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  315
            GN+P +G  P H  +AAMA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGGAPLHSLLAAMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  316  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  495
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +RQ+E++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISAVHLFSSKALDDHRRIRQDEISVLVQALAR  162

Query  496  AGKTPVKLGQLLNVCTTNALAR  561
            +G+ P  LG LL VC  N+L R
Sbjct  163  SGEAPANLGSLLTVCIANSLGR  184



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 135/188 (72%), Gaps = 8/188 (4%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA-----SAGK-TPVKLGQLLNV  537
             RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA       G+   V LGQ+ NV
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQVANV  184

Query  538  CTTNALAR  561
            C TN LAR
Sbjct  185  CATNTLAR  192



>gb|AII26680.1| flavonoid 3'-hydroxylase [Indosasa hispida]
Length=521

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 128/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  46   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  222
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  223  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  402
             G  DVVVA SAAVA QFL++HD+ FSNRPPNSG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPNSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  403  TSVHLFSAKALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQLLNVCTTNALAR  561
             +V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+ +NVCTTNAL+R
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGKAVNVCTTNALSR  190



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  166  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  345
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  346  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  525
            +Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  526  LLNVCTTNALARV  564
            LLNVCT NAL RV
Sbjct  122  LLNVCTANALGRV  134



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  166  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  345
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  346  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  525
            +Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  526  LLNVCTTNALARV  564
            LLNVCT NAL RV
Sbjct  122  LLNVCTANALGRV  134



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|AGT50315.1| flavonoid 3'-hydroxylase, partial [Meconopsis betonicifolia]
Length=452

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 110/146 (75%), Gaps = 8/146 (5%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP +G  PH ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  496  ----AGKTPVKLGQLLNVCTTNALAR  561
                AG   V LGQ+ NVC TN LAR
Sbjct  168  QHQHAG---VPLGQVANVCATNTLAR  190



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|AGT50317.1| flavonoid 3'-hydroxylase, partial [Meconopsis zangnanensis]
Length=442

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 4/126 (3%)
 Frame = +1

Query  199  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  378
            YGP+++LR G V+VVVA SA++A+QFLK  DSNFSNRPPNSGA+HIAYNYQDLVFAPYG 
Sbjct  4    YGPIIYLRFGSVNVVVACSASIASQFLKTRDSNFSNRPPNSGAKHIAYNYQDLVFAPYGR  63

Query  379  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTT  546
            RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA + +    +PV L  LLNVCTT
Sbjct  64   RWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNENSKGSPVNLADLLNVCTT  123

Query  547  NALARV  564
            NALARV
Sbjct  124  NALARV  129



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA   K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQTNKNSKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 8/146 (5%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  496  ----AGKTPVKLGQLLNVCTTNALAR  561
                AG   V LGQ+ NVC TN LAR
Sbjct  168  QHQHAG---VPLGQVANVCATNTLAR  190



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 8/146 (5%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  496  ----AGKTPVKLGQLLNVCTTNALAR  561
                AG   V LGQ+ NVC TN LAR
Sbjct  168  QHQHAG---VPLGQVANVCATNTLAR  190



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFWYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|AEF33624.1| flavonoid 3' hydroxylase [Zea mays]
Length=517

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 8/146 (5%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  496  ----AGKTPVKLGQLLNVCTTNALAR  561
                AG   V LGQ+ NVC TN LAR
Sbjct  168  QHQHAG---VPLGQVANVCATNTLAR  190



>gb|AGT50316.1| flavonoid 3'-hydroxylase, partial [Meconopsis integrifolia]
Length=445

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPP+SGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPDSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLSDLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 5/125 (4%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-----TPVKLGQLLNVCTTN  549
            RM RKI ++HLFS KALD+F +VR+EEVA LT++LA + K     +PV L  LLNVCTTN
Sbjct  61   RMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKAGSPVNLADLLNVCTTN  120

Query  550  ALARV  564
            ALARV
Sbjct  121  ALARV  125



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = +1

Query  139  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  315
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  316  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  495
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  496  AGKTPVKLGQLLNVCTTNALARV  564
            +G+ P  LG LL VC  N+L R 
Sbjct  163  SGEAPANLGSLLTVCIANSLGRT  185



>gb|AGT50321.1| flavonoid 3'-hydroxylase, partial [Meconopsis wilsonii]
Length=445

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 4/124 (3%)
 Frame = +1

Query  205  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  384
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGARHIAYNYQDLVFAPYGRRW  60

Query  385  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  552
            RM RKI +VHLFS KALD+F + R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYAREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  553  LARV  564
            LARV
Sbjct  121  LARV  124



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  105

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  492
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  165

Query  493  SAGKTPVKLGQLLNVCTTNALAR  561
                  V LGQ+ NVC TN LAR
Sbjct  166  QHQHAGVPLGQVANVCATNTLAR  188



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 110/146 (75%), Gaps = 8/146 (5%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP +G  P+ ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPYHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  495
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  496  ----AGKTPVKLGQLLNVCTTNALAR  561
                AG   V LGQ+ NVC TN LAR
Sbjct  168  QHQHAG---VPLGQVANVCATNTLAR  190



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = +1

Query  139  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  315
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  316  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  495
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  496  AGKTPVKLGQLLNVCTTNALARV  564
            +G+ P  LG LL VC  N+L R 
Sbjct  163  SGEAPANLGSLLTVCIANSLGRT  185



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = +1

Query  139  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  318
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  107

Query  319  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  492
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  167

Query  493  SAGKTPVKLGQLLNVCTTNALAR  561
                  V LGQ+ NVC TN LAR
Sbjct  168  QHQHAGVPLGQVANVCATNTLAR  190



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 135/188 (72%), Gaps = 8/188 (4%)
 Frame = +1

Query  22   LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  195
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  196  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  375
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  376  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA-----SAGK-TPVKLGQLLNV  537
             RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA       G+   V LGQ+ NV
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQVANV  184

Query  538  CTTNALAR  561
            C TN LAR
Sbjct  185  CATNTLAR  192



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = +1

Query  13   MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  192
            M+   +   T+V AI +Y  +L+      LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSPWVIAVATIVAAILIY-RVLKHIAGPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  193  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  372
            + +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N    ++ YN +D+ F PY
Sbjct  60   KTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYNFRTTYMTYNKKDIAFYPY  119

Query  373  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  552
            GPRWR LRKI +VH+FS KA+D+F  +RQEEV  L  +L  +    V L QLLNVC TN 
Sbjct  120  GPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRSNSKAVNLRQLLNVCITNI  179

Query  553  LARV  564
            +AR+
Sbjct  180  MARI  183



>gb|AII26679.1| flavonoid 3'-monooxygenase [Indosasa hispida]
Length=521

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  46   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  222
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  223  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  402
             G  DVVVA SAAVA QFL++HD+ FSNRPP+SG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPSSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  403  TSVHLFSAKALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQLLNVCTTNALAR  561
             +V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+ +NVCTTNA +R
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGKAVNVCTTNAPSR  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920