BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016J05

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                 57.4    4e-08   Citrus sinensis [apfelsine]
dbj|BAA00860.1|  cyc07                                                57.0    4e-08   Catharanthus roseus [chatas]
gb|ACU17112.1|  unknown                                               56.2    5e-08   Glycine max [soybeans]
gb|KJB28382.1|  hypothetical protein B456_005G045000                  56.6    6e-08   Gossypium raimondii
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like        57.0    6e-08   Sesamum indicum [beniseed]
dbj|BAA05057.1|  cyc07                                                56.6    6e-08   Catharanthus roseus [chatas]
gb|KJB28385.1|  hypothetical protein B456_005G045000                  56.6    6e-08   Gossypium raimondii
ref|XP_010090259.1|  40S ribosomal protein S3a                        56.6    7e-08   Morus notabilis
emb|CBI34197.3|  unnamed protein product                              55.8    7e-08   Vitis vinifera
gb|KHG11221.1|  40S ribosomal S3a                                     56.6    8e-08   Gossypium arboreum [tree cotton]
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2    55.8    9e-08   Vitis vinifera
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like      56.2    9e-08   Vitis vinifera
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein           56.2    1e-07   Medicago truncatula
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                 56.2    1e-07   Theobroma cacao [chocolate]
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg           56.2    1e-07   Citrus clementina [clementine]
gb|KJB28384.1|  hypothetical protein B456_005G045000                  55.8    1e-07   Gossypium raimondii
gb|KJB28386.1|  hypothetical protein B456_005G045000                  55.8    1e-07   Gossypium raimondii
ref|XP_010092425.1|  40S ribosomal protein S3a                        56.2    1e-07   
gb|KJB38202.1|  hypothetical protein B456_006G241700                  55.8    1e-07   Gossypium raimondii
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg           55.8    1e-07   Prunus persica
ref|XP_007030615.1|  Ribosomal protein S3Ae                           55.8    1e-07   
ref|NP_001239858.1|  uncharacterized protein LOC100808747             55.8    1e-07   Glycine max [soybeans]
emb|CDO99096.1|  unnamed protein product                              55.8    1e-07   Coffea canephora [robusta coffee]
gb|KDP40219.1|  hypothetical protein JCGZ_02217                       55.8    1e-07   Jatropha curcas
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                   55.5    1e-07   Eucalyptus grandis [rose gum]
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...  55.8    1e-07   Catharanthus roseus [chatas]
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg           55.8    1e-07   Citrus clementina [clementine]
gb|KJB38201.1|  hypothetical protein B456_006G241700                  55.8    1e-07   Gossypium raimondii
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2           55.8    1e-07   Prunus mume [ume]
gb|KJB28383.1|  hypothetical protein B456_005G045000                  55.5    1e-07   Gossypium raimondii
gb|KJB72261.1|  hypothetical protein B456_011G167500                  55.8    1e-07   Gossypium raimondii
emb|CDO98656.1|  unnamed protein product                              55.8    1e-07   Coffea canephora [robusta coffee]
gb|KHG19560.1|  40S ribosomal S3a                                     55.8    1e-07   Gossypium arboreum [tree cotton]
ref|NP_001241430.1|  uncharacterized protein LOC100813273             55.8    2e-07   Glycine max [soybeans]
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a       55.8    2e-07   Helianthus annuus
gb|KHG05975.1|  40S ribosomal S3a                                     55.8    2e-07   Gossypium arboreum [tree cotton]
ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a             55.8    2e-07   Sesamum indicum [beniseed]
ref|NP_001276152.1|  40S ribosomal protein S3a-like                   55.8    2e-07   
gb|KHN02741.1|  40S ribosomal protein S3a                             55.8    2e-07   Glycine soja [wild soybean]
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1           55.8    2e-07   Vitis vinifera
gb|KJB34507.1|  hypothetical protein B456_006G069600                  55.8    2e-07   Gossypium raimondii
gb|KDP23643.1|  hypothetical protein JCGZ_23476                       55.8    2e-07   Jatropha curcas
ref|NP_001241005.1|  uncharacterized protein LOC100805519             55.8    2e-07   Glycine max [soybeans]
gb|ACU18272.1|  unknown                                               55.5    2e-07   Glycine max [soybeans]
gb|ACJ85751.1|  unknown                                               55.5    2e-07   Medicago truncatula
dbj|BAC10914.1|  putative 40S ribosomal protein S3A                   53.1    2e-07   Zinnia elegans [garden zinnia]
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g           55.5    2e-07   Phaseolus vulgaris [French bean]
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a             55.5    2e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH32959.1|  40S ribosomal protein S3a-1                           55.1    2e-07   Medicago truncatula
ref|NP_001265990.1|  40S ribosomal protein S3a                        55.1    2e-07   Cicer arietinum [garbanzo]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like        55.1    2e-07   Nelumbo nucifera [Indian lotus]
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein           55.1    3e-07   Solanum tuberosum [potatoes]
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160        55.1    3e-07   Amborella trichopoda
ref|XP_009406018.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  54.7    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like        55.1    3e-07   Cicer arietinum [garbanzo]
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g           55.1    3e-07   Phaseolus vulgaris [French bean]
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  55.1    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a             55.1    3e-07   Solanum lycopersicum
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like      54.7    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  54.7    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1           54.7    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  54.7    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275123.1|  cyc07-like protein                               54.7    4e-07   Solanum tuberosum [potatoes]
gb|ABB55362.1|  cyc07-like                                            54.7    4e-07   Solanum tuberosum [potatoes]
ref|NP_001274913.1|  40S ribosomal protein S3a-like                   54.7    4e-07   Solanum tuberosum [potatoes]
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a             54.7    4e-07   Solanum lycopersicum
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like        54.7    4e-07   Elaeis guineensis
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like      54.7    4e-07   Populus euphratica
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a             54.7    4e-07   Elaeis guineensis
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a             54.7    4e-07   Cucumis melo [Oriental melon]
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like        54.7    4e-07   Cucumis sativus [cucumbers]
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like        54.7    4e-07   Eucalyptus grandis [rose gum]
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                54.7    4e-07   Elaeis guineensis
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a             54.3    5e-07   Fragaria vesca subsp. vesca
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g           54.3    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2           54.3    5e-07   Populus euphratica
ref|XP_002517085.1|  40S ribosomal protein S3a, putative              54.3    6e-07   Ricinus communis
ref|XP_002314671.2|  ribosomal protein S3a                            54.3    6e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a             53.9    6e-07   Solanum lycopersicum
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...  53.9    7e-07   Volvox carteri f. nagariensis
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...  53.9    7e-07   Chlamydomonas reinhardtii
gb|KHG19561.1|  40S ribosomal S3a                                     53.9    7e-07   Gossypium arboreum [tree cotton]
ref|XP_002312545.2|  ribosomal protein S3a                            53.9    7e-07   
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...  53.5    9e-07   Daucus carota [carrots]
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  53.5    9e-07   Phoenix dactylifera
gb|EPY50727.1|  40S ribosomal protein S3a                             53.5    1e-06   Schizosaccharomyces cryophilus OY26
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a             53.5    1e-06   Phoenix dactylifera
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  53.5    1e-06   Nicotiana tomentosiformis
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg              53.5    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a             53.5    1e-06   Nicotiana sylvestris
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like        53.5    1e-06   Nicotiana sylvestris
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  53.5    1e-06   Nicotiana tomentosiformis
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  53.5    1e-06   Nicotiana tomentosiformis
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a             53.5    1e-06   Eucalyptus grandis [rose gum]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2           53.1    1e-06   Fragaria vesca subsp. vesca
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g           53.1    1e-06   Phaseolus vulgaris [French bean]
gb|EPS65103.1|  hypothetical protein M569_09676                       52.0    1e-06   Genlisea aurea
gb|EPX74608.1|  40S ribosomal protein S3a                             53.1    1e-06   Schizosaccharomyces octosporus yFS286
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like        53.1    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like        53.1    1e-06   Cucumis melo [Oriental melon]
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like        53.1    1e-06   
gb|ABK24527.1|  unknown                                               51.6    2e-06   Picea sitchensis
gb|KIY97031.1|  small subunit ribosomal protein S3Ae                  52.0    2e-06   Monoraphidium neglectum
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                  53.1    2e-06   
emb|CDY30019.1|  BnaC01g39890D                                        53.1    2e-06   Brassica napus [oilseed rape]
gb|ACN40078.1|  unknown                                               52.4    2e-06   Picea sitchensis
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...  52.4    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR37738.1|  unknown                                               51.2    3e-06   Zea mays [maize]
ref|NP_187135.1|  40S ribosomal protein S3a-1                         52.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg           52.4    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...  52.4    3e-06   Setaria italica
ref|XP_002882377.1|  40S ribosomal protein S3A                        52.4    3e-06   
gb|AFW89326.1|  hypothetical protein ZEAMMB73_166147                  50.1    3e-06   
gb|AFW89330.1|  40S ribosomal protein S3a                             52.8    3e-06   
gb|AFW89335.1|  40S ribosomal protein S3a                             52.8    3e-06   
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg           52.4    3e-06   Capsella rubella
gb|ABK56834.1|  RPS3                                                  52.4    3e-06   Cymbidium hybrid cultivar
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg           53.5    3e-06   
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg              53.5    3e-06   Erythranthe guttata [common monkey flower]
tpg|DAA43947.1|  TPA: hypothetical protein ZEAMMB73_528269            50.8    3e-06   
gb|ACG33267.1|  40S ribosomal protein S3a                             52.0    3e-06   Zea mays [maize]
ref|NP_001152574.1|  40S ribosomal protein S3a                        52.0    3e-06   Zea mays [maize]
ref|NP_001149096.1|  40S ribosomal protein S3a                        52.0    3e-06   Zea mays [maize]
gb|ACG34058.1|  40S ribosomal protein S3a                             52.0    3e-06   Zea mays [maize]
ref|NP_001141038.1|  hypothetical protein                             52.0    3e-06   Zea mays [maize]
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg           52.0    4e-06   Capsella rubella
ref|NP_001288829.1|  40S ribosomal protein S3a                        52.0    4e-06   Brassica rapa
gb|AGT16352.1|  40S ribosomal protein S3a                             52.0    4e-06   Saccharum hybrid cultivar R570
gb|KIY97642.1|  small subunit ribosomal protein S3Ae                  52.0    4e-06   Monoraphidium neglectum
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570        51.6    4e-06   
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...  52.0    5e-06   
gb|AGE93851.1|  40S ribosomal protein S3a                             48.9    5e-06   Posidonia oceanica
gb|EPY52698.1|  40S ribosomal protein S3a                             51.2    6e-06   Schizosaccharomyces cryophilus OY26
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2           51.2    6e-06   Tarenaya hassleriana [spider flower]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like      51.2    7e-06   Pyrus x bretschneideri [bai li]
ref|NP_001066631.1|  Os12g0406200                                     51.2    7e-06   
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370        51.2    7e-06   Sorghum bicolor [broomcorn]
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like      51.2    7e-06   Malus domestica [apple tree]
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like      51.2    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like      51.2    7e-06   Malus domestica [apple tree]
gb|KHN21710.1|  40S ribosomal protein S3a                             51.6    7e-06   Glycine soja [wild soybean]
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365        51.2    7e-06   Sorghum bicolor [broomcorn]
emb|CDY17474.1|  BnaC03g65890D                                        50.8    7e-06   Brassica napus [oilseed rape]
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                  51.2    7e-06   Arabis alpina [alpine rockcress]
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like      51.2    8e-06   Brassica rapa
emb|CDY40680.1|  BnaC03g33960D                                        51.2    8e-06   Brassica napus [oilseed rape]
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a             51.2    8e-06   Populus euphratica
ref|XP_006382773.1|  40S ribosomal protein S3A                        50.8    8e-06   Populus trichocarpa [western balsam poplar]
emb|CDY21109.1|  BnaA01g33400D                                        50.8    8e-06   Brassica napus [oilseed rape]
emb|CDX76296.1|  BnaA08g11040D                                        50.8    8e-06   
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg           50.8    9e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like      50.8    9e-06   Brassica rapa
gb|ABK93399.1|  unknown                                               50.8    9e-06   Populus trichocarpa [western balsam poplar]
emb|CDX74165.1|  BnaA03g28820D                                        50.8    9e-06   
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like      50.8    9e-06   Brassica rapa
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2           50.8    9e-06   Brassica rapa
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like        50.8    9e-06   Oryza brachyantha
gb|AFK33413.1|  unknown                                               50.8    9e-06   Lotus japonicus
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like        50.8    9e-06   Oryza brachyantha
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like        50.8    9e-06   Glycine max [soybeans]
ref|XP_002512232.1|  40S ribosomal protein S3a, putative              50.8    9e-06   Ricinus communis
emb|CDX75453.1|  BnaA01g02490D                                        50.8    9e-06   
emb|CDY50760.1|  BnaAnng10670D                                        50.8    9e-06   Brassica napus [oilseed rape]
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like        50.8    9e-06   Oryza brachyantha
ref|XP_002869131.1|  40S ribosomal protein S3A                        50.8    1e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a             50.8    1e-05   Prunus mume [ume]
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like      50.8    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like      50.8    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2           50.8    1e-05   Brassica rapa
emb|CDX69078.1|  BnaC01g03750D                                        50.8    1e-05   
ref|XP_002505259.1|  predicted protein                                50.8    1e-05   Micromonas commoda
ref|NP_195193.1|  40S ribosomal protein S3a-2                         50.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...  50.4    1e-05   Ostreococcus lucimarinus CCE9901
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like        50.4    1e-05   Setaria italica
ref|NP_001049289.1|  Os03g0200500                                     50.4    1e-05   
ref|XP_002958995.1|  hypothetical protein VOLCADRAFT_70175            48.1    1e-05   Volvox carteri f. nagariensis
ref|XP_005650618.1|  ribosomal protein S3Ae                           50.4    1e-05   Coccomyxa subellipsoidea C-169
gb|KDD76342.1|  ribosomal protein S3Ae                                50.4    1e-05   Helicosporidium sp. ATCC 50920
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like      50.4    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_002172001.1|  40S ribosomal protein S3a                        50.4    1e-05   Schizosaccharomyces japonicus yFS275
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                  50.4    1e-05   Arabis alpina [alpine rockcress]
ref|XP_003336191.1|  40S ribosomal protein S1                         50.1    2e-05   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like      50.1    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_001765908.1|  predicted protein                                50.1    2e-05   
gb|EPX72723.1|  40S ribosomal protein S3a                             50.1    2e-05   Schizosaccharomyces octosporus yFS286
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                 50.1    2e-05   Gelatoporia subvermispora B
ref|XP_007302916.1|  S-phase-specific ribosomal protein cyc07         50.1    2e-05   Stereum hirsutum FP-91666 SS1
ref|XP_007392195.1|  hypothetical protein PHACADRAFT_250267           50.1    2e-05   Phanerochaete carnosa HHB-10118-sp
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1           50.1    2e-05   Camelina sativa [gold-of-pleasure]
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                 50.1    2e-05   Gymnopus luxurians FD-317 M1
gb|EUC65367.1|  40s ribosomal protein s3ae                            50.1    2e-05   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like      50.1    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002619798.1|  40S ribosomal protein S3aE                       50.1    2e-05   Clavispora lusitaniae ATCC 42720
gb|KII94785.1|  hypothetical protein PLICRDRAFT_33595                 50.1    2e-05   Plicaturopsis crispa FD-325 SS-3
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07         50.1    2e-05   Punctularia strigosozonata HHB-11173 SS5
dbj|BAA87298.1|  40s ribosomal protein RP10                           47.8    2e-05   Schizosaccharomyces pombe
ref|XP_007409874.1|  hypothetical protein MELLADRAFT_43398            50.1    2e-05   Melampsora larici-populina 98AG31
ref|XP_002618019.1|  40S ribosomal protein S3aE                       50.1    2e-05   Clavispora lusitaniae ATCC 42720
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...  50.1    2e-05   Lentinula edodes
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2           50.1    2e-05   Camelina sativa [gold-of-pleasure]
gb|KJA29982.1|  hypothetical protein HYPSUDRAFT_81601                 49.7    2e-05   Hypholoma sublateritium FD-334 SS-4
gb|KIK06774.1|  hypothetical protein K443DRAFT_674057                 49.7    2e-05   Laccaria amethystina LaAM-08-1
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like      49.7    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002387295.1|  hypothetical protein MPER_14061                  47.4    2e-05   
ref|XP_007862325.1|  40S ribosomal protein S1                         49.7    2e-05   Gloeophyllum trabeum ATCC 11539
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like      49.7    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDO74072.1|  hypothetical protein BN946_scf185043.g122            49.7    2e-05   Trametes cinnabarina
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like        49.7    2e-05   Oryza brachyantha
gb|KDQ64848.1|  hypothetical protein JAAARDRAFT_28494                 49.7    2e-05   Jaapia argillacea MUCL 33604
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1        49.7    2e-05   Laccaria bicolor S238N-H82
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                 49.7    2e-05   Hebeloma cylindrosporum h7
emb|CCM04869.1|  predicted protein                                    49.7    2e-05   Fibroporia radiculosa
ref|XP_007338149.1|  40S ribosomal protein S1                         49.7    2e-05   
ref|XP_002475466.1|  40S ribosomal protein S3A                        49.7    3e-05   
ref|XP_007843081.1|  40s ribosomal protein s3ae                       49.7    3e-05   
ref|XP_001777314.1|  predicted protein                                49.7    3e-05   
gb|KFH70745.1|  40S ribosomal protein S1                              49.7    3e-05   Mortierella verticillata NRRL 6337
emb|CDS03716.1|  Putative 40S ribosomal protein S1                    49.7    3e-05   Lichtheimia ramosa
ref|XP_001774632.1|  predicted protein                                49.7    3e-05   
ref|XP_008035602.1|  40S ribosomal protein S1                         49.3    3e-05   Trametes versicolor FP-101664 SS1
gb|EEC69140.1|  hypothetical protein OsI_38068                        50.8    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_001837102.1|  40S ribosomal protein S1                         49.3    3e-05   Coprinopsis cinerea okayama7#130
gb|ACZ59453.1|  hypothetical protein                                  48.9    3e-05   Pleurotus ostreatus [shimeji]
emb|CCO27311.1|  40S ribosomal protein S1 AltName: Full=Protein c...  49.3    3e-05   Rhizoctonia solani AG-1 IB
ref|XP_001755439.1|  predicted protein                                49.3    3e-05   
emb|CEG00819.1|  Ribosomal protein S3Ae                               49.3    3e-05   Ostreococcus tauri
ref|NP_592828.1|  40S ribosomal protein S1                            49.3    3e-05   Schizosaccharomyces pombe
ref|XP_003680888.1|  40S ribosomal protein S1                         49.3    4e-05   Torulaspora delbrueckii
ref|XP_007329524.1|  hypothetical protein AGABI1DRAFT_106559          49.3    4e-05   Agaricus bisporus var. burnettii JB137-S8
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                   49.3    4e-05   Trichosporon asahii var. asahii CBS 2479
ref|XP_007377291.1|  hypothetical protein SPAPADRAFT_143639           49.3    4e-05   Spathaspora passalidarum NRRL Y-27907
ref|NP_001046578.1|  Os02g0287000                                     49.3    4e-05   
emb|CDR40922.1|  RHTO0S05e08922g1_1                                   49.3    4e-05   Rhodotorula toruloides
gb|KIP10648.1|  hypothetical protein PHLGIDRAFT_84595                 49.3    4e-05   Phlebiopsis gigantea 11061_1 CR5-6
gb|EPB82263.1|  30S ribosomal protein S3Ae                            49.3    4e-05   Mucor circinelloides f. circinelloides 1006PhL
gb|EEE53089.1|  hypothetical protein OsJ_35850                        50.4    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EIE78641.1|  40S ribosomal protein S1                              49.3    4e-05   Rhizopus delemar RA 99-880
emb|CEG72228.1|  Putative 40S ribosomal protein S1                    49.3    4e-05   Rhizopus microsporus
emb|CEI91945.1|  Putative 40S ribosomal protein S1                    48.9    4e-05   Rhizopus microsporus
emb|CEG72481.1|  Putative 40S ribosomal protein S1                    48.9    4e-05   Rhizopus microsporus
gb|AAC98779.1|  S-phase-specific ribosomal protein                    48.9    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001765967.1|  predicted protein                                48.9    4e-05   
emb|CDS09424.1|  Putative 40S ribosomal protein S1                    48.9    4e-05   Lichtheimia ramosa
emb|CEG70959.1|  Putative 40S ribosomal protein S1                    48.9    4e-05   Rhizopus microsporus
emb|CEP07976.1|  hypothetical protein                                 49.3    5e-05   Parasitella parasitica
emb|CDH60302.1|  40s ribosomal protein s1                             48.9    5e-05   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001767326.1|  predicted protein                                48.9    5e-05   
gb|KDQ29255.1|  hypothetical protein PLEOSDRAFT_1089059               48.9    5e-05   Pleurotus ostreatus PC15
ref|XP_001774288.1|  predicted protein                                48.9    5e-05   
ref|XP_007364341.1|  40S ribosomal protein S1                         48.9    5e-05   Dichomitus squalens LYAD-421 SS1
emb|CCJ30410.1|  unnamed protein product                              47.4    5e-05   Pneumocystis jirovecii
ref|XP_006684746.1|  ribosomal protein S3Ae                           48.5    5e-05   Yamadazyma tenuis ATCC 10573
gb|EHN01046.1|  Rps1ap                                                48.9    5e-05   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_007874563.1|  hypothetical protein PNEG_02550                  48.5    5e-05   Pneumocystis murina B123
ref|XP_001761018.1|  predicted protein                                48.9    5e-05   
ref|XP_001911292.1|  hypothetical protein                             48.5    6e-05   Podospora anserina S mat+
ref|XP_002173730.1|  40S ribosomal protein S3a                        48.5    6e-05   Schizosaccharomyces japonicus yFS275
ref|XP_001385778.1|  40S ribosomal protein S1                         48.5    6e-05   Scheffersomyces stipitis CBS 6054
emb|CBX25071.1|  40S ribosomal protein S3a                            48.5    6e-05   Polytomella sp. Pringsheim 198.80
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801               48.5    6e-05   Scleroderma citrinum Foug A
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                48.5    6e-05   Pisolithus microcarpus 441
ref|XP_001633847.1|  predicted protein                                48.5    6e-05   Nematostella vectensis
gb|KIO12878.1|  hypothetical protein M404DRAFT_699665                 48.5    6e-05   Pisolithus tinctorius Marx 270
ref|XP_011395666.1|  40S ribosomal protein S3a                        48.5    6e-05   Auxenochlorella protothecoides
ref|XP_002553413.1|  40S ribosomal protein S1                         48.5    6e-05   Lachancea thermotolerans CBS 6340
emb|CEJ94564.1|  Putative 40S ribosomal protein S1                    48.5    7e-05   Torrubiella hemipterigena
emb|CDP25519.1|  Putative cytosolic 40S ribosomal protein Rps3a       48.5    7e-05   Podospora anserina S mat+
ref|XP_003644224.1|  hypothetical protein Ecym_1156                   48.5    7e-05   Eremothecium cymbalariae DBVPG#7215
gb|AGO12478.1|  AaceriAER131Cp                                        48.5    7e-05   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_002838347.1|  40S ribosomal protein S1                         48.1    7e-05   Tuber melanosporum Mel28
ref|NP_984990.1|  40S ribosomal protein S1                            48.1    7e-05   Eremothecium gossypii ATCC 10895
gb|KIJ20179.1|  hypothetical protein PAXINDRAFT_166304                48.1    8e-05   Paxillus involutus ATCC 200175
ref|XP_009544052.1|  hypothetical protein HETIRDRAFT_458158           48.1    8e-05   Heterobasidion irregulare TC 32-1
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295           48.1    8e-05   Serpula lacrymans var. lacrymans S7.9
ref|XP_006682437.1|  hypothetical protein BATDEDRAFT_33774            48.1    8e-05   Batrachochytrium dendrobatidis JAM81
gb|KIJ56726.1|  hypothetical protein M422DRAFT_72882                  48.1    8e-05   Sphaerobolus stellatus SS14
ref|XP_007004007.1|  hypothetical protein TREMEDRAFT_43796            48.1    9e-05   Tremella mesenterica DSM 1558
dbj|BAJ93929.1|  predicted protein                                    48.1    9e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIJ70171.1|  hypothetical protein HYDPIDRAFT_104846                48.1    9e-05   Hydnomerulius pinastri MD-312
gb|KEZ40245.1|  hypothetical protein SAPIO_CDS8739                    48.1    1e-04   
ref|XP_009520284.1|  hypothetical protein PHYSODRAFT_285013           48.1    1e-04   
ref|XP_007819839.1|  Ribosomal protein S3Ae                           47.8    1e-04   
gb|AGH70187.1|  40S ribosomal protein S3a                             47.8    1e-04   
ref|XP_003191240.1|  40s ribosomal protein s3ae-a (s1-a)              47.8    1e-04   
gb|EEE56753.1|  hypothetical protein OsJ_06287                        48.5    1e-04   
emb|CEP61669.1|  LALA0S03e08130g1_1                                   47.8    1e-04   
ref|XP_001384696.1|  40S ribosomal protein S1                         47.8    1e-04   
gb|AFR93504.1|  small subunit ribosomal protein S1                    47.8    1e-04   
gb|ESW97497.1|  40S ribosomal protein S1                              47.8    1e-04   
gb|KGB79628.1|  40S ribosomal protein S3ae-a                          47.8    1e-04   
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                 47.8    1e-04   
ref|XP_449381.1|  40S ribosomal protein S1                            47.8    1e-04   
ref|XP_004211786.1|  PREDICTED: 40S ribosomal protein S3a-like        47.8    1e-04   
ref|XP_460779.1|  40S ribosomal protein S1                            47.8    1e-04   
sp|Q4KTD9.1|RS3A_SUBDO  RecName: Full=40S ribosomal protein S3a       47.8    1e-04   
gb|AAP80855.1|  cyc07                                                 47.4    1e-04   
ref|XP_721500.1|  cytosolic ribosomal protein S1 (rp10)               47.8    1e-04   
gb|EMG46719.1|  40S ribosomal protein S1                              47.8    1e-04   
emb|CCE40991.1|  hypothetical protein CPAR2_110290                    47.8    1e-04   
ref|XP_002550047.1|  40S ribosomal protein S3aE                       47.8    1e-04   
ref|XP_007767741.1|  ribosomal protein S3Ae                           47.8    1e-04   
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a       47.4    1e-04   
emb|CCX31922.1|  Similar to 40S ribosomal protein S1; acc. no. C7...  47.8    1e-04   
sp|Q2GW51.2|RS3A_CHAGB  RecName: Full=40S ribosomal protein S1        47.4    1e-04   
ref|XP_004181039.1|  hypothetical protein TBLA_0E04680                47.4    1e-04   
ref|XP_007268611.1|  40S ribosomal protein S1                         47.4    1e-04   
ref|XP_007372173.1|  cytosolic ribosomal protein S1                   47.4    1e-04   
ref|XP_003868273.1|  Rps1 ribosomal protein 10 of the 40S subunit     47.4    1e-04   
gb|KDE09348.1|  40S ribosomal protein S1                              47.4    1e-04   
emb|CCE34351.1|  probable ribosomal protein 10, cytosolic             47.4    1e-04   
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                 47.4    2e-04   
gb|KIY51600.1|  ribosomal protein S3Ae                                47.4    2e-04   
gb|ADD84599.1|  40S ribosomal protein S3AE                            47.4    2e-04   
gb|AAX07667.1|  40S ribosomal protein S1-like protein                 47.4    2e-04   
ref|XP_003709655.1|  40S ribosomal protein S3aE                       47.4    2e-04   
ref|NP_593116.1|  40S ribosomal protein S1                            47.4    2e-04   
ref|XP_007727460.1|  40S ribosomal protein S1                         47.4    2e-04   
ref|XP_568980.1|  40s ribosomal protein s3ae-a (s1-a)                 47.4    2e-04   
gb|KIY73683.1|  putative S-phase-specific ribosomal protein cyc07     47.4    2e-04   
ref|XP_458876.1|  40S ribosomal protein S1                            47.4    2e-04   
emb|CCG82073.1|  40S ribosomal protein S3a                            47.4    2e-04   
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660        47.4    2e-04   
emb|CAA57542.1|  ribosomal protein 10                                 47.4    2e-04   
ref|XP_001598109.1|  40S ribosomal protein S1                         47.4    2e-04   
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906           47.4    2e-04   
ref|XP_002116071.1|  expressed hypothetical protein                   47.4    2e-04   
ref|XP_001555389.1|  40S ribosomal protein S1                         47.0    2e-04   
ref|XP_003349668.1|  40S ribosomal protein S1                         47.0    2e-04   
ref|XP_955974.2|  40S ribosomal protein S1                            47.0    2e-04   
ref|XP_002493957.1|  40S ribosomal protein S1                         47.0    2e-04   
ref|XP_008900376.1|  40S ribosomal protein S3a                        47.0    2e-04   
ref|XP_009658314.1|  40S ribosomal protein S3a-2                      47.0    2e-04   
ref|XP_007283244.1|  40s ribosomal protein s3ae                       47.0    2e-04   
ref|XP_007731752.1|  40S ribosomal protein S1                         47.0    2e-04   
ref|XP_011272400.1|  hypothetical protein BN7_5334                    47.0    2e-04   
gb|EJT97646.1|  40S ribosomal protein S1                              47.0    2e-04   
gb|EHN05747.1|  Rps1ap                                                47.0    2e-04   
ref|XP_002901276.1|  40S ribosomal protein S3a                        47.0    2e-04   
ref|XP_009260836.1|  hypothetical protein FPSE_09444                  47.0    2e-04   
emb|CDH53546.1|  40s ribosomal protein s1                             47.4    2e-04   
ref|NP_013546.1|  ribosomal 40S subunit protein S1A                   47.0    3e-04   
ref|XP_011104678.1|  rps1ap                                           47.0    3e-04   
emb|CAY81665.1|  Rps1ap                                               47.0    3e-04   
ref|XP_505043.2|  40S ribosomal protein S1                            47.0    3e-04   
ref|XP_006693334.1|  hypothetical protein CTHT_0028780                47.0    3e-04   
gb|EGA77599.1|  Rps1ap                                                47.0    3e-04   
ref|XP_011273931.1|  hypothetical protein BN7_3788                    47.0    3e-04   
ref|XP_008600583.1|  ribosomal S3Ae family protein                    46.6    3e-04   
ref|XP_007838879.1|  40S ribosomal protein S1                         46.6    3e-04   
gb|EGA81616.1|  Rps1ap                                                46.6    3e-04   
emb|CCK70651.1|  hypothetical protein KNAG_0E03980                    46.6    3e-04   
gb|EIF47090.1|  40s ribosomal protein s3ae                            46.6    3e-04   
ref|XP_005771392.1|  hypothetical protein EMIHUDRAFT_316252           46.6    3e-04   
ref|XP_004196831.1|  Piso0_004057                                     46.6    3e-04   
ref|XP_003008322.1|  40S ribosomal protein S1                         46.6    3e-04   
ref|XP_003684155.1|  40S ribosomal protein S1                         46.6    3e-04   
ref|XP_003957703.1|  hypothetical protein KAFR_0E04170                46.6    3e-04   
ref|XP_001643958.1|  hypothetical protein Kpol_1001p12                46.6    3e-04   
gb|KGK38697.1|  hypothetical protein JL09_g2138                       46.6    3e-04   
ref|XP_003958956.1|  hypothetical protein KAFR_0I00400                46.6    3e-04   
ref|XP_007919074.1|  putative 40s ribosomal protein s3ae protein      46.6    3e-04   
emb|CCK69086.1|  hypothetical protein KNAG_0B06590                    46.6    3e-04   
emb|CCF42444.1|  40S ribosomal protein S1                             46.2    3e-04   
gb|KIM94998.1|  hypothetical protein OIDMADRAFT_21260                 46.6    3e-04   
ref|XP_009222255.1|  40S ribosomal protein S3aE                       46.6    3e-04   
emb|CCQ18660.1|  40S ribosomal protein S3A                            46.6    3e-04   
gb|EGU87266.1|  hypothetical protein FOXB_02248                       46.6    3e-04   
ref|XP_007291650.1|  40S ribosomal protein S3                         46.6    3e-04   
gb|EFQ28170.1|  ribosomal S3Ae family protein                         46.6    3e-04   
gb|KEY66556.1|  hypothetical protein S7711_08060                      46.6    4e-04   
gb|KHJ33456.1|  putative 40s ribosomal protein s1                     46.6    4e-04   
ref|XP_011104733.1|  rps1bp                                           46.2    4e-04   
ref|XP_003669860.1|  ribosomal protein S1                             46.2    4e-04   
ref|NP_013648.1|  ribosomal 40S subunit protein S1B                   46.2    4e-04   
sp|C7GVZ9.1|RS3A2_YEAS2  RecName: Full=40S ribosomal protein S1-B     46.2    4e-04   
ref|XP_009827334.1|  hypothetical protein H257_04494                  46.2    4e-04   
gb|EWG89250.1|  Rps1bp                                                46.2    4e-04   
emb|CCA67212.1|  probable ribosomal protein 10, cytosolic             46.2    4e-04   
ref|XP_002495559.1|  40S ribosomal protein S1                         46.2    4e-04   
ref|XP_003661611.1|  hypothetical protein MYCTH_2314609               46.2    4e-04   
dbj|GAA97694.1|  hypothetical protein E5Q_04372                       46.2    4e-04   
ref|XP_008872125.1|  hypothetical protein H310_08228                  46.2    4e-04   
gb|EHN00942.1|  Rps1bp                                                46.2    4e-04   
gb|EHK15137.1|  hypothetical protein TRIVIDRAFT_83608                 46.2    4e-04   
ref|XP_003050314.1|  40S ribosomal protein S1                         46.2    4e-04   
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843            46.2    4e-04   
gb|KFY76180.1|  hypothetical protein V498_09734                       46.2    4e-04   
gb|KFY15252.1|  hypothetical protein V492_02139                       46.2    4e-04   
gb|ELR10454.1|  40S ribosomal protein S1                              46.2    4e-04   
ref|XP_006967667.1|  hypothetical protein TRIREDRAFT_80484            46.2    4e-04   
gb|EGA61079.1|  Rps1bp                                                46.2    4e-04   
gb|KIM90711.1|  hypothetical protein PILCRDRAFT_811171                46.2    4e-04   
gb|KDO28449.1|  40S ribosomal protein S3a-2                           46.2    4e-04   
gb|KIM33406.1|  hypothetical protein M408DRAFT_153936                 46.2    4e-04   
ref|XP_008619762.1|  40S ribosomal protein S3a-2                      46.2    5e-04   
gb|EMT64937.1|  40S ribosomal protein S1                              45.8    5e-04   
gb|KFH46285.1|  40S ribosomal protein S1-like protein                 46.2    5e-04   
gb|EHK49744.1|  hypothetical protein TRIATDRAFT_297633                46.2    5e-04   
ref|XP_004196691.1|  Piso0_003916                                     46.2    5e-04   
ref|XP_003673547.1|  hypothetical protein NCAS_0A06060                46.2    5e-04   
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887           46.2    5e-04   
gb|EMS66737.1|  40S ribosomal protein S3a                             46.2    5e-04   
ref|XP_004349214.1|  ribosomal protein S3a                            45.8    5e-04   
gb|KIV90937.1|  40S ribosomal protein S1                              45.8    6e-04   
ref|XP_007798981.1|  putative 40s ribosomal protein s3ae protein      45.8    6e-04   
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like        45.8    6e-04   
gb|AFW89334.1|  hypothetical protein ZEAMMB73_166147                  43.9    7e-04   
emb|CDJ64179.1|  40S ribosomal protein S3A, putative                  45.8    7e-04   
gb|AET50824.1|  hypothetical protein                                  45.8    7e-04   
gb|KFY25487.1|  hypothetical protein V493_04626                       46.2    7e-04   
ref|XP_003883511.1|  hypothetical protein NCLIV_032660                45.4    8e-04   
gb|KFY04868.1|  hypothetical protein O988_00467                       46.2    8e-04   
gb|KFX90221.1|  hypothetical protein V490_06574                       46.2    8e-04   
ref|XP_005760601.1|  hypothetical protein EMIHUDRAFT_438398           45.4    8e-04   
ref|XP_002368140.1|  40S ribosomal protein S3a, putative              45.4    8e-04   
gb|ABW90413.1|  putative ribosomal protein S3a                        45.4    8e-04   
gb|KIW17256.1|  40S ribosomal protein S1                              45.4    8e-04   
ref|XP_001093267.2|  PREDICTED: 40S ribosomal protein S3a-like        43.9    8e-04   
emb|CDO92241.1|  unnamed protein product                              45.4    9e-04   
emb|CDF91461.1|  ZYBA0S11-03378g1_1                                   45.4    9e-04   
ref|XP_451759.1|  40S ribosomal protein S1                            45.4    9e-04   
dbj|BAO40824.1|  40S ribosomal protein S1                             45.1    0.001   
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a             45.4    0.001   
ref|XP_003038024.1|  40S ribosomal protein S1                         45.1    0.001   
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like        45.1    0.001   



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score = 55.8 bits (133),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB28384.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=230

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB28383.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=225

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>dbj|BAC10914.1| putative 40S ribosomal protein S3A [Zinnia elegans]
Length=66

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA+DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKASDPFAKKDWYDIKAPS  36



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            M VG NKRISKGKKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MVVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_009406018.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=241

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKATDPFAKKDWYDIKAPS  36



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKATDPFAKKDWYDIKAPS  36



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKAPS  36



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFTKKDWYDIKAPS  36



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA+DPFAKKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKASDPFAKKDWYDIKAPT  36



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA+DPFAKKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKASDPFAKKDWYDIKAPT  36



>gb|KHG19561.1| 40S ribosomal S3a [Gossypium arboreum]
Length=245

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWY+IKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYNIKAPS  36



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYDIKAPS  36



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKATDPFAKKDWYDIKAPN  36



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFSKKDWYDIKAPS  36



>gb|EPY50727.1| 40S ribosomal protein S3a [Schizosaccharomyces cryophilus OY26]
Length=253

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +A DPFA+KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKRAVDPFARKDWYDIKAPS  36



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFSKKDWYDIKAPS  36



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDVKAPS  36



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADP+AKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPYAKKDWYDIKAPS  36



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFSKKDWYDIKAPS  36



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPFAKKDWYD+ APS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFAKKDWYDVTAPS  36



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKATDPFTKKDWYDIKAPS  36



>gb|EPS65103.1| hypothetical protein M569_09676, partial [Genlisea aurea]
Length=165

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF+KKDWYD+KAPS
Sbjct  3    MAVGKNKRISKGKKGGKKKAVDPFSKKDWYDVKAPS  38



>gb|EPX74608.1| 40S ribosomal protein S3a [Schizosaccharomyces octosporus yFS286]
Length=253

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +A DPFA+KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKRAVDPFARKDWYDIKAPS  36



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYDIK PS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDIKVPS  36



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFAKKDWYDIKAPS  36



>gb|ABK24527.1| unknown [Picea sitchensis]
Length=165

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFTKKDWYDVKAPS  36



>gb|KIY97031.1| small subunit ribosomal protein S3Ae [Monoraphidium neglectum]
Length=199

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFSKKDWYDVKAPS  36



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   TMAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            TMAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  70   TMAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  106



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   TMAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            TMAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  41   TMAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  77



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFTKKDWYDVKAPS  36



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>gb|ACR37738.1| unknown [Zea mays]
 gb|AFW89327.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=175

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPS  36



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPS  36



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPS  36



>gb|AFW89326.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=83

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   TMAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            TMAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  70   TMAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  106



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   TMAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            TMAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  72   TMAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  108



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPS  36



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   TMAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            TMAVG NKRISK KKGG  KAADPFAKKDWYDIKAPS
Sbjct  369  TMAVGKNKRISKSKKGGKKKAADPFAKKDWYDIKAPS  405



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPFAKKDWYD+KAPS
Sbjct  389  MAVGKNKRISKGKKGGKKKAVDPFAKKDWYDVKAPS  424



>tpg|DAA43947.1| TPA: hypothetical protein ZEAMMB73_528269, partial [Zea mays]
Length=188

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPS  36



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFAKKDWYDIKAPS  36



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>gb|KIY97642.1| small subunit ribosomal protein S3Ae [Monoraphidium neglectum]
Length=280

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFSKKDWYDVKAPS  36



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFAKKDWYDIKAPS  36



>gb|AGE93851.1| 40S ribosomal protein S3a, partial [Posidonia oceanica]
Length=46

 Score = 48.9 bits (115),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISK KKGG  KA DPF KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKAKKGGKKKAVDPFTKKDWYDIKAPS  36



>gb|EPY52698.1| 40S ribosomal protein S3a [Schizosaccharomyces cryophilus OY26]
Length=252

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +A DPFA+KDWY+IKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKRAVDPFARKDWYEIKAPS  36



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKVVDPFSKKDWYDIKAPS  36



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAP  196
            MAVG NKRISK KKGG  KA DPFAKKDWYDIKAP
Sbjct  1    MAVGKNKRISKSKKGGKKKAVDPFAKKDWYDIKAP  35



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAP  196
            MAVG NKRISK KKGG  KA DPFAKKDWYDIKAP
Sbjct  1    MAVGKNKRISKSKKGGKKKAVDPFAKKDWYDIKAP  35



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKVVDPFSKKDWYDIKAPS  36



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAP  196
            MAVG NKRISK KKGG  KA DPFAKKDWYDIKAP
Sbjct  1    MAVGKNKRISKSKKGGKKKAVDPFAKKDWYDIKAP  35



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISK KKGG  KAADPF KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKAKKGGKKKAADPFTKKDWYDIKAPS  36



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPS  36



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWY +KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYVVKAPS  36



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWY +KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYVVKAPS  36



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAP+
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPA  36



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KAADPF+KKDWY +KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAADPFSKKDWYVVKAPS  36



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKAADPFAKKDWYDIKAPS  36



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISK KK G  KAADPF KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKAKKVGKKKAADPFTKKDWYDIKAPS  36



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKAADPFAKKDWYDIKAPS  36



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAP+
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPA  36



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISK KKGG  KAADPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKSKKGGKKKAADPFAKKDWYDIKAPS  36



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_002505259.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66517.1| predicted protein [Micromonas sp. RCC299]
Length=263

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  KA DPF KK+WYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKAVDPFLKKEWYDIKAPS  36



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAP  196
            MAVG NKRISKG+KGG  KA DPF+KKDWYD+KAP
Sbjct  1    MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAP  35



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKGG  KA DPF KKDWYDIKAPS
Sbjct  1    MAVGKNKRMSKGKKGGKKKAVDPFTKKDWYDIKAPS  36



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISK KKGG  K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKSKKGGKKKTVDPFAKKDWYDIKAPS  36



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_002958995.1| hypothetical protein VOLCADRAFT_70175 [Volvox carteri f. nagariensis]
 gb|ADI46818.1| RPS3A2f [Volvox carteri f. nagariensis]
 gb|EFJ39943.1| hypothetical protein VOLCADRAFT_70175 [Volvox carteri f. nagariensis]
Length=57

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            M +G NKRISKGKKGG  KA+DPF KKDWYDIKAP+
Sbjct  1    MNLGKNKRISKGKKGGKKKASDPFTKKDWYDIKAPT  36



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGKKGGKKKVVDPFSKKDWYDVKAPS  36



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKGG  K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGGKKKIVDPFSKKDWYDIKAPS  36



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDVKAPS  36



>ref|XP_002172001.1| 40S ribosomal protein S3a [Schizosaccharomyces japonicus yFS275]
 sp|B6JWF7.1|RS3A_SCHJY RecName: Full=40S ribosomal protein S1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB05708.1| 40S ribosomal protein S3a [Schizosaccharomyces japonicus yFS275]
Length=252

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKRVVDPFSRKDWYDIKAPS  36



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDVKAPS  36



>ref|XP_003336191.1| 40S ribosomal protein S1 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 ref|XP_003338900.1| 40S ribosomal protein S1 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EFP91772.1| 40S ribosomal protein S1 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EFP94481.1| 40S ribosomal protein S1 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
Length=257

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K ADPF +KDWYD+KAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVADPFTRKDWYDVKAPS  36



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKLVDPFSKKDWYDVKAPS  36



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>gb|EPX72723.1| 40S ribosomal protein S3a [Schizosaccharomyces octosporus yFS286]
Length=252

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +A DPFA+KDWY+IKAP+
Sbjct  1    MAVGKNKRLSKGKKGIKKRAVDPFARKDWYEIKAPA  36



>gb|EMD41078.1| hypothetical protein CERSUDRAFT_80722 [Ceriporiopsis subvermispora 
B]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_007302916.1| S-phase-specific ribosomal protein cyc07 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM88274.1| S-phase-specific ribosomal protein cyc07 [Stereum hirsutum FP-91666 
SS1]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_007392195.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59637.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKLVDPFSKKDWYDVKAPS  36



>gb|KIK65348.1| hypothetical protein GYMLUDRAFT_38796 [Gymnopus luxurians FD-317 
M1]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>gb|EUC65367.1| 40s ribosomal protein s3ae [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP55145.1| 40s ribosomal protein S3Ae [Rhizoctonia solani 123E]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKLVDPFSKKDWYDVKAPS  36



>ref|XP_002619798.1| 40S ribosomal protein S3aE [Clavispora lusitaniae ATCC 42720]
 sp|C4XYD5.1|RS3A1_CLAL4 RecName: Full=40S ribosomal protein S1-A [Clavispora lusitaniae 
ATCC 42720]
 gb|EEQ36834.1| 40S ribosomal protein S3aE [Clavispora lusitaniae ATCC 42720]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   KA DPFA+K+W+DIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKAVDPFARKEWFDIKAPS  36



>gb|KII94785.1| hypothetical protein PLICRDRAFT_33595 [Plicaturopsis crispa FD-325 
SS-3]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_007382215.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10703.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>dbj|BAA87298.1| 40s ribosomal protein RP10 [Schizosaccharomyces pombe]
Length=72

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +  DPF++KDWYDIKAP+
Sbjct  1    MAVGKNKRLSKGKKGIKKRVVDPFSRKDWYDIKAPA  36



>ref|XP_007409874.1| hypothetical protein MELLADRAFT_43398 [Melampsora larici-populina 
98AG31]
 gb|EGG06914.1| hypothetical protein MELLADRAFT_43398 [Melampsora larici-populina 
98AG31]
Length=257

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K ADPF +KDWYD+KAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVADPFTRKDWYDVKAPS  36



>ref|XP_002618019.1| 40S ribosomal protein S3aE [Clavispora lusitaniae ATCC 42720]
 sp|C4XZU6.1|RS3A2_CLAL4 RecName: Full=40S ribosomal protein S1-B [Clavispora lusitaniae 
ATCC 42720]
 gb|EEQ37355.1| 40S ribosomal protein S3aE [Clavispora lusitaniae ATCC 42720]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   KA DPFA+K+W+DIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKAVDPFARKEWFDIKAPS  36



>sp|Q764D2.1|RS3A_LENED RecName: Full=40S ribosomal protein S1; AltName: Full=Protein 
cyc07 [Lentinula edodes]
 dbj|BAD11816.1| putative S-phase specific ribosomal protein cyc07 [Lentinula 
edodes]
Length=256

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKLVDPFSKKDWYDVKAPS  36



>gb|KJA29982.1| hypothetical protein HYPSUDRAFT_81601 [Hypholoma sublateritium 
FD-334 SS-4]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>gb|KIK06774.1| hypothetical protein K443DRAFT_674057 [Laccaria amethystina LaAM-08-1]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKLVDPFSKKDWYDVKAPS  36



>ref|XP_002387295.1| hypothetical protein MPER_14061 [Moniliophthora perniciosa FA553]
 gb|EEB88225.1| hypothetical protein MPER_14061 [Moniliophthora perniciosa FA553]
Length=39

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_007862325.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59292.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KGG  K  DPF+KKDWYD+KAPS
Sbjct  1    MAVGKNKRISKGRKGGKKKLVDPFSKKDWYDVKAPS  36



>emb|CDO74072.1| hypothetical protein BN946_scf185043.g122 [Trametes cinnabarina]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPF+KKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFSKKDWYDIKAPS  36



>gb|KDQ64848.1| hypothetical protein JAAARDRAFT_28494 [Jaapia argillacea MUCL 
33604]
Length=257

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFSRKDWYDIKAPS  36



>sp|B0CY45.2|RS3A_LACBS RecName: Full=40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>gb|KIM46265.1| hypothetical protein M413DRAFT_441346 [Hebeloma cylindrosporum 
h7]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>emb|CCM04869.1| predicted protein [Fibroporia radiculosa]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_007338149.1| 40S ribosomal protein S1 [Auricularia delicata TFB-10046 SS5]
 gb|EJD53828.1| 40S ribosomal protein S1 [Auricularia delicata TFB-10046 SS5]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFSRKDWYDIKAPS  36



>ref|XP_002475466.1| 40S ribosomal protein S3A [Postia placenta Mad-698-R]
 sp|B8PIG4.1|RS3A_POSPM RecName: Full=40S ribosomal protein S1 [Postia placenta Mad-698-R]
 gb|EED79317.1| 40S ribosomal protein S3A [Postia placenta Mad-698-R]
Length=256

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_007843081.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
 gb|ESK97646.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
Length=256

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>gb|KFH70745.1| 40S ribosomal protein S1 [Mortierella verticillata NRRL 6337]
 gb|KFH71914.1| 40S ribosomal protein S1 [Mortierella verticillata NRRL 6337]
Length=257

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>emb|CDS03716.1| Putative 40S ribosomal protein S1 [Absidia idahoensis var. thermophila]
Length=265

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>ref|XP_008035602.1| 40S ribosomal protein S1 [Trametes versicolor FP-101664 SS1]
 gb|EIW61739.1| 40S ribosomal protein S1 [Trametes versicolor FP-101664 SS1]
Length=256

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDIKAPS  36



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>ref|XP_001837102.1| 40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 sp|A8NX92.1|RS3A_COPC7 RecName: Full=40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 gb|EAU84719.1| 40s ribosomal protein s3ae-a [Coprinopsis cinerea okayama7#130]
Length=256

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>gb|ACZ59453.1| hypothetical protein [Pleurotus ostreatus]
Length=229

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDW+DIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWFDIKAPS  36



>emb|CCO27311.1| 40S ribosomal protein S1 AltName: Full=Protein cyc07 [Rhizoctonia 
solani AG-1 IB]
 emb|CEL58118.1| 40S ribosomal protein S1 OS=Lentinula edodes GN=RPS1 PE=2 SV=1 
[Rhizoctonia solani AG-1 IB]
Length=256

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYD+KAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDVKAPS  36



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MA G NKR+SKGKKGG  KA DPF KKDWYDIKAPS
Sbjct  1    MAQGKNKRMSKGKKGGKKKAVDPFTKKDWYDIKAPS  36



>ref|NP_592828.1| 40S ribosomal protein S1 [Schizosaccharomyces pombe 972h-]
 sp|Q09781.2|RS3A1_SCHPO RecName: Full=40S ribosomal protein S1-A; AltName: Full=S3aE-A 
[Schizosaccharomyces pombe 972h-]
 emb|CAA91095.1| 40S ribosomal protein S3a [Schizosaccharomyces pombe]
Length=252

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +  DPF++KDWYDIKAP+
Sbjct  1    MAVGKNKRLSKGKKGIKKRVVDPFSRKDWYDIKAPA  36



>ref|XP_003680888.1| 40S ribosomal protein S1 [Torulaspora delbrueckii]
 emb|CCE91677.1| hypothetical protein TDEL_0D00930 [Torulaspora delbrueckii]
Length=255

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF KK+WYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTKKEWYDIKAPS  36



>ref|XP_007329524.1| hypothetical protein AGABI1DRAFT_106559 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM80357.1| hypothetical protein AGABI1DRAFT_106559 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=256

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>gb|EJT50838.1| 40s ribosomal protein s3ae-a (s1-a) [Trichosporon asahii var. 
asahii CBS 2479]
 gb|EKD01998.1| 40s ribosomal protein s3ae-a (s1-a) [Trichosporon asahii var. 
asahii CBS 8904]
Length=258

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_007377291.1| hypothetical protein SPAPADRAFT_143639 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30320.1| hypothetical protein SPAPADRAFT_143639 [Spathaspora passalidarum 
NRRL Y-27907]
Length=260

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF KKDWYDIKAP+
Sbjct  1    MAVGKNKRLSKGKKGVKKKIIDPFTKKDWYDIKAPT  36



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KG   K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGRKGSKKKTVDPFSKKDWYDIKAPT  36



>emb|CDR40922.1| RHTO0S05e08922g1_1 [Rhodosporidium toruloides]
Length=257

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   +  DPF +KDWYD+KAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKRVVDPFTRKDWYDLKAPS  36



>gb|KIP10648.1| hypothetical protein PHLGIDRAFT_84595 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=256

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYD+KAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDVKAPS  36



>gb|EPB82263.1| 30S ribosomal protein S3Ae [Mucor circinelloides f. circinelloides 
1006PhL]
Length=266

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKG   K  DPFAKKDWYDIKAPS
Sbjct  1    MAVGKNKRISKGKKGSKKKTVDPFAKKDWYDIKAPS  36



>gb|EIE78641.1| 40S ribosomal protein S1 [Rhizopus delemar RA 99-880]
 gb|EIE87411.1| 40S ribosomal protein S1 [Rhizopus delemar RA 99-880]
Length=266

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>emb|CEG72228.1| Putative 40S ribosomal protein S1 [Rhizopus microsporus]
Length=266

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>emb|CEI91945.1| Putative 40S ribosomal protein S1 [Rhizopus microsporus]
Length=266

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>emb|CEG72481.1| Putative 40S ribosomal protein S1 [Rhizopus microsporus]
 emb|CEI86919.1| Putative 40S ribosomal protein S1 [Rhizopus microsporus]
Length=266

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKG+KG   K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGRKGSKKKTVDPFSKKDWYDIKAPT  36



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>emb|CDS09424.1| Putative 40S ribosomal protein S1 [Absidia idahoensis var. thermophila]
Length=265

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>emb|CEG70959.1| Putative 40S ribosomal protein S1 [Rhizopus microsporus]
Length=266

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>emb|CEP07976.1| hypothetical protein [Parasitella parasitica]
Length=323

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  60   MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  95



>emb|CDH60302.1| 40s ribosomal protein s1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=265

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF +KDWYDIKAPS
Sbjct  1    MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPS  36



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>gb|KDQ29255.1| hypothetical protein PLEOSDRAFT_1089059 [Pleurotus ostreatus 
PC15]
Length=256

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDW+DIKAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWFDIKAPS  36



>ref|XP_001774288.1| predicted protein [Physcomitrella patens]
 gb|EDQ60924.1| predicted protein [Physcomitrella patens]
Length=254

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKRISKGKKGG  K  DPF+KKDWYDIKAP+
Sbjct  1    MAVGKNKRISKGKKGGKKKIVDPFSKKDWYDIKAPN  36



>ref|XP_007364341.1| 40S ribosomal protein S1 [Dichomitus squalens LYAD-421 SS1]
 gb|EJF62995.1| 40S ribosomal protein S1 [Dichomitus squalens LYAD-421 SS1]
Length=256

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  92   MAVGXNKRISkgkkggxxkAADPFAKKDWYDIKAPS  199
            MAVG NKR+SKGKKG   K  DPF++KDWYD+KAPS
Sbjct  1    MAVGKNKRLSKGKKGIKKKVVDPFSRKDWYDLKAPS  36



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565033620200