BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016J03

Length=442
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626744.1|  PREDICTED: uncharacterized protein LOC104117398    109   7e-26   Nicotiana tomentosiformis
ref|XP_009791619.1|  PREDICTED: uncharacterized protein LOC104238836    107   4e-25   Nicotiana sylvestris
ref|XP_009797256.1|  PREDICTED: uncharacterized protein LOC104243716    106   1e-24   Nicotiana sylvestris
ref|XP_009631591.1|  PREDICTED: uncharacterized protein LOC104121329    104   5e-24   Nicotiana tomentosiformis
emb|CDP14558.1|  unnamed protein product                                103   7e-24   Coffea canephora [robusta coffee]
ref|XP_006359698.1|  PREDICTED: uncharacterized protein LOC102599645    103   1e-23   Solanum tuberosum [potatoes]
ref|XP_004231042.1|  PREDICTED: uncharacterized protein LOC101266077    101   5e-23   Solanum lycopersicum
ref|XP_003607180.1|  hypothetical protein MTR_4g073100                  100   2e-22   Medicago truncatula
emb|CAN73631.1|  hypothetical protein VITISV_026643                   99.8    2e-22   Vitis vinifera
ref|XP_002278836.1|  PREDICTED: uncharacterized protein LOC100243471  99.8    2e-22   Vitis vinifera
ref|XP_004505820.1|  PREDICTED: uncharacterized protein LOC101509009  99.4    3e-22   Cicer arietinum [garbanzo]
gb|KJB12148.1|  hypothetical protein B456_002G003000                  99.4    3e-22   Gossypium raimondii
gb|KJB12146.1|  hypothetical protein B456_002G003000                  99.4    3e-22   Gossypium raimondii
ref|XP_010107666.1|  hypothetical protein L484_008383                 99.0    4e-22   
ref|XP_008236021.1|  PREDICTED: uncharacterized protein LOC103334...  97.4    1e-21   Prunus mume [ume]
ref|XP_007041832.1|  Basic-leucine zipper (bZIP) transcription fa...  96.3    2e-21   
ref|XP_006590380.1|  PREDICTED: bZIP transcription factor bZIP121...  97.4    2e-21   
ref|XP_008236016.1|  PREDICTED: uncharacterized protein LOC103334...  97.4    2e-21   Prunus mume [ume]
ref|NP_001237296.1|  bZIP transcription factor bZIP121                97.4    2e-21   
ref|NP_001235033.1|  bZIP transcription factor bZIP122                97.4    2e-21   Glycine max [soybeans]
ref|XP_007201303.1|  hypothetical protein PRUPE_ppa009913mg           97.4    2e-21   Prunus persica
ref|XP_010266832.1|  PREDICTED: uncharacterized protein LOC104604256  97.4    2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006591923.1|  PREDICTED: bZIP transcription factor bZIP122...  97.4    2e-21   
gb|KHN39873.1|  hypothetical protein glysoja_020613                   97.1    2e-21   Glycine soja [wild soybean]
ref|XP_010690366.1|  PREDICTED: uncharacterized protein LOC104903923  97.4    2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007041826.1|  Basic-leucine zipper transcription factor fa...  97.1    2e-21   
ref|XP_010028728.1|  PREDICTED: uncharacterized protein LOC104418944  97.1    3e-21   Eucalyptus grandis [rose gum]
ref|XP_007041828.1|  Basic-leucine zipper transcription factor fa...  97.1    3e-21   
ref|XP_007041827.1|  Basic-leucine zipper transcription factor fa...  97.1    3e-21   
gb|KJB32659.1|  hypothetical protein B456_005G254200                  96.3    4e-21   Gossypium raimondii
ref|XP_010265995.1|  PREDICTED: uncharacterized protein LOC104603629  96.7    4e-21   Nelumbo nucifera [Indian lotus]
gb|KHG28517.1|  Protein FD -like protein                              96.3    4e-21   Gossypium arboreum [tree cotton]
ref|XP_007131714.1|  hypothetical protein PHAVU_011G035700g           95.9    7e-21   Phaseolus vulgaris [French bean]
ref|XP_010526894.1|  PREDICTED: uncharacterized protein LOC104804328  95.1    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_006409392.1|  hypothetical protein EUTSA_v10022810mg           95.1    1e-20   Eutrema salsugineum [saltwater cress]
gb|KJB15817.1|  hypothetical protein B456_002G197800                  94.7    1e-20   Gossypium raimondii
ref|XP_006409393.1|  hypothetical protein EUTSA_v10022810mg           94.7    1e-20   
ref|XP_004147043.1|  PREDICTED: uncharacterized protein LOC101219501  94.7    2e-20   Cucumis sativus [cucumbers]
ref|XP_008457698.1|  PREDICTED: uncharacterized protein LOC103497...  94.7    2e-20   Cucumis melo [Oriental melon]
ref|XP_010530900.1|  PREDICTED: uncharacterized protein LOC104807371  94.7    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_008457697.1|  PREDICTED: uncharacterized protein LOC103497...  94.7    2e-20   
ref|XP_006422593.1|  hypothetical protein CICLE_v10028931mg           94.4    2e-20   
gb|KDO68071.1|  hypothetical protein CISIN_1g024365mg                 94.4    2e-20   Citrus sinensis [apfelsine]
ref|XP_006422601.1|  hypothetical protein CICLE_v10028931mg           94.4    3e-20   
ref|XP_002534148.1|  DNA binding protein, putative                    93.2    6e-20   
ref|XP_006384577.1|  hypothetical protein POPTR_0004s18120g           93.2    7e-20   
ref|XP_002305521.2|  bZIP transcription factor family protein         92.8    7e-20   
emb|CBI37871.3|  unnamed protein product                              89.7    1e-19   Vitis vinifera
ref|XP_011046688.1|  PREDICTED: uncharacterized protein LOC105141...  92.0    2e-19   Populus euphratica
ref|XP_011046685.1|  PREDICTED: uncharacterized protein LOC105141...  92.0    2e-19   Populus euphratica
ref|XP_011046689.1|  PREDICTED: uncharacterized protein LOC105141...  91.7    2e-19   Populus euphratica
emb|CDY47478.1|  BnaA09g08870D                                        90.5    5e-19   Brassica napus [oilseed rape]
ref|XP_002884017.1|  DNA binding protein                              89.7    9e-19   Arabidopsis lyrata subsp. lyrata
ref|NP_179268.2|  transcription factor bZIP23                         89.7    9e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24610.1|  hypothetical protein                                  89.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376970.1|  PREDICTED: uncharacterized protein LOC103965622  89.0    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009376950.1|  PREDICTED: uncharacterized protein LOC103965600  89.0    2e-18   Pyrus x bretschneideri [bai li]
gb|AFP19453.1|  bZIP transcription factor family protein 2            89.0    2e-18   Camellia sinensis [black tea]
ref|XP_006298365.1|  hypothetical protein CARUB_v10014436mg           88.6    2e-18   Capsella rubella
ref|XP_009108690.1|  PREDICTED: uncharacterized protein LOC103834377  88.6    3e-18   Brassica rapa
gb|KDP29660.1|  hypothetical protein JCGZ_18822                       88.2    4e-18   Jatropha curcas
ref|XP_010327411.1|  PREDICTED: uncharacterized protein LOC104649609  87.4    6e-18   Solanum lycopersicum
ref|XP_009112403.1|  PREDICTED: uncharacterized protein LOC103837...  87.0    9e-18   Brassica rapa
ref|XP_009112401.1|  PREDICTED: uncharacterized protein LOC103837...  86.7    1e-17   
emb|CDY26786.1|  BnaC09g09130D                                        86.3    1e-17   Brassica napus [oilseed rape]
emb|CDY17503.1|  BnaC03g65600D                                        85.9    2e-17   Brassica napus [oilseed rape]
ref|XP_006284366.1|  hypothetical protein CARUB_v10005538mg           85.5    3e-17   Capsella rubella
emb|CDX76308.1|  BnaA08g10920D                                        85.5    3e-17   
ref|XP_010516149.1|  PREDICTED: uncharacterized protein LOC104791854  84.7    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010489260.1|  PREDICTED: uncharacterized protein LOC104766980  84.3    7e-17   Camelina sativa [gold-of-pleasure]
gb|KFK30142.1|  hypothetical protein AALP_AA7G222200                  84.7    7e-17   Arabis alpina [alpine rockcress]
ref|XP_010467405.1|  PREDICTED: uncharacterized protein LOC104747472  84.3    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002869111.1|  bZIP transcription factor family protein         84.3    8e-17   Arabidopsis lyrata subsp. lyrata
ref|NP_567974.1|  transcription factor bZIP19                         84.3    8e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63358.1|  putative transcription factor                         84.3    9e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAA17769.1|  putative protein                                     84.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437531.1|  PREDICTED: uncharacterized protein LOC104721282  83.6    2e-16   
ref|XP_010432347.1|  PREDICTED: uncharacterized protein LOC104716633  83.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010447005.1|  PREDICTED: uncharacterized protein LOC104729711  83.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009787001.1|  PREDICTED: uncharacterized protein LOC104235...  83.6    2e-16   Nicotiana sylvestris
ref|XP_009786999.1|  PREDICTED: uncharacterized protein LOC104235...  83.2    2e-16   Nicotiana sylvestris
ref|XP_010548099.1|  PREDICTED: uncharacterized protein LOC104819648  82.8    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_006412160.1|  hypothetical protein EUTSA_v10026007mg           82.4    4e-16   
ref|XP_011046168.1|  PREDICTED: uncharacterized protein LOC105140851  80.9    1e-15   Populus euphratica
ref|XP_008377738.1|  PREDICTED: uncharacterized protein LOC103440807  80.5    2e-15   
ref|XP_009408222.1|  PREDICTED: uncharacterized protein LOC103990...  80.1    2e-15   
ref|XP_009408220.1|  PREDICTED: uncharacterized protein LOC103990...  80.1    3e-15   
ref|XP_009355669.1|  PREDICTED: uncharacterized protein LOC103946638  80.1    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_009624365.1|  PREDICTED: uncharacterized protein LOC104115438  79.7    3e-15   Nicotiana tomentosiformis
ref|XP_002313707.2|  hypothetical protein POPTR_0009s13730g           78.2    1e-14   
ref|XP_004164905.1|  PREDICTED: uncharacterized protein LOC101232700  75.9    7e-14   
ref|XP_004144846.1|  PREDICTED: uncharacterized protein LOC101208161  75.9    8e-14   Cucumis sativus [cucumbers]
ref|XP_008447959.1|  PREDICTED: uncharacterized protein LOC103490288  75.9    9e-14   Cucumis melo [Oriental melon]
gb|KJB76278.1|  hypothetical protein B456_012G081200                  75.5    1e-13   Gossypium raimondii
ref|NP_001058591.1|  Os06g0716800                                     75.5    1e-13   
gb|KJB76277.1|  hypothetical protein B456_012G081200                  75.5    1e-13   Gossypium raimondii
gb|AAL79736.1|AC091774_27  putative transcription factor              75.5    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141059.1|  uncharacterized protein LOC100273140             75.1    1e-13   Zea mays [maize]
gb|ACG32751.1|  DNA binding protein                                   75.1    1e-13   Zea mays [maize]
ref|XP_002439031.1|  hypothetical protein SORBIDRAFT_10g030250        74.7    2e-13   Sorghum bicolor [broomcorn]
ref|XP_004966468.1|  PREDICTED: uncharacterized protein LOC101762...  74.7    2e-13   
gb|AFW69519.1|  putative bZIP transcription factor superfamily pr...  74.7    4e-13   
ref|XP_009391011.1|  PREDICTED: uncharacterized protein LOC103977271  73.9    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006656494.1|  PREDICTED: uncharacterized protein LOC102721653  73.2    6e-13   Oryza brachyantha
ref|XP_009401478.1|  PREDICTED: uncharacterized protein LOC103985487  72.8    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136335.1|  PREDICTED: uncharacterized protein LOC103860484  72.4    9e-13   Brassica rapa
emb|CDX89748.1|  BnaC03g46620D                                        72.4    1e-12   
emb|CDY02237.1|  BnaA03g39300D                                        72.4    1e-12   
ref|NP_001148839.1|  LOC100282457                                     72.4    1e-12   Zea mays [maize]
ref|XP_008647848.1|  PREDICTED: LOC100282457 isoform X1               72.4    1e-12   Zea mays [maize]
gb|AFP19452.1|  bZIP transcription factor family protein 1            71.2    3e-12   Camellia sinensis [black tea]
ref|XP_011088608.1|  PREDICTED: uncharacterized protein LOC105169791  70.5    8e-12   Sesamum indicum [beniseed]
gb|EMT00406.1|  hypothetical protein F775_29696                       68.2    4e-11   
ref|XP_003563276.1|  PREDICTED: uncharacterized protein LOC100823660  68.2    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_011092974.1|  PREDICTED: uncharacterized protein LOC105173...  68.2    6e-11   Sesamum indicum [beniseed]
ref|XP_011092972.1|  PREDICTED: uncharacterized protein LOC105173...  68.2    6e-11   Sesamum indicum [beniseed]
ref|XP_010920114.1|  PREDICTED: uncharacterized protein LOC105044037  66.2    2e-10   Elaeis guineensis
ref|XP_009418779.1|  PREDICTED: uncharacterized protein LOC103998893  65.1    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846902.1|  hypothetical protein AMTR_s00152p00031760        65.5    5e-10   Amborella trichopoda
ref|XP_008790182.1|  PREDICTED: uncharacterized protein LOC103707462  64.3    9e-10   Phoenix dactylifera
ref|XP_008813516.1|  PREDICTED: uncharacterized protein LOC103724133  64.3    1e-09   
gb|EYU37954.1|  hypothetical protein MIMGU_mgv1a011243mg              64.3    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_008800178.1|  PREDICTED: uncharacterized protein LOC103714...  62.8    4e-09   Phoenix dactylifera
ref|XP_008800177.1|  PREDICTED: uncharacterized protein LOC103714...  62.4    5e-09   
ref|XP_010935120.1|  PREDICTED: uncharacterized protein LOC105055101  62.0    7e-09   Elaeis guineensis
ref|XP_011091785.1|  PREDICTED: putative transcription factor kapC    61.2    1e-08   
emb|CDX69107.1|  BnaC01g03460D                                        61.2    1e-08   
ref|XP_004289872.1|  PREDICTED: uncharacterized protein LOC101314521  61.2    1e-08   Fragaria vesca subsp. vesca
gb|EPS65924.1|  hypothetical protein M569_08855                       60.8    1e-08   Genlisea aurea
gb|ACI90291.1|  putative bZIP transcription factor                    60.5    3e-08   Picrorhiza kurrooa
ref|XP_001758867.1|  predicted protein                                58.5    4e-08   
ref|XP_008788583.1|  PREDICTED: uncharacterized protein LOC103706294  55.8    7e-07   Phoenix dactylifera
emb|CDP21594.1|  unnamed protein product                              55.8    1e-06   Coffea canephora [robusta coffee]
ref|XP_007149027.1|  hypothetical protein PHAVU_005G034400g           54.7    3e-06   Phaseolus vulgaris [French bean]
ref|XP_009106517.1|  PREDICTED: uncharacterized protein LOC103832273  53.5    6e-06   Brassica rapa
gb|EMS47152.1|  hypothetical protein TRIUR3_12850                     52.8    6e-06   Triticum urartu
emb|CDY52654.1|  BnaAnng11690D                                        53.1    8e-06   Brassica napus [oilseed rape]
ref|XP_009354398.1|  PREDICTED: transcription factor TGA3             52.8    1e-05   
ref|XP_008344616.1|  PREDICTED: uncharacterized protein LOC103407459  52.8    1e-05   
gb|EMT32723.1|  hypothetical protein F775_08202                       51.2    2e-05   
gb|EMT32714.1|  hypothetical protein F775_17324                       48.5    2e-04   
emb|CAB41316.1|  putative protein                                     48.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMS52367.1|  hypothetical protein TRIUR3_01653                     47.4    5e-04   Triticum urartu
ref|XP_006403861.1|  hypothetical protein EUTSA_v10010764mg           47.0    7e-04   
ref|XP_010104020.1|  hypothetical protein L484_001603                 47.8    7e-04   
ref|XP_006291938.1|  hypothetical protein CARUB_v10018125mg           47.0    7e-04   Capsella rubella
ref|NP_190764.2|  basic leucine zipper 24                             47.4    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850680.1|  basic leucine zipper 24                             47.4    8e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009626744.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
 ref|XP_009626745.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
Length=276

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 60/71 (85%), Gaps = 3/71 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M DGELEFSNQ MLSSSNF  F  S   MDSF NEILKDTHACTHAHTCNPPGPDNSHTH
Sbjct  2    MADGELEFSNQEMLSSSNFGEFSSS---MDSFFNEILKDTHACTHAHTCNPPGPDNSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTKIVP
Sbjct  59   TCYHVHTKIVP  69



>ref|XP_009791619.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
 ref|XP_009791625.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
Length=276

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 59/71 (83%), Gaps = 3/71 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M DGELEFSNQ MLSSSNF  F  S   MDSF NEILKDTHACTHAHTCNPPGPDNSHTH
Sbjct  2    MADGELEFSNQEMLSSSNFGEFSSS---MDSFFNEILKDTHACTHAHTCNPPGPDNSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTK VP
Sbjct  59   TCYHVHTKFVP  69



>ref|XP_009797256.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797257.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797258.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797259.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797260.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
Length=273

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSNQ MLSSSNF  FP S S MDSF NEILKDTHACTH HTCNPPGPDN+HTH
Sbjct  1    MDDGELEFSNQEMLSSSNFGEFPDSGS-MDSFFNEILKDTHACTHTHTCNPPGPDNTHTH  59

Query  399  TCYHXHTKIVP  431
            TCYH HTKIVP
Sbjct  60   TCYHVHTKIVP  70



>ref|XP_009631591.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
 ref|XP_009631599.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
Length=273

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSNQ MLSSSNF  FP S   MDSF NEILKDTHACTH HTCNPPGPD++HTH
Sbjct  1    MDDGELEFSNQEMLSSSNFGEFPDSG-LMDSFFNEILKDTHACTHTHTCNPPGPDSTHTH  59

Query  399  TCYHXHTKIVP  431
            TCYH HTKIVP
Sbjct  60   TCYHVHTKIVP  70



>emb|CDP14558.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSN  M S+S+F   P S S M SFL+EILKDTHACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELEFSNHEMFSNSSFGDLPSSCS-MGSFLDEILKDTHACTHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599645 [Solanum tuberosum]
Length=272

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 58/71 (82%), Gaps = 3/71 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M DGEL+ SNQ MLSSSNF  F  S   MDSF NEILKD HACTHAHTCNPPGPDNSHTH
Sbjct  1    MADGELDISNQEMLSSSNFGEFSSS---MDSFFNEILKDAHACTHAHTCNPPGPDNSHTH  57

Query  399  TCYHXHTKIVP  431
            TCYH HTKIVP
Sbjct  58   TCYHVHTKIVP  68



>ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266077 [Solanum lycopersicum]
Length=270

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M DGEL+ S Q MLSSSNF  F  S   MDSF NEILKD HACTHAHTCNPPGPDNSHTH
Sbjct  1    MADGELDISTQEMLSSSNFGEFSSS---MDSFFNEILKDAHACTHAHTCNPPGPDNSHTH  57

Query  399  TCYHXHTKIVP  431
            TCYH HTKIVP
Sbjct  58   TCYHVHTKIVP  68



>ref|XP_003607180.1| hypothetical protein MTR_4g073100 [Medicago truncatula]
 gb|ACJ84596.1| unknown [Medicago truncatula]
 gb|AES89377.1| BZIP transcription factor [Medicago truncatula]
Length=267

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGEL+FSNQ + SS N   F  S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQDVFSSPNMGEFQTSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPA  434
            TCYH HTKIVPA
Sbjct  60   TCYHVHTKIVPA  71



>emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera]
Length=264

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS N    P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  60   TCFHVHTKIVPAP  72



>ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera]
Length=273

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS N    P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  3    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  61

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  62   TCFHVHTKIVPAP  74



>ref|XP_004505820.1| PREDICTED: uncharacterized protein LOC101509009 [Cicer arietinum]
Length=269

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGEL+FSN  + SS N   FP S S MDSF +E+LKD+HACTH HTCNPPGPD+SHTH
Sbjct  1    MEDGELDFSNHEVFSSPNMGEFPSSGS-MDSFFDELLKDSHACTHTHTCNPPGPDSSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>gb|KJB12148.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=269

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M++GEL+FSN  + S  N      S+  MDSF NEIL D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDEGELDFSNHEVFSGGNSMGDIPSSCSMDSFFNEILNDSHACTHTHTCNPPGPDNSHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIVPA
Sbjct  61   TCFHVHTKIVPA  72



>gb|KJB12146.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
 gb|KJB12147.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=265

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M++GEL+FSN  + S  N      S+  MDSF NEIL D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDEGELDFSNHEVFSGGNSMGDIPSSCSMDSFFNEILNDSHACTHTHTCNPPGPDNSHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIVPA
Sbjct  61   TCFHVHTKIVPA  72



>ref|XP_010107666.1| hypothetical protein L484_008383 [Morus notabilis]
 gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis]
Length=262

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FSNQ + SS N      S+  MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGEVDFSNQEVFSSPNIGGELPSSCSMDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIVPA
Sbjct  61   TCFHVHTKIVPA  72



>ref|XP_008236021.1| PREDICTED: uncharacterized protein LOC103334826 isoform X2 [Prunus 
mume]
Length=265

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGEL+FSNQ M S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV + 
Sbjct  61   TCFHVHTKIVSSA  73



>ref|XP_007041832.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
 gb|EOX97663.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
Length=202

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+F NQ + S +        +  MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSGNMADIPSSCS--MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>ref|XP_006590380.1| PREDICTED: bZIP transcription factor bZIP121 isoform X1 [Glycine 
max]
 ref|XP_006590381.1| PREDICTED: bZIP transcription factor bZIP121 isoform X2 [Glycine 
max]
 ref|XP_006590382.1| PREDICTED: bZIP transcription factor bZIP121 isoform X3 [Glycine 
max]
Length=270

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSN  + SS N    P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>ref|XP_008236016.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236017.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236018.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236020.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
Length=272

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGEL+FSNQ M S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV + 
Sbjct  61   TCFHVHTKIVSSA  73



>ref|NP_001237296.1| bZIP transcription factor bZIP121 [Glycine max]
 gb|ABI34680.1| bZIP transcription factor bZIP121 [Glycine max]
Length=270

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSN  + SS N    P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>ref|NP_001235033.1| bZIP transcription factor bZIP122 [Glycine max]
 ref|XP_006591930.1| PREDICTED: bZIP transcription factor bZIP122 isoform X8 [Glycine 
max]
 ref|XP_006591931.1| PREDICTED: bZIP transcription factor bZIP122 isoform X9 [Glycine 
max]
 gb|ABI34664.1| bZIP transcription factor bZIP122 [Glycine max]
Length=265

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSN  + SS N    P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>ref|XP_007201303.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
 gb|EMJ02502.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
Length=272

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGEL+FSNQ M S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV + 
Sbjct  61   TCFHVHTKIVSSA  73



>ref|XP_010266832.1| PREDICTED: uncharacterized protein LOC104604256 [Nelumbo nucifera]
Length=273

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS+N      S+  MD F +E+LKD  ACTH HTCNPPGPD++HTH
Sbjct  1    MDDGELDFSNQEVFSSANLGDQLPSSCSMDEFFDELLKDAQACTHTHTCNPPGPDSTHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKI+PAP
Sbjct  61   TCFHVHTKILPAP  73



>ref|XP_006591923.1| PREDICTED: bZIP transcription factor bZIP122 isoform X1 [Glycine 
max]
 ref|XP_006591924.1| PREDICTED: bZIP transcription factor bZIP122 isoform X2 [Glycine 
max]
 ref|XP_006591925.1| PREDICTED: bZIP transcription factor bZIP122 isoform X3 [Glycine 
max]
 ref|XP_006591926.1| PREDICTED: bZIP transcription factor bZIP122 isoform X4 [Glycine 
max]
 ref|XP_006591927.1| PREDICTED: bZIP transcription factor bZIP122 isoform X5 [Glycine 
max]
 ref|XP_006591928.1| PREDICTED: bZIP transcription factor bZIP122 isoform X6 [Glycine 
max]
 ref|XP_006591929.1| PREDICTED: bZIP transcription factor bZIP122 isoform X7 [Glycine 
max]
Length=271

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSN  + SS N    P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>gb|KHN39873.1| hypothetical protein glysoja_020613 [Glycine soja]
Length=268

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSN  + SS N    P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>ref|XP_010690366.1| PREDICTED: uncharacterized protein LOC104903923 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +3

Query  210  ISXMEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNS  389
            +  M+DGELEFSNQ +LSS+N    P S S MDSF +E+LKDTHACTH HTCNPPGPD  
Sbjct  20   VPLMDDGELEFSNQELLSSANIGDVPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDLH  78

Query  390  HTHTCYHXHTKIVPAP  437
            HTHTC+H HTKI+P P
Sbjct  79   HTHTCFHVHTKILPPP  94



>ref|XP_007041826.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041829.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041830.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041831.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97657.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97660.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97661.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97662.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=266

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+F NQ + S +        +  MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSGNMADIPSSCS--MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>ref|XP_010028728.1| PREDICTED: uncharacterized protein LOC104418944 [Eucalyptus grandis]
 gb|KCW55527.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
 gb|KCW55528.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
Length=269

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 5/77 (6%)
 Frame = +3

Query  219  MEDGELEFSNQXMLs-----ssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPD  383
            M+DGEL+FSNQ + +     S +       +  MDSFL EI +DTHACTH HTCNPPGPD
Sbjct  1    MDDGELDFSNQEVFANHDVFSGSTLGEVPGSRSMDSFLEEIFRDTHACTHTHTCNPPGPD  60

Query  384  NSHTHTCYHXHTKIVPA  434
            +SHTHTC+H HTKIVPA
Sbjct  61   SSHTHTCFHVHTKIVPA  77



>ref|XP_007041828.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOX97659.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
Length=281

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+F NQ + S +        +  MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSGNMADIPSSCS--MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>ref|XP_007041827.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOX97658.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
Length=310

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+F NQ + S +        +  MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSGNMADIPSSCS--MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>gb|KJB32659.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
 gb|KJB32660.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
Length=266

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + S +N    P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFSNQEVFSGNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIVPA
Sbjct  60   TCFHVHTKIVPA  71



>ref|XP_010265995.1| PREDICTED: uncharacterized protein LOC104603629 [Nelumbo nucifera]
Length=280

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ M SS N    P S+  MDSF +E+L DTHACTH HTCNPPGPD +HTH
Sbjct  1    MDDGELDFSNQEMFSSPNMGDQPPSSCSMDSFFDELLNDTHACTHTHTCNPPGPDFTHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKI+ AP
Sbjct  61   TCFHVHTKILSAP  73



>gb|KHG28517.1| Protein FD -like protein [Gossypium arboreum]
Length=261

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + S +N    P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFSNQEVFSGNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIVPA
Sbjct  60   TCFHFHTKIVPA  71



>ref|XP_007131714.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 ref|XP_007131715.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03708.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03709.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
Length=265

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FS   + SS N    P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSTHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTKIVPAP
Sbjct  60   TCYHVHTKIVPAP  72



>ref|XP_010526894.1| PREDICTED: uncharacterized protein LOC104804328 [Tarenaya hassleriana]
Length=273

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FSNQ + S+SN    P S+  MD+F +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGEVDFSNQEVFSNSNMEEIPPSSCSMDTFFDELLRDSHACTHTHTCNPPGPENTHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKI+PA
Sbjct  61   TCFHVHTKILPA  72



>ref|XP_006409392.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50845.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=263

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSNQ  LS+     FP SN  MDSF +E+L D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNQEALSNPKMPEFPPSNCSMDSFFDELLNDSHACTHTHTCNPPGPENTHTH  60

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+PA
Sbjct  61   TCLHVHTKILPA  72



>gb|KJB15817.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15818.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15819.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
Length=257

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL++SNQ + S +N    P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDYSNQEVFSVNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIVPA
Sbjct  60   TCFHFHTKIVPA  71



>ref|XP_006409393.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50846.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=265

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSNQ  LS+     FP SN  MDSF +E+L D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNQEALSNPKMPEFPPSNCSMDSFFDELLNDSHACTHTHTCNPPGPENTHTH  60

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+PA
Sbjct  61   TCLHVHTKILPA  72



>ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus]
 ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus]
 gb|KGN61936.1| hypothetical protein Csa_2G270780 [Cucumis sativus]
Length=273

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGELE SN  + SSSN    P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSSSNAIELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV +P
Sbjct  60   TCFHVHTKIVSSP  72



>ref|XP_008457698.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
 ref|XP_008457699.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
Length=272

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGELE SN  + S SN    P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSGSNAVELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV +P
Sbjct  60   TCFHVHTKIVSSP  72



>ref|XP_010530900.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530901.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530902.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530904.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530905.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530906.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530907.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530908.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530909.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530910.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530911.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530912.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
Length=270

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + S+SN      S+  MD+F +E+L+D+HACTH HTCNPPGP+++HTH
Sbjct  1    MDDGELDFSNQEVFSNSNMDDIQPSSCSMDTFFDELLRDSHACTHTHTCNPPGPESTHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKI+PA
Sbjct  61   TCFHVHTKILPA  72



>ref|XP_008457697.1| PREDICTED: uncharacterized protein LOC103497333 isoform X1 [Cucumis 
melo]
Length=273

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGELE SN  + S SN    P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSGSNAVELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV +P
Sbjct  60   TCFHVHTKIVSSP  72



>ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422594.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422595.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422596.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422597.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422598.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422599.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422600.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006486739.1| PREDICTED: uncharacterized protein LOC102628933 isoform X1 [Citrus 
sinensis]
 ref|XP_006486740.1| PREDICTED: uncharacterized protein LOC102628933 isoform X2 [Citrus 
sinensis]
 ref|XP_006486741.1| PREDICTED: uncharacterized protein LOC102628933 isoform X3 [Citrus 
sinensis]
 gb|ESR35833.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35834.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35835.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35836.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35837.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35838.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35839.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35840.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|KDO68066.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68067.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68068.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68069.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68070.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=268

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FSNQ MLS++       S   MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSANIGDFPSCS---MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  399  TCYHXHTKIV  428
            TC+H HTKIV
Sbjct  58   TCFHVHTKIV  67



>gb|KDO68071.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=262

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FSNQ MLS++       S   MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSANIGDFPSCS---MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  399  TCYHXHTKIV  428
            TC+H HTKIV
Sbjct  58   TCFHVHTKIV  67



>ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35841.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
Length=302

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FSNQ MLS++       S   MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSANIGDFPSCS---MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  399  TCYHXHTKIV  428
            TC+H HTKIV
Sbjct  58   TCFHVHTKIV  67



>ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28231.1| DNA binding protein, putative [Ricinus communis]
Length=284

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FS+Q + S +N    P + S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSHQEVFSGTNMGEMPNNCS-MDSFFDELLKDTHACTHTHTCNPPGPDYSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV AP
Sbjct  60   TCFHVHTKIVSAP  72



>ref|XP_006384577.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
 gb|ERP62374.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
Length=266

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ +LSS N    P S S+   FL+E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDTHACTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTKI+P
Sbjct  59   TCYHVHTKILP  69



>ref|XP_002305521.2| bZIP transcription factor family protein [Populus trichocarpa]
 gb|EEE86032.2| bZIP transcription factor family protein [Populus trichocarpa]
Length=265

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ +LSS N    P S S+   FL+E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDTHACTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTKI+P
Sbjct  59   TCYHVHTKILP  69



>emb|CBI37871.3| unnamed protein product [Vitis vinifera]
Length=127

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS N    P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKI  425
            TC+H HTKI
Sbjct  60   TCFHVHTKI  68



>ref|XP_011046688.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
 ref|XP_011046690.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
Length=265

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ +LSS N    P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTKI+P
Sbjct  59   TCYHVHTKILP  69



>ref|XP_011046685.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046686.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046687.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
Length=266

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ +LSS N    P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTKI+P
Sbjct  59   TCYHVHTKILP  69



>ref|XP_011046689.1| PREDICTED: uncharacterized protein LOC105141220 isoform X3 [Populus 
euphratica]
Length=265

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ +LSS N    P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVP  431
            TCYH HTKI+P
Sbjct  59   TCYHVHTKILP  69



>emb|CDY47478.1| BnaA09g08870D [Brassica napus]
Length=241

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 14/73 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGELEF                S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  1    MEDGELEFP--------------PSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  46

Query  399  TCYHXHTKIVPAP  437
            TC H HTKI+PAP
Sbjct  47   TCLHVHTKILPAP  59



>ref|XP_002884017.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60276.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSN  M         P S+  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNM-----GGELPPSSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTH  55

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+P+
Sbjct  56   TCLHVHTKILPS  67



>ref|NP_179268.2| transcription factor bZIP23 [Arabidopsis thaliana]
 dbj|BAC42143.1| putative bzip transcription factor atbzip23 [Arabidopsis thaliana]
 gb|ABI93931.1| At2g16770 [Arabidopsis thaliana]
 gb|AEC06536.1| Basic-leucine zipper (bZIP) transcription factor family protein 
[Arabidopsis thaliana]
Length=249

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSN  M            +  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNM-------GGELPSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTH  53

Query  399  TCYHXHTKIVP  431
            TC H HTKI+P
Sbjct  54   TCLHVHTKILP  64



>gb|AAD24610.1| hypothetical protein [Arabidopsis thaliana]
Length=255

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSN  M            +  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNM-------GGELPSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTH  53

Query  399  TCYHXHTKIVP  431
            TC H HTKI+P
Sbjct  54   TCLHVHTKILP  64



>ref|XP_009376970.1| PREDICTED: uncharacterized protein LOC103965622 [Pyrus x bretschneideri]
Length=268

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+D E++FSNQ + SS+N      S+  MD+F +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDHEVDFSNQEVFSSANMGGELASSCSMDTFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIV +
Sbjct  61   TCFHVHTKIVSS  72



>ref|XP_009376950.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
 ref|XP_009376951.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
Length=268

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+D E++FSNQ + SS+N      S+  MD+F +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDHEVDFSNQEVFSSANMGGELASSCSMDTFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  399  TCYHXHTKIVPA  434
            TC+H HTKIV +
Sbjct  61   TCFHVHTKIVSS  72



>gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis]
Length=270

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 57/73 (78%), Gaps = 3/73 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FSNQ + SS N    P S S MDSF +E+LKDT  CTH HTCNPPGPD SHTH
Sbjct  1    MDDGEIDFSNQDVFSSPNMGELPSSCS-MDSFFDELLKDT--CTHTHTCNPPGPDFSHTH  57

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  58   TCFHVHTKIVPAP  70



>ref|XP_006298365.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 ref|XP_006298366.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31263.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31264.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
Length=258

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 5/72 (7%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEFSN  M         P ++  MDSF +E+L+D+HACTH HTCNP GP+N+HTH
Sbjct  1    MDDGELEFSNSNM-----GGELPLTSCSMDSFFDELLRDSHACTHTHTCNPSGPENTHTH  55

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+PA
Sbjct  56   TCLHVHTKILPA  67



>ref|XP_009108690.1| PREDICTED: uncharacterized protein LOC103834377 [Brassica rapa]
Length=255

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGELEFSNQ + S+S+    P +N  MD+F +E+LKD++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLKDSNAACTHTHTCNPTGPENAHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>gb|KDP29660.1| hypothetical protein JCGZ_18822 [Jatropha curcas]
Length=284

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE++FS Q + S++N      + S MD+F  E+ KD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGEVDFSQQEVFSNTNIGDIQPNCS-MDNFFEELFKDSHACTHTHTCNPPGPDFSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIV AP
Sbjct  60   TCFHVHTKIVSAP  72



>ref|XP_010327411.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
 ref|XP_010327412.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
Length=262

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+D ELEFS+Q +LSSS F   P S+  M+   NEIL D HAC HAHTCNPPGPDNSHTH
Sbjct  1    MDDMELEFSSQQVLSSSTFGEIPESSP-MNKRFNEILTDVHACIHAHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPAP  437
            TCYH HTK+V  P
Sbjct  60   TCYHVHTKVVTPP  72



>ref|XP_009112403.1| PREDICTED: uncharacterized protein LOC103837781 isoform X2 [Brassica 
rapa]
Length=239

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 14/72 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEF                S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  2    MDDGELEFP--------------PSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  47

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+PA
Sbjct  48   TCLHVHTKILPA  59



>ref|XP_009112401.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
 ref|XP_009112402.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
Length=242

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 14/72 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEF                S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  2    MDDGELEFP--------------PSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  47

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+PA
Sbjct  48   TCLHVHTKILPA  59



>emb|CDY26786.1| BnaC09g09130D [Brassica napus]
Length=239

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 14/72 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGELEF                S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFP--------------PSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  46

Query  399  TCYHXHTKIVPA  434
            TC H HTKI+PA
Sbjct  47   TCLHVHTKILPA  58



>emb|CDY17503.1| BnaC03g65600D [Brassica napus]
Length=255

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGELEFSNQ + S+S+    P +N  MD+F +E+L D++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLMDSNAACTHTHTCNPTGPENAHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>ref|XP_006284366.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
 gb|EOA17264.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
Length=258

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGELEFSNQ + SSS     P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>emb|CDX76308.1| BnaA08g10920D [Brassica napus]
Length=273

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGELEFSNQ + S+S+    P +N  MD+F +E+L D++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLMDSNAACTHTHTCNPTGPENAHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>ref|XP_010516149.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
 ref|XP_010516157.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
Length=256

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 6/73 (8%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPD-NSHT  395
            M+DGELEFSN  M+              MDSF +E+L+D+HACTH HTCNP GP+ N+HT
Sbjct  1    MDDGELEFSNSNMVGELLPSSCS-----MDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  396  HTCYHXHTKIVPA  434
            HTC H HTKI+P+
Sbjct  56   HTCLHVHTKILPS  68



>ref|XP_010489260.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489261.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489262.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489264.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
Length=256

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 6/73 (8%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPD-NSHT  395
            M+DGELEFSN  M+              MDSF +E+L+D+HACTH HTCNP GP+ N+HT
Sbjct  1    MDDGELEFSNSNMVGELLPSSCS-----MDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  396  HTCYHXHTKIVPA  434
            HTC H HTKI+P+
Sbjct  56   HTCLHVHTKILPS  68



>gb|KFK30142.1| hypothetical protein AALP_AA7G222200 [Arabis alpina]
Length=263

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  392
            MEDGEL+FSNQ + SSS+    P SN  MDSF + +L D+H  ACTH HTCNP GP+N+H
Sbjct  1    MEDGELDFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDSHQAACTHTHTCNPTGPENTH  60

Query  393  THTCYHXHTKIVP  431
            THTC+H HTKI+P
Sbjct  61   THTCFHVHTKILP  73



>ref|XP_010467405.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
 ref|XP_010467406.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
Length=259

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 6/73 (8%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPD-NSHT  395
            M+DGELEFSN  M+              MDSF +E+L+D+HACTH HTCNP GP+ N+HT
Sbjct  1    MDDGELEFSNSNMVGELLPSSCS-----MDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  396  HTCYHXHTKIVPA  434
            HTC H HTKI+P+
Sbjct  56   HTCLHVHTKILPS  68



>ref|XP_002869111.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45370.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=261

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGEL+FSNQ + SSS     P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>ref|NP_567974.1| transcription factor bZIP19 [Arabidopsis thaliana]
 gb|AAL62378.1| putative protein [Arabidopsis thaliana]
 gb|AAN15479.1| putative protein [Arabidopsis thaliana]
 gb|AEE86454.1| transcription factor bZIP19 [Arabidopsis thaliana]
Length=261

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGEL+FSNQ + SSS     P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>gb|AAM63358.1| putative transcription factor [Arabidopsis thaliana]
Length=261

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGEL+FSNQ + SSS     P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>emb|CAA17769.1| putative protein [Arabidopsis thaliana]
 emb|CAB80221.1| putative protein [Arabidopsis thaliana]
Length=278

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  395
            MEDGEL+FSNQ + SSS     P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  396  HTCYHXHTKIVP  431
            HTC+H HTKI+P
Sbjct  61   HTCFHVHTKILP  72



>ref|XP_010437531.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
 ref|XP_010437532.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
Length=264

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT----HACTHAHTCNPPGPDN  386
            MEDGELEFSNQ + SSS+    P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPEN  60

Query  387  SHTHTCYHXHTKIVP  431
            +HTHTC+H HTKI+P
Sbjct  61   THTHTCFHVHTKILP  75



>ref|XP_010432347.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
 ref|XP_010432348.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
Length=264

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT----HACTHAHTCNPPGPDN  386
            MEDGELEFSNQ + SSS+    P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPEN  60

Query  387  SHTHTCYHXHTKIVP  431
            +HTHTC+H HTKI+P
Sbjct  61   THTHTCFHVHTKILP  75



>ref|XP_010447005.1| PREDICTED: uncharacterized protein LOC104729711 [Camelina sativa]
Length=261

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT----HACTHAHTCNPPGPDN  386
            MEDGELEFSNQ + SSS+    P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTTTNAACTHTHTCNPTGPEN  60

Query  387  SHTHTCYHXHTKIVP  431
            +HTHTC+H HTKI+P
Sbjct  61   THTHTCFHVHTKILP  75



>ref|XP_009787001.1| PREDICTED: uncharacterized protein LOC104235029 isoform X2 [Nicotiana 
sylvestris]
Length=269

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M +GELE SNQ  +SSSNF   P  +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNGELELSNQETVSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPAP  437
            +CYH HTK+VP P
Sbjct  60   SCYHVHTKVVPPP  72



>ref|XP_009786999.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009787000.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
Length=274

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M +GELE SNQ  +SSSNF   P  +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNGELELSNQETVSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVPAP  437
            +CYH HTK+VP P
Sbjct  60   SCYHVHTKVVPPP  72



>ref|XP_010548099.1| PREDICTED: uncharacterized protein LOC104819648 [Tarenaya hassleriana]
Length=260

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpx--snsYMDSFLNEILKDTHACTHAHTCNPPGPDNSH  392
            M++GEL+FSNQ + SS N        S+  MDSF +E+LKD   CTH HTCNPPGP+N+H
Sbjct  1    MDEGELDFSNQELFSSPNMEGIRIPLSSCSMDSFFDELLKDPQTCTHTHTCNPPGPENTH  60

Query  393  THTCYHXHTKIVP  431
            +HTC+H HTK +P
Sbjct  61   SHTCFHVHTKFLP  73



>ref|XP_006412160.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
 gb|ESQ53613.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
Length=262

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  392
            MEDGEL+FSNQ + SSS+    P SN  +DSF   +L D+H  ACTH HTCNP GP+N+H
Sbjct  1    MEDGELDFSNQEVFSSSDMGELPPSNCSIDSFFEGLLMDSHQAACTHTHTCNPTGPENTH  60

Query  393  THTCYHXHTKIVP  431
            THTC+H HTKI+P
Sbjct  61   THTCFHVHTKILP  73



>ref|XP_011046168.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046178.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046187.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046199.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
Length=267

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT-HACTHAHTCNPPGPDNSHT  395
            M+DGEL++SNQ +  S N    P S SY   FL+E+LKDT HACTH HTCNPPGPDN HT
Sbjct  1    MDDGELDYSNQELFLSPNMDDLPSSCSY--GFLDELLKDTPHACTHTHTCNPPGPDNPHT  58

Query  396  HTCYHXHTKIVPA  434
            H C+H HTK++ +
Sbjct  59   HVCFHAHTKLLSS  71



>ref|XP_008377738.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
 ref|XP_008377739.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
Length=263

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  303  MDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            MDSF +++LKDTHACTHAHTCNPPGPD SHTHTC+H HTKI+ +
Sbjct  22   MDSFFDDLLKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKILSS  65



>ref|XP_009408222.1| PREDICTED: uncharacterized protein LOC103990705 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=239

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE + SN  + S+        S+  MDSF ++IL D H CTH HTCNPPGP+ SHTH
Sbjct  1    MDDGEPDLSNPEVFSTPGAGEDLPSSCSMDSFFDKILNDGHTCTHTHTCNPPGPNLSHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKI+ +P
Sbjct  61   TCFHVHTKILSSP  73



>ref|XP_009408220.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408221.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=273

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE + SN  + S+        S+  MDSF ++IL D H CTH HTCNPPGP+ SHTH
Sbjct  1    MDDGEPDLSNPEVFSTPGAGEDLPSSCSMDSFFDKILNDGHTCTHTHTCNPPGPNLSHTH  60

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKI+ +P
Sbjct  61   TCFHVHTKILSSP  73



>ref|XP_009355669.1| PREDICTED: uncharacterized protein LOC103946638 [Pyrus x bretschneideri]
Length=263

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  303  MDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            MDSF +++LKDTHACTHAHTCNPPGPD SHTHTC+H HTKI+ +
Sbjct  22   MDSFFDDLLKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKILSS  65



>ref|XP_009624365.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624366.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624367.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624368.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
Length=263

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M + EL FSNQ M  SS+        S      NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNRELHFSNQEM-GSSSNFGEIPECSSTKRLFNEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  399  TCYHXHTKIVP  431
            TCYH HTK+VP
Sbjct  60   TCYHVHTKVVP  70



>ref|XP_002313707.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
 gb|EEE87662.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
Length=267

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT-HACTHAHTCNPPGPDNSHT  395
            M+DGEL++SNQ +  S N    P S SY   FL+E+L DT HACTH HTCNPPGPDN HT
Sbjct  1    MDDGELDYSNQELFLSPNMDDLPSSCSY--GFLDELLMDTPHACTHTHTCNPPGPDNPHT  58

Query  396  HTCYHXHTKIVPA  434
            H C+H HTK++ +
Sbjct  59   HVCFHAHTKLLSS  71



>ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus]
Length=262

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS N       +  MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMEIPSSCS--MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus]
 gb|KGN43249.1| DNA binding protein [Cucumis sativus]
Length=270

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS N       +  MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMEIPSSCS--MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>ref|XP_008447959.1| PREDICTED: uncharacterized protein LOC103490288 [Cucumis melo]
Length=270

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGEL+FSNQ + SS N       +  MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNIEIPSSCS--MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  399  TCYHXHTKIVPAP  437
            TC+H HTKIVPAP
Sbjct  59   TCFHVHTKIVPAP  71



>gb|KJB76278.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
 gb|KJB76279.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
Length=249

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGE+E S+  +LS++        ++ +D  ++E LK+T  C+H HTCNPPGPD +H+H
Sbjct  5    MEDGEIELSDHVLLSNTAPSTNFQDSTSVDLIIDEYLKNTRTCSHTHTCNPPGPDVAHSH  64

Query  399  TCYHXHTKIVPA  434
            TCYH HT+++ +
Sbjct  65   TCYHTHTQLLTS  76



>ref|NP_001058591.1| Os06g0716800 [Oryza sativa Japonica Group]
 dbj|BAD53586.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD61716.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF20505.1| Os06g0716800 [Oryza sativa Japonica Group]
 gb|EAZ02370.1| hypothetical protein OsI_24474 [Oryza sativa Indica Group]
 dbj|BAG96347.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92598.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66367.1| hypothetical protein OsJ_22672 [Oryza sativa Japonica Group]
Length=272

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +3

Query  219  MEDGELEFSN-QXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  389
            M+DG+L+FSN    L  +     P  +  MDS+ ++ILKDT  HACTH HTCNPP  D S
Sbjct  1    MDDGDLDFSNPDTFLCPAVGGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDLS  60

Query  390  HTHTCYHXHTKIVPAP  437
            HTHTC H HTKIV AP
Sbjct  61   HTHTCVHVHTKIVSAP  76



>gb|KJB76277.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
Length=257

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGE+E S+  +LS++        ++ +D  ++E LK+T  C+H HTCNPPGPD +H+H
Sbjct  13   MEDGEIELSDHVLLSNTAPSTNFQDSTSVDLIIDEYLKNTRTCSHTHTCNPPGPDVAHSH  72

Query  399  TCYHXHTKIVPA  434
            TCYH HT+++ +
Sbjct  73   TCYHTHTQLLTS  84



>gb|AAL79736.1|AC091774_27 putative transcription factor [Oryza sativa Japonica Group]
Length=297

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +3

Query  219  MEDGELEFSN-QXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  389
            M+DG+L+FSN    L  +     P  +  MDS+ ++ILKDT  HACTH HTCNPP  D S
Sbjct  1    MDDGDLDFSNPDTFLCPAVGGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDLS  60

Query  390  HTHTCYHXHTKIVPAP  437
            HTHTC H HTKIV AP
Sbjct  61   HTHTCVHVHTKIVSAP  76



>ref|NP_001141059.1| uncharacterized protein LOC100273140 [Zea mays]
 ref|XP_008681415.1| PREDICTED: uncharacterized protein LOC100273140 isoform X1 [Zea 
mays]
 gb|ACF85309.1| unknown [Zea mays]
 gb|ADX60074.1| bZIP transcription factor [Zea mays]
 gb|AFW69520.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW69521.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW69522.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW69523.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AIB04274.1| bZIP transcription factor, partial [Zea mays]
Length=276

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>gb|ACG32751.1| DNA binding protein [Zea mays]
Length=276

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>ref|XP_002439031.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
 gb|EER90398.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
Length=273

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>ref|XP_004966468.1| PREDICTED: uncharacterized protein LOC101762708 isoform X1 [Setaria 
italica]
 ref|XP_004966469.1| PREDICTED: uncharacterized protein LOC101762708 isoform X2 [Setaria 
italica]
Length=261

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ ++ILKDT  HACTH HTCNPP  D+SH
Sbjct  1    MDDGDLDFSNPDTFLCPAIGNDPPSSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDHSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>gb|AFW69519.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=332

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>ref|XP_009391011.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391012.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            ME+G+L+FSN  + S  N    P   S MDS  + I  D+  H CTH HTCNPPGPD SH
Sbjct  1    MEEGDLDFSNPEVFSGPNAGDLPSGCS-MDSVFDNIFNDSQQHTCTHTHTCNPPGPDLSH  59

Query  393  THTCYHXHTKIVPAP  437
            THTC+H HTKI+ AP
Sbjct  60   THTCFHVHTKILSAP  74



>ref|XP_006656494.1| PREDICTED: uncharacterized protein LOC102721653 [Oryza brachyantha]
Length=269

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +3

Query  219  MEDGELEFSN--QXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDN  386
            M+DG+++FSN    +  ++     P  +  MDS+ ++ILKDT  HACTH HTCNPP  D 
Sbjct  1    MDDGDIDFSNPDTFLCPAAGAGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDL  60

Query  387  SHTHTCYHXHTKIVPAP  437
            SHTHTC H HTKIV AP
Sbjct  61   SHTHTCVHVHTKIVSAP  77



>ref|XP_009401478.1| PREDICTED: uncharacterized protein LOC103985487 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  392
            M++G+++FSN  + S  +      S+  MDSF + I  ++  H+CTH HTCNPPGPD SH
Sbjct  1    MDEGDVDFSNPEVFSGPSAGEDLPSSCSMDSFFDNIFNESQQHSCTHTHTCNPPGPDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKI+ A
Sbjct  61   THTCLHVHTKILTA  74



>ref|XP_009136335.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
 ref|XP_009136337.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
Length=239

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  EILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            E+L+D+HACTH HTCNPPGP+N+HTHTC H HTKI+PA
Sbjct  21   ELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPA  58



>emb|CDX89748.1| BnaC03g46620D [Brassica napus]
Length=248

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  EILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            E+L+D+HACTH HTCNPPGP+N+HTHTC H HTKI+PA
Sbjct  21   ELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPA  58



>emb|CDY02237.1| BnaA03g39300D [Brassica napus]
Length=239

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  EILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            E+L+D+HACTH HTCNPPGP+N+HTHTC H HTKI+PA
Sbjct  21   ELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPA  58



>ref|NP_001148839.1| LOC100282457 [Zea mays]
 gb|ACG33099.1| DNA binding protein [Zea mays]
Length=267

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ +EILKDT   ACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHLACTHTHTCNPPVHDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>ref|XP_008647848.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647849.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647850.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647851.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647852.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647853.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 gb|ACF83160.1| unknown [Zea mays]
 gb|ACN29059.1| unknown [Zea mays]
 gb|ACR33895.1| unknown [Zea mays]
 gb|AFU81623.1| bZIP-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW75759.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW75760.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW75761.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW75762.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AFW75763.1| putative bZIP transcription factor superfamily protein isoform 
5 [Zea mays]
 gb|AFW75764.1| putative bZIP transcription factor superfamily protein isoform 
6 [Zea mays]
 gb|AFW75765.1| putative bZIP transcription factor superfamily protein isoform 
7 [Zea mays]
Length=267

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN            P S+  MDS+ +EILKDT   ACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHLACTHTHTCNPPVHDLSH  60

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  61   THTCVHVHTKIVAA  74



>gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis]
Length=270

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            MEDGE++FSNQ + SS N    P ++S+ +SFLN+  ++T  CTH H CNPP  D+SH+H
Sbjct  1    MEDGEIDFSNQEVCSSPNIGELPKTSSW-ESFLNDFQRET--CTHTHICNPPRLDSSHSH  57

Query  399  TCYHXHTKIVPA  434
            TC H HTKIVPA
Sbjct  58   TCRHVHTKIVPA  69



>ref|XP_011088608.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
 ref|XP_011088609.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
Length=287

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 17/90 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsY-MDSFLN----------------EILKDTHAC  347
            M+DGEL+F +  MLS  +      S S+ +D FL                 ++L  T AC
Sbjct  1    MDDGELDFPSDQMLSCLDMTNAQSSCSFDIDEFLGRTQACNDALGRTEAYTDVLGRTQAC  60

Query  348  THAHTCNPPGPDNSHTHTCYHXHTKIVPAP  437
            THAH CNP GPD SHTHTC H HT+I+P+P
Sbjct  61   THAHACNPSGPDKSHTHTCIHVHTQIMPSP  90



>gb|EMT00406.1| hypothetical protein F775_29696 [Aegilops tauschii]
Length=266

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  392
            M+DG+L+FSN      +         S MDS+ +E L DT   ACTH HTCNPP  D+SH
Sbjct  1    MDDGDLDFSNPEAYLDTGADLPGGGCS-MDSYFDEFLNDTEHLACTHTHTCNPPVDDSSH  59

Query  393  THTCYHXHTKIVPA  434
            THTC H HTKIV A
Sbjct  60   THTCVHVHTKIVSA  73



>ref|XP_003563276.1| PREDICTED: uncharacterized protein LOC100823660 [Brachypodium 
distachyon]
Length=269

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxs--nsYMDSFLNEILKDTH--ACTHAHTCNPPGPDN  386
            M+DG+L+F+    L S        +     MDS+ +EILKDT   ACTH HTCNPP  D 
Sbjct  1    MDDGDLDFNPDTYLCSGAAAGGTETPGACSMDSYFDEILKDTEHLACTHTHTCNPPVHDL  60

Query  387  SHTHTCYHXHTKIVPA  434
            SHTHTC H HTKIV A
Sbjct  61   SHTHTCVHVHTKIVSA  76



>ref|XP_011092974.1| PREDICTED: uncharacterized protein LOC105173033 isoform X2 [Sesamum 
indicum]
Length=287

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 51/90 (57%), Gaps = 17/90 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsY-MDSFLN----------------EILKDTHAC  347
            M D ELEF ++ +LS  +      S S+ +D FL                 ++L  THAC
Sbjct  1    MYDTELEFPSEELLSCLDMANAQSSCSFDIDEFLVRTQACNDALGGTEACPDLLGRTHAC  60

Query  348  THAHTCNPPGPDNSHTHTCYHXHTKIVPAP  437
            THAH CNPPGPD SHTHTC H HT+I+P P
Sbjct  61   THAHACNPPGPDKSHTHTCIHVHTQIMPTP  90



>ref|XP_011092972.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
 ref|XP_011092973.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
Length=288

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 51/90 (57%), Gaps = 17/90 (19%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsY-MDSFLN----------------EILKDTHAC  347
            M D ELEF ++ +LS  +      S S+ +D FL                 ++L  THAC
Sbjct  1    MYDTELEFPSEELLSCLDMANAQSSCSFDIDEFLVRTQACNDALGGTEACPDLLGRTHAC  60

Query  348  THAHTCNPPGPDNSHTHTCYHXHTKIVPAP  437
            THAH CNPPGPD SHTHTC H HT+I+P P
Sbjct  61   THAHACNPPGPDKSHTHTCIHVHTQIMPTP  90



>ref|XP_010920114.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920115.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920117.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
Length=262

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +3

Query  303  MDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHXHTKIVPAP  437
            ++ F +E +KD   H+CTH HTCNPPGPD SH+HTC+H HTKI+ AP
Sbjct  25   INGFFDESVKDMPRHSCTHTHTCNPPGPDLSHSHTCFHAHTKILSAP  71



>ref|XP_009418779.1| PREDICTED: uncharacterized protein LOC103998893 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 6/75 (8%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKD--THACTHAHTCNPPGPDNSH  392
            M+DG+++FSN  + S  N       +  +DSF ++I  D   H CTH HTCNP     SH
Sbjct  1    MDDGDIDFSNPDVFSGPNAGDDLPGSRSIDSFFDDIFNDGQQHTCTHTHTCNPL----SH  56

Query  393  THTCYHXHTKIVPAP  437
            THTC+H HTKIV AP
Sbjct  57   THTCFHVHTKIVSAP  71



>ref|XP_006846902.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
 gb|ERN08483.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
Length=293

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxs---nsYMDSFLNEI-LKDTHA--CTHAHTCNPP-G  377
            MEDGE++FSNQ + S  +             M SF  ++ +KD H+  CTH HTCNPP G
Sbjct  1    MEDGEIDFSNQDVFSRPSMEMGLGDCDDGCSMGSFFEDLFVKDIHSQSCTHTHTCNPPAG  60

Query  378  PDNSHTHTCYHXHTKIV  428
            PD +HTHTC+H HTKI+
Sbjct  61   PDLAHTHTCFHVHTKIL  77



>ref|XP_008790182.1| PREDICTED: uncharacterized protein LOC103707462 [Phoenix dactylifera]
Length=268

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 2/45 (4%)
 Frame = +3

Query  300  YMDSFLNEILKD--THACTHAHTCNPPGPDNSHTHTCYHXHTKIV  428
            ++D F +E +KD   H+CTH HTCNPPG D SHTHTC+H HT+I+
Sbjct  27   WIDGFFDESVKDMPRHSCTHTHTCNPPGGDLSHTHTCFHAHTRIL  71



>ref|XP_008813516.1| PREDICTED: uncharacterized protein LOC103724133, partial [Phoenix 
dactylifera]
Length=277

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 2/45 (4%)
 Frame = +3

Query  300  YMDSFLNEILKD--THACTHAHTCNPPGPDNSHTHTCYHXHTKIV  428
            ++D F +E +KD   H+CTH HTCNPPG D SHTHTC+H HT+I+
Sbjct  25   WIDGFFDESVKDMPRHSCTHTHTCNPPGGDLSHTHTCFHAHTRIL  69



>gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Erythranthe guttata]
Length=288

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 47/90 (52%), Gaps = 17/90 (19%)
 Frame = +3

Query  219  MEDGELEF-SNQXMLsssnfcxfpxsnsYMDSFLN----------------EILKDTHAC  347
            M+DGEL+F S+Q M            +  +D FL                 ++L  T AC
Sbjct  1    MDDGELDFPSDQMMSCLDLPNAQSSCSFDIDEFLGRTQSCNDALGRTEAYTDVLGRTQAC  60

Query  348  THAHTCNPPGPDNSHTHTCYHXHTKIVPAP  437
            THAH CNP GPD SHTHTC H HT+I+ +P
Sbjct  61   THAHACNPSGPDKSHTHTCIHVHTQIMHSP  90



>ref|XP_008800178.1| PREDICTED: uncharacterized protein LOC103714633 isoform X2 [Phoenix 
dactylifera]
Length=266

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  303  MDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            ++ F +E LKD   H+CTH HTCN PGP+ SHTHTC+H HTKIV A
Sbjct  29   INDFFDESLKDVPHHSCTHTHTCNHPGPNLSHTHTCFHVHTKIVSA  74



>ref|XP_008800177.1| PREDICTED: uncharacterized protein LOC103714633 isoform X1 [Phoenix 
dactylifera]
Length=271

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  303  MDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHXHTKIVPA  434
            ++ F +E LKD   H+CTH HTCN PGP+ SHTHTC+H HTKIV A
Sbjct  29   INDFFDESLKDVPHHSCTHTHTCNHPGPNLSHTHTCFHVHTKIVSA  74



>ref|XP_010935120.1| PREDICTED: uncharacterized protein LOC105055101 [Elaeis guineensis]
Length=273

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHT--CNPPGPDNSH  392
            M++G+L+ SN    S  +      S+  MDSF +EILKDTH  +  HT  CNPPGPD SH
Sbjct  1    MDEGDLDLSNPEAFSGPSMGEDLPSSCSMDSFFDEILKDTHHHSCTHTHTCNPPGPDLSH  60

Query  393  THTCYHXHTKIVPAP  437
            THTC+H HTKI+ AP
Sbjct  61   THTCFHVHTKILSAP  75



>ref|XP_011091785.1| PREDICTED: putative transcription factor kapC [Sesamum indicum]
Length=256

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE+E S++ +L +S+      ++   DSFL+++L++   CTH HTCNPPGPD +HTH
Sbjct  5    MDDGEVELSDRLLLPNSDSSSNIQASLSADSFLDDLLRNAQTCTHTHTCNPPGPDTAHTH  64

Query  399  TCYHXHTKIVPA  434
            TCYH HT ++P+
Sbjct  65   TCYHTHTHVIPS  76



>emb|CDX69107.1| BnaC01g03460D [Brassica napus]
Length=271

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 13/84 (15%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpx-snsYMDSFLNEILKDTH----------ACTHAHTC  365
            MEDGELEFSNQ + SSS+       SN  +DSF + +L D+H          ACTH HTC
Sbjct  1    MEDGELEFSNQEVFSSSDVVGGLPPSNGSIDSFFDGLLMDSHHQHQHQHQQGACTHTHTC  60

Query  366  N--PPGPDNSHTHTCYHXHTKIVP  431
            N      DN+H+HTC+H HTK++P
Sbjct  61   NNSTGTADNTHSHTCFHVHTKVLP  84



>ref|XP_004289872.1| PREDICTED: uncharacterized protein LOC101314521 [Fragaria vesca 
subsp. vesca]
Length=276

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  219  MEDGELEFSNQXM-LsssnfcxfpxsnsYMDSFLNEILKDTH-ACTHAHTCNPP-GPDNS  389
            M+DGEL+FSNQ +  S  N      S+  M++   +  K+T  ACTH H CNPP GPD++
Sbjct  1    MDDGELDFSNQELDFSIPNMTGELPSSCSMENIFGDFFKETDTACTHNHICNPPSGPDSA  60

Query  390  HTHTCYHXHTKIVPA  434
            H HTC H HTKI+ +
Sbjct  61   HRHTCIHVHTKILSS  75



>gb|EPS65924.1| hypothetical protein M569_08855 [Genlisea aurea]
Length=246

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  EILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVPAP  437
            ++L  T ACTHAH CNP GPD SHTHTC H HT+I+ +P
Sbjct  50   DVLGRTQACTHAHACNPSGPDKSHTHTCIHVHTQIMASP  88



>gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza kurrooa]
Length=289

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  EILKDTHACTHAHTCNPPGPDNSHTHTCYHXHTKIVP  431
            ++L  T ACTHAH CNP GPD SHTHTC H HT+I+P
Sbjct  52   DVLGRTQACTHAHACNPSGPDKSHTHTCIHVHTQIMP  88



>ref|XP_001758867.1| predicted protein [Physcomitrella patens]
 gb|EDQ76373.1| predicted protein, partial [Physcomitrella patens]
Length=171

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnf---cxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDN  386
            M+DGELEF++  + +  +       P +   M++FL E+L+ THACTH HTCNPPGPDN
Sbjct  1    MDDGELEFTDHDVFAGCSLCDLPSTPTTMGSMENFLEEVLRSTHACTHTHTCNPPGPDN  59



>ref|XP_008788583.1| PREDICTED: uncharacterized protein LOC103706294 [Phoenix dactylifera]
Length=225

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNS-HT  395
            M+DGE++ S+  +L +            M +  +E L+++  CTH HTCNPPGP  + HT
Sbjct  1    MDDGEVDLSSHLLLPNPE----------MTNSFDEYLRNSRTCTHTHTCNPPGPAAAMHT  50

Query  396  HTCYHXHTKI  425
            HTCYH H ++
Sbjct  51   HTCYHTHMQV  60



>emb|CDP21594.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+D E+E S+  ++ +S+      ++  +DSFL+E+L++   CTH HTCNPPGPD +HTH
Sbjct  1    MDDREVELSHPVLVPNSDSSSSVQASISVDSFLDELLRNAQTCTHTHTCNPPGPDAAHTH  60

Query  399  TCYHXHTKIVPA  434
            TCYH HT+++P+
Sbjct  61   TCYHTHTQVIPS  72



>ref|XP_007149027.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 ref|XP_007149028.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21021.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21022.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
Length=260

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  336  THACTHAHTCNPPGPDNSHTHTCYHXHTKI  425
            +  CTH HTCNPPGPD +HTHTCYH HT+I
Sbjct  44   SRTCTHTHTCNPPGPDAAHTHTCYHSHTQI  73



>ref|XP_009106517.1| PREDICTED: uncharacterized protein LOC103832273 [Brassica rapa]
Length=237

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 40/77 (52%), Gaps = 21/77 (27%)
 Frame = +3

Query  219  MEDGELE-FSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH-----ACTHAHTCNPPGP  380
            MEDGELE FS+   +               DSF + +L D+H     ACTH HTCN    
Sbjct  1    MEDGELEVFSSNGSI---------------DSFFDGLLMDSHHHQQGACTHTHTCNNSTG  45

Query  381  DNSHTHTCYHXHTKIVP  431
               H HTC+H HTKI+P
Sbjct  46   TEPHAHTCFHVHTKILP  62



>gb|EMS47152.1| hypothetical protein TRIUR3_12850 [Triticum urartu]
Length=195

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 12/69 (17%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DG+L+FS+  M             SY D  L    +    CTH HTCNPP  D  HTH
Sbjct  1    MDDGDLDFSSMSM------------GSYFDDLLGGTAEHLACCTHTHTCNPPAHDLPHTH  48

Query  399  TCYHXHTKI  425
            TC+H H+K 
Sbjct  49   TCHHVHSKF  57



>emb|CDY52654.1| BnaAnng11690D [Brassica napus]
Length=238

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 40/78 (51%), Gaps = 22/78 (28%)
 Frame = +3

Query  219  MEDGELE-FSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTH------ACTHAHTCNPPG  377
            MEDGELE FS+   +               DSF + +L D+H      ACTH HTCN   
Sbjct  1    MEDGELEVFSSNGSI---------------DSFFDGLLMDSHHQHQQGACTHTHTCNNST  45

Query  378  PDNSHTHTCYHXHTKIVP  431
                H HTC+H HTKI+P
Sbjct  46   GTEPHAHTCFHVHTKILP  63



>ref|XP_009354398.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
 ref|XP_009354399.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
Length=245

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DGE+  S+  +L + N       ++Y D+F +E LK    CTH HTCNPPGP+ +HTH
Sbjct  1    MDDGEVVTSDHALLPNPNSSSNFHGSTYEDTFFDEFLKTARTCTHTHTCNPPGPEAAHTH  60

Query  399  TCYHXHTKIVPA  434
            TCYH HT+++P+
Sbjct  61   TCYHTHTQVLPS  72



>ref|XP_008344616.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008344617.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008363297.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
 ref|XP_008363299.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
Length=245

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPD  383
            M+DGE+  S+  +L + N       ++Y D+F +E LK    CTH HTCNPPGPD
Sbjct  1    MDDGEVVTSDHALLPNPNSSSTFHGSTYEDTFFDEFLKTARTCTHTHTCNPPGPD  55



>gb|EMT32723.1| hypothetical protein F775_08202 [Aegilops tauschii]
Length=176

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 36/69 (52%), Gaps = 12/69 (17%)
 Frame = +3

Query  219  MEDGELEFSNQXMLsssnfcxfpxsnsYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  398
            M+DG+L+FS+  M             SY D  L    +    CTH HTCNPP  D  H+H
Sbjct  1    MDDGDLDFSSMSM------------GSYFDDVLGGAAEHLACCTHTHTCNPPAHDLPHSH  48

Query  399  TCYHXHTKI  425
            TC+H H+K 
Sbjct  49   TCHHVHSKF  57



>gb|EMT32714.1| hypothetical protein F775_17324 [Aegilops tauschii]
Length=188

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +3

Query  303  MDSFLNEILKDTH--ACTHAHTCNPPGPDNSHTHTCYHXHTKI  425
            M S+ ++IL DT   ACTH HTCNPP     HTHTC H H+KI
Sbjct  11   MGSYFDDILMDTEQVACTHTHTCNPPAHHLPHTHTCLHVHSKI  53



>emb|CAB41316.1| putative protein [Arabidopsis thaliana]
Length=157

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +3

Query  336  THACTHAHTCNPPGP-DNSHTHTCYHXHTKIVPAP  437
            T  C+H H+CNPPGP D SH+HTC+H HT ++ + 
Sbjct  13   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISQ  47



>gb|EMS52367.1| hypothetical protein TRIUR3_01653 [Triticum urartu]
Length=182

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = +3

Query  303  MDSFLNEILKDTH--ACTHAHTCNPPGPDNSHTHTCYHXHTKI  425
            M S+ ++IL DT   ACTH HTCNPP     HTHTC H H+K 
Sbjct  11   MGSYFDDILMDTEQVACTHTHTCNPPAHHLPHTHTCLHVHSKF  53



>ref|XP_006403861.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
 gb|ESQ45314.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
Length=176

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  330  KDTHACTHAHTCNPPGP-DNSHTHTCYHXHTKIV  428
            + +  C+H H+CNPPGP D SH+HTC+H HT ++
Sbjct  11   RASRGCSHTHSCNPPGPEDASHSHTCFHAHTHLI  44



>ref|XP_010104020.1| hypothetical protein L484_001603 [Morus notabilis]
 gb|EXB97908.1| hypothetical protein L484_001603 [Morus notabilis]
Length=232

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  303  MDSFLNEILKDTHACTHAHTCNPPGPDN  386
            +DSF++++LK+   CTH HTCNPPGPD+
Sbjct  3    LDSFIDDLLKNARTCTHTHTCNPPGPDS  30



>ref|XP_006291938.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
 gb|EOA24836.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
Length=171

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +3

Query  336  THACTHAHTCNPPGPDN-SHTHTCYHXHTKIV  428
            +  C+H H+CNPPGPD+ SH+HTC+H HT ++
Sbjct  15   SRGCSHTHSCNPPGPDDASHSHTCFHTHTHLI  46



>ref|NP_190764.2| basic leucine zipper 24 [Arabidopsis thaliana]
 gb|AEE78868.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=228

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +3

Query  336  THACTHAHTCNPPGP-DNSHTHTCYHXHTKIV  428
            T  C+H H+CNPPGP D SH+HTC+H HT ++
Sbjct  52   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLI  83



>ref|NP_850680.1| basic leucine zipper 24 [Arabidopsis thaliana]
 dbj|BAC42285.1| putative bZip transcription factor Atbzip24 [Arabidopsis thaliana]
 gb|AAO63842.1| putative bZIP family transcription factor [Arabidopsis thaliana]
 gb|AEE78869.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=227

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +3

Query  336  THACTHAHTCNPPGP-DNSHTHTCYHXHTKIV  428
            T  C+H H+CNPPGP D SH+HTC+H HT ++
Sbjct  52   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLI  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860