BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016E09

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    269   2e-85   Sesamum indicum [beniseed]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                260   3e-82   Erythranthe guttata [common monkey flower]
gb|KJB42342.1|  hypothetical protein B456_007G150200                    252   3e-81   Gossypium raimondii
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             258   4e-81   Populus trichocarpa [western balsam poplar]
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    258   5e-81   Vitis vinifera
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    257   5e-81   Populus euphratica
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    257   9e-81   Elaeis guineensis
gb|KJB42341.1|  hypothetical protein B456_007G150200                    253   2e-80   Gossypium raimondii
gb|KJB42337.1|  hypothetical protein B456_007G150200                    254   3e-80   Gossypium raimondii
emb|CDP03802.1|  unnamed protein product                                255   6e-80   Coffea canephora [robusta coffee]
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    254   6e-80   Phoenix dactylifera
gb|KJB42340.1|  hypothetical protein B456_007G150200                    254   7e-80   Gossypium raimondii
gb|ABK94679.1|  unknown                                                 254   7e-80   Populus trichocarpa [western balsam poplar]
gb|KJB42338.1|  hypothetical protein B456_007G150200                    253   1e-79   Gossypium raimondii
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    254   1e-79   Pyrus x bretschneideri [bai li]
gb|KJB42335.1|  hypothetical protein B456_007G150200                    254   1e-79   Gossypium raimondii
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    253   2e-79   Prunus mume [ume]
gb|KDP26455.1|  hypothetical protein JCGZ_17613                         253   3e-79   Jatropha curcas
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             253   3e-79   
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    253   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    252   4e-79   Malus domestica [apple tree]
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    253   6e-79   
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    251   2e-78   Glycine max [soybeans]
gb|ACU23211.1|  unknown                                                 251   2e-78   Glycine max [soybeans]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    251   2e-78   Fragaria vesca subsp. vesca
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    250   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    250   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    250   4e-78   
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    249   5e-78   
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    249   6e-78   
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             249   8e-78   
ref|XP_010091822.1|  hypothetical protein L484_015891                   248   2e-77   Morus notabilis
gb|KGN46368.1|  hypothetical protein Csa_6G087960                       246   1e-76   Cucumis sativus [cucumbers]
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    245   2e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    244   6e-76   Solanum tuberosum [potatoes]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    244   7e-76   Cucumis melo [Oriental melon]
gb|AFK48198.1|  unknown                                                 244   9e-76   Lotus japonicus
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             243   1e-75   Phaseolus vulgaris [French bean]
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    243   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    243   3e-75   
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    243   3e-75   Cicer arietinum [garbanzo]
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    240   2e-74   
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    239   4e-74   Eucalyptus grandis [rose gum]
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    238   5e-74   
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    239   7e-74   Tarenaya hassleriana [spider flower]
gb|ACJ84721.1|  unknown                                                 239   7e-74   Medicago truncatula
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             239   9e-74   Eutrema salsugineum [saltwater cress]
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    238   1e-73   Nicotiana tomentosiformis
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    237   3e-73   Brassica rapa
ref|NP_001048516.1|  Os02g0816800                                       237   4e-73   
emb|CDY31970.1|  BnaA07g00250D                                          237   4e-73   Brassica napus [oilseed rape]
gb|EEC74241.1|  hypothetical protein OsI_09443                          237   4e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    234   5e-73   Nicotiana sylvestris
emb|CDY39772.1|  BnaA09g10240D                                          236   7e-73   Brassica napus [oilseed rape]
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    236   7e-73   Arabis alpina [alpine rockcress]
ref|XP_006296717.1|  hypothetical protein CARUB_v10014190mg             234   9e-73   
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    235   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_006854436.1|  hypothetical protein AMTR_s00039p00218660          235   2e-72   Amborella trichopoda
emb|CDY05746.1|  BnaC07g00570D                                          235   3e-72   
emb|CDY03308.1|  BnaC09g10400D                                          235   3e-72   
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    235   4e-72   Brassica rapa
gb|EPS69627.1|  hypothetical protein M569_05135                         233   4e-72   Genlisea aurea
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    234   7e-72   Brassica rapa
emb|CDY13877.1|  BnaA09g43790D                                          234   7e-72   Brassica napus [oilseed rape]
emb|CDX81965.1|  BnaC08g36360D                                          234   9e-72   
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          233   2e-71   Sorghum bicolor [broomcorn]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                232   4e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             232   4e-71   
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    231   9e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    230   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    230   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    230   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    228   1e-69   Setaria italica
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    226   6e-69   
gb|ACF85773.1|  unknown                                                 226   1e-68   Zea mays [maize]
ref|NP_001149069.1|  LOC100282690                                       226   1e-68   
gb|ABK24353.1|  unknown                                                 225   2e-68   Picea sitchensis
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  226   3e-68   
dbj|BAJ86608.1|  predicted protein                                      222   4e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB42336.1|  hypothetical protein B456_007G150200                    202   4e-60   Gossypium raimondii
gb|KHG08643.1|  hypothetical protein F383_12346                         194   6e-57   Gossypium arboreum [tree cotton]
dbj|BAH20309.1|  AT2G20360                                              191   6e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   190   8e-56   Citrus sinensis [apfelsine]
ref|XP_001765756.1|  predicted protein                                  185   4e-53   
gb|EEE58042.1|  hypothetical protein OsJ_08874                          162   4e-45   Oryza sativa Japonica Group [Japonica rice]
gb|KJB42339.1|  hypothetical protein B456_007G150200                    160   9e-44   Gossypium raimondii
dbj|BAG95473.1|  unnamed protein product                                158   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    153   1e-41   
ref|XP_001757609.1|  predicted protein                                  154   2e-41   
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             152   4e-41   
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              151   2e-40   
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    146   6e-39   Triticum urartu
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    146   7e-39   
ref|XP_007510295.1|  predicted protein                                  146   4e-38   Bathycoccus prasinos
ref|XP_001420142.1|  predicted protein                                  144   7e-38   Ostreococcus lucimarinus CCE9901
dbj|GAA99675.1|  hypothetical protein E5Q_06378                         142   5e-37   Mixia osmundae IAM 14324
ref|XP_005537134.1|  NADH dehydrogenase I alpha subcomplex 9, mit...    142   1e-36   Cyanidioschyzon merolae strain 10D
ref|XP_007872120.1|  hypothetical protein PNEG_00249                    141   1e-36   Pneumocystis murina B123
ref|XP_004339653.1|  NADH dehydrogenase, putative                       141   1e-36   Acanthamoeba castellanii str. Neff
ref|XP_005681037.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   3e-36   Capra hircus [domestic goat]
gb|KIO18953.1|  hypothetical protein M407DRAFT_153532                   140   3e-36   Tulasnella calospora MUT 4182
ref|XP_004006995.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   3e-36   
ref|XP_006957558.1|  NAD(P)-binding protein                             140   4e-36   Wallemia mellicola CBS 633.66
ref|XP_008274666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   5e-36   Stegastes partitus
ref|XP_002736180.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   6e-36   Saccoglossus kowalevskii
ref|XP_002504449.1|  predicted protein                                  139   8e-36   Micromonas commoda
ref|XP_007902354.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   8e-36   Callorhinchus milii [Australian ghost shark]
gb|KIJ17694.1|  hypothetical protein PAXINDRAFT_167681                  139   9e-36   Paxillus involutus ATCC 200175
ref|NP_001094222.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    139   9e-36   Rattus norvegicus [brown rat]
ref|XP_003126608.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   9e-36   Sus scrofa [pigs]
gb|AAH91192.1|  Ndufa9 protein                                          139   9e-36   Rattus norvegicus [brown rat]
ref|NP_001279619.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    139   1e-35   Callorhinchus milii [Australian ghost shark]
ref|XP_006237562.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35   Rattus norvegicus [brown rat]
ref|XP_001626712.1|  predicted protein                                  138   1e-35   Nematostella vectensis
ref|XP_005084120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   2e-35   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007469502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   3e-35   Lipotes vexillifer [baiji]
gb|KDN41067.1|  putative NADH2 dehydrogenase 40K chain                  138   3e-35   Tilletiaria anomala UBC 951
ref|XP_002712902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   3e-35   Oryctolagus cuniculus [domestic rabbit]
gb|AAH05760.1|  Ndufa9 protein                                          137   3e-35   Mus musculus [mouse]
ref|XP_004610502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   4e-35   Sorex araneus [Eurasian shrew]
gb|KIK91888.1|  hypothetical protein PAXRUDRAFT_830459                  137   4e-35   Paxillus rubicundulus Ve08.2h10
gb|EAW88839.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    134   4e-35   Homo sapiens [man]
gb|KDQ62587.1|  hypothetical protein JAAARDRAFT_30488                   137   5e-35   Jaapia argillacea MUCL 33604
ref|XP_008574858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   5e-35   Galeopterus variegatus [Malayan flying lemur]
dbj|BAK63310.1|  NADH dehydrogenase                                     135   5e-35   Pan troglodytes
ref|NP_079634.2|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    137   5e-35   Mus musculus [mouse]
ref|XP_004279068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   6e-35   Orcinus orca [Orca]
ref|XP_005334075.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   6e-35   
ref|XP_006053611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   8e-35   Bubalus bubalis [domestic water buffalo]
ref|XP_010843290.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   8e-35   Bison bison bison
ref|XP_004347048.1|  Ndufa9 protein                                     135   8e-35   Capsaspora owczarzaki ATCC 30864
ref|XP_006795902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   8e-35   Neolamprologus brichardi [lyretail cichlid]
emb|CEF99374.1|  NAD(P)-binding domain                                  136   9e-35   Ostreococcus tauri
ref|XP_005957904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   1e-34   Pantholops hodgsonii [Tibetan antelope]
ref|XP_003496081.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   1e-34   Cricetulus griseus [Chinese hamsters]
ref|NP_001073383.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    136   1e-34   Pan troglodytes
gb|ABH12231.1|  mitochondrial complex I subunit NDUFA9                  136   1e-34   Pongo pygmaeus [orang utan]
ref|XP_007935381.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-34   Orycteropus afer afer
ref|XP_007170262.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-34   Balaenoptera acutorostrata scammoni
ref|NP_001127602.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    135   1e-34   Pongo abelii [orang utan]
ref|XP_006987942.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-34   
ref|XP_009546417.1|  hypothetical protein HETIRDRAFT_475334             135   2e-34   Heterobasidion irregulare TC 32-1
ref|NP_001013477.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    134   2e-34   
ref|XP_003390219.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   2e-34   Amphimedon queenslandica
gb|AAH03351.1|  Similar to NADH dehydrogenase (ubiquinone) 1 alph...    134   2e-34   Homo sapiens [man]
ref|XP_003796469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   2e-34   Otolemur garnettii
gb|KDN34621.1|  hypothetical protein RSAG8_12283                        130   2e-34   Rhizoctonia solani AG-8 WAC10335
ref|XP_009266962.1|  hypothetical protein J056_003464                   135   2e-34   Wallemia ichthyophaga EXF-994
ref|XP_005365322.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-34   
ref|XP_005365321.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-34   Microtus ochrogaster [prairie voles]
sp|Q0MQB3.2|NDUA9_GORGO  RecName: Full=NADH dehydrogenase [ubiqui...    135   3e-34   Gorilla gorilla gorilla [lowland gorilla]
ref|NP_001266630.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    135   3e-34   Gorilla gorilla [gorilla]
ref|XP_003988339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-34   Felis catus [cat]
gb|ELR54825.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    134   3e-34   Bos mutus
gb|AAA36350.1|  NADH dehydrogenase (ubiquinone)                         134   3e-34   Homo sapiens [man]
gb|AIC62000.1|  NDUFA9                                                  134   3e-34   synthetic construct
gb|ABF57357.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    134   3e-34   Bos taurus [bovine]
ref|NP_991386.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    135   3e-34   Bos taurus [bovine]
ref|NP_004993.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    134   3e-34   Homo sapiens [man]
gb|EFB28697.1|  hypothetical protein PANDA_009221                       134   3e-34   Ailuropoda melanoleuca
gb|AAI53423.1|  Ndufa9 protein                                          134   4e-34   Danio rerio [leopard danio]
ref|XP_001515711.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-34   
ref|XP_005897993.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   4e-34   Bos mutus
ref|XP_010963120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   4e-34   Camelus bactrianus [camel]
ref|XP_006210904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   4e-34   Vicugna pacos
ref|XP_006633741.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   4e-34   Lepisosteus oculatus
gb|KDQ20806.1|  hypothetical protein BOTBODRAFT_26820                   134   5e-34   Botryobasidium botryosum FD-172 SS1
ref|XP_006175621.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   5e-34   
dbj|BAB22596.1|  unnamed protein product                                134   5e-34   Mus musculus [mouse]
gb|EAW88838.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    134   5e-34   Homo sapiens [man]
ref|XP_002920485.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   5e-34   Ailuropoda melanoleuca
ref|XP_006739694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   5e-34   Leptonychotes weddellii
ref|XP_006754928.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   5e-34   Myotis davidii
ref|XP_007089756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   6e-34   
ref|XP_002920484.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   6e-34   
gb|EFA77105.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9         134   6e-34   Heterostelium album PN500
ref|XP_001494651.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   6e-34   Equus caballus [domestic horse]
ref|XP_006862735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   6e-34   Chrysochloris asiatica
ref|XP_008528773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   6e-34   Equus przewalskii [Przewalski horse]
ref|XP_005174380.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   6e-34   
gb|AAI52140.1|  Ndufa9 protein                                          134   6e-34   Danio rerio [leopard danio]
ref|XP_008823675.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   6e-34   Nannospalax galili
ref|XP_005950396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   7e-34   Haplochromis burtoni
ref|XP_005950395.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   7e-34   Haplochromis burtoni
gb|AAH68378.1|  Ndufa9 protein                                          134   8e-34   Danio rerio [leopard danio]
ref|XP_005734821.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   8e-34   Pundamilia nyererei
ref|XP_005734820.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   8e-34   Pundamilia nyererei
ref|XP_007503809.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-33   Monodelphis domestica
ref|XP_534915.3|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    133   1e-33   Canis lupus familiaris [dogs]
ref|XP_003410681.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-33   Loxodonta africana [African bush elephant]
ref|XP_004459092.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-33   Dasypus novemcinctus
ref|XP_010357461.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-33   Rhinopithecus roxellana
ref|XP_001372251.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   2e-33   Monodelphis domestica
gb|ETS63618.1|  hypothetical protein PaG_01917                          133   2e-33   Moesziomyces aphidis DSM 70725
gb|ETN62206.1|  NADH-ubiquinone oxidoreductase 39 kda subunit           133   2e-33   Anopheles darlingi [American malaria mosquito]
ref|XP_004416912.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   2e-33   Odobenus rosmarus divergens
dbj|GAC73597.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa sub...    132   2e-33   Moesziomyces antarcticus T-34
ref|XP_005877078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   2e-33   Myotis brandtii
ref|XP_006923900.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   2e-33   Pteropus alecto
dbj|GAK62286.1|  NAD(P)-binding protein                                 132   2e-33   Moesziomyces antarcticus
emb|CBQ67793.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    132   2e-33   Sporisorium reilianum SRZ2
dbj|BAF83756.1|  unnamed protein product                                132   2e-33   Homo sapiens [man]
ref|XP_003447104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   2e-33   Oreochromis niloticus
gb|EXX58721.1|  hypothetical protein RirG_195270                        132   2e-33   Rhizophagus irregularis DAOM 197198w
gb|ESA03096.1|  hypothetical protein GLOINDRAFT_336975                  132   2e-33   
ref|XP_007882091.1|  hypothetical protein PFL1_06359                    132   3e-33   Anthracocystis flocculosa PF-1
gb|ERE67037.1|  putative polypeptide N-acetylgalactosaminyltransf...    136   3e-33   Cricetulus griseus [Chinese hamsters]
ref|XP_007304718.1|  NADH dehydrogenase                                 132   3e-33   Stereum hirsutum FP-91666 SS1
ref|XP_004692611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   3e-33   
ref|XP_004778323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-33   Mustela putorius furo [black ferret]
ref|XP_001835685.1|  NADH dehydrogenase                                 132   3e-33   Coprinopsis cinerea okayama7#130
ref|XP_008141973.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-33   Eptesicus fuscus
gb|KIJ64483.1|  hypothetical protein HYDPIDRAFT_28424                   132   3e-33   Hydnomerulius pinastri MD-312
ref|XP_003463318.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-33   Cavia porcellus [guinea pig]
ref|XP_008703114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-33   Ursus maritimus [white bear]
ref|XP_008703115.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-33   Ursus maritimus [white bear]
ref|XP_007870444.1|  NAD P-binding protein                              132   4e-33   Gloeophyllum trabeum ATCC 11539
ref|XP_007527887.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   4e-33   Erinaceus europaeus [common hedgehog]
ref|XP_009178280.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   4e-33   Papio anubis [baboon]
ref|XP_009178281.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   4e-33   Papio anubis [baboon]
ref|XP_003771339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   4e-33   Sarcophilus harrisii
ref|XP_006891427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   4e-33   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003059930.1|  predicted protein                                  131   5e-33   Micromonas pusilla CCMP1545
ref|XP_004381326.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   5e-33   
emb|CCF54116.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    132   5e-33   Ustilago hordei
ref|XP_006123105.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   5e-33   Pelodiscus sinensis [Chinese softshell turtle]
gb|KIM65954.1|  hypothetical protein SCLCIDRAFT_1211966                 131   6e-33   Scleroderma citrinum Foug A
gb|KFV11223.1|  hypothetical protein N339_08758                         129   6e-33   Pterocles gutturalis
ref|XP_005378797.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   6e-33   Chinchilla lanigera
gb|KDR23820.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    131   7e-33   Zootermopsis nevadensis
ref|XP_008071131.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   7e-33   
gb|KFV03415.1|  hypothetical protein N340_03010                         130   7e-33   Tauraco erythrolophus
ref|XP_010076803.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   8e-33   Pterocles gutturalis
ref|XP_009989270.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   8e-33   Tauraco erythrolophus
ref|XP_007353556.1|  NAD(P)-binding protein                             131   8e-33   
ref|XP_007965492.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   9e-33   Chlorocebus sabaeus
ref|XP_007008648.1|  hypothetical protein TREMEDRAFT_72592              131   9e-33   Tremella mesenterica DSM 1558
gb|KIM89048.1|  hypothetical protein PILCRDRAFT_812944                  130   1e-32   Piloderma croceum F 1598
ref|XP_004643624.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   1e-32   Octodon degus
gb|KIK69637.1|  hypothetical protein GYMLUDRAFT_992204                  130   1e-32   Gymnopus luxurians FD-317 M1
gb|EST09999.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit    130   1e-32   Kalmanozyma brasiliensis GHG001
ref|XP_003331391.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    130   1e-32   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|KDN34620.1|  hypothetical protein RSAG8_12282                        130   1e-32   Rhizoctonia solani AG-8 WAC10335
gb|EMD40072.1|  hypothetical protein CERSUDRAFT_112285                  130   1e-32   Gelatoporia subvermispora B
emb|CDI51333.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    130   1e-32   Melanopsichium pennsylvanicum 4
dbj|GAC95510.1|  hypothetical protein PHSY_003086                       130   1e-32   Pseudozyma hubeiensis SY62
ref|XP_007435737.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   1e-32   
ref|XP_003273859.2|  PREDICTED: probable polypeptide N-acetylgala...    133   2e-32   
ref|XP_005569923.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   2e-32   Macaca fascicularis [crab eating macaque]
ref|XP_002108719.1|  expressed hypothetical protein                     130   2e-32   Trichoplax adhaerens
gb|KDE07008.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    130   2e-32   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_010609901.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   2e-32   Fukomys damarensis [Damara mole rat]
gb|ADO28252.1|  mitochondrial NADH dehydrogenase 1 alpha subcompl...    130   2e-32   Ictalurus furcatus
ref|XP_011386267.1|  putative NADH2 dehydrogenase (ubiquinone) 40...    130   2e-32   Ustilago maydis 521
gb|KIY67124.1|  NAD(P)-binding protein                                  129   2e-32   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_645194.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    129   2e-32   Dictyostelium discoideum AX4
gb|KIK47221.1|  hypothetical protein CY34DRAFT_21544                    129   2e-32   Suillus luteus UH-Slu-Lm8-n1
ref|XP_010195242.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   2e-32   Colius striatus
gb|KIM28918.1|  hypothetical protein M408DRAFT_328984                   129   2e-32   Serendipita vermifera MAFF 305830
gb|KFP29723.1|  hypothetical protein N325_09765                         129   3e-32   Colius striatus
ref|XP_010881814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   3e-32   Esox lucius
ref|XP_004438802.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   4e-32   Ceratotherium simum simum [southern square-lipped rhinoceros]
dbj|GAM27735.1|  hypothetical protein SAMD00019534_109110               129   4e-32   Acytostelium subglobosum LB1
ref|XP_010148325.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   4e-32   Eurypyga helias
gb|EHH20407.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit           129   4e-32   Macaca mulatta [rhesus macaque]
ref|XP_005569922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   5e-32   Macaca fascicularis [crab eating macaque]
ref|NP_001187320.1|  mitochondrial NADH dehydrogenase (ubiquinone...    129   5e-32   Ictalurus punctatus
gb|KFP08708.1|  hypothetical protein N300_02598                         128   5e-32   Calypte anna
gb|KFB35184.1|  AGAP010792-PA-like protein                              129   5e-32   Anopheles sinensis
ref|XP_318516.3|  AGAP010792-PA                                         129   5e-32   Anopheles gambiae str. PEST
gb|KFV92623.1|  hypothetical protein N326_00630                         125   6e-32   Eurypyga helias
ref|XP_007845659.1|  nadh dehydrogenase                                 128   6e-32   
ref|XP_008502666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   6e-32   Calypte anna
gb|KFP45254.1|  hypothetical protein N324_11766                         127   6e-32   Chlamydotis macqueenii
ref|XP_004568347.1|  PREDICTED: probable polypeptide N-acetylgala...    132   6e-32   
ref|XP_003221407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   7e-32   Anolis carolinensis [Carolina anole]
ref|XP_010125588.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   7e-32   Chlamydotis macqueenii
ref|XP_001985349.1|  GH14554                                            129   7e-32   Drosophila grimshawi
gb|KFV38950.1|  hypothetical protein N341_11120                         125   8e-32   Tyto alba [Schleiereule]
ref|XP_001118102.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   8e-32   
ref|XP_009973803.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    125   9e-32   
ref|XP_005234795.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    128   9e-32   
gb|KFQ75039.1|  hypothetical protein N335_03526                         128   9e-32   
emb|CCJ28978.1|  unnamed protein product                                128   1e-31   
ref|XP_010285464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   1e-31   
ref|XP_007399771.1|  hypothetical protein PHACADRAFT_199484             127   1e-31   
ref|XP_005097061.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   1e-31   
gb|KFZ63522.1|  hypothetical protein N321_03654                         127   1e-31   
ref|XP_010133323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   1e-31   
emb|CEL51784.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    127   1e-31   
ref|XP_010171650.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   1e-31   
ref|XP_009567541.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   2e-31   
gb|KFO82303.1|  hypothetical protein N303_06049                         127   2e-31   
gb|KFO89045.1|  hypothetical protein N320_01399                         126   2e-31   
gb|KFV95211.1|  hypothetical protein N327_03132                         127   2e-31   
ref|XP_006172086.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   2e-31   
emb|CCA67799.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    127   2e-31   
gb|KFQ73922.1|  hypothetical protein N337_04487                         127   2e-31   
ref|XP_010573635.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   2e-31   
ref|XP_009582483.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   2e-31   
ref|XP_007768401.1|  NAD(P)-binding protein                             127   2e-31   
ref|XP_009001694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   2e-31   
gb|KFV57640.1|  hypothetical protein N328_11892                         127   2e-31   
gb|KFO62876.1|  hypothetical protein N302_08675                         127   2e-31   
ref|XP_010408555.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   3e-31   
gb|ENN72465.1|  hypothetical protein YQE_10807                          127   3e-31   
ref|XP_009917119.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   3e-31   
gb|ERL95049.1|  hypothetical protein D910_12319                         127   3e-31   
gb|AEE61636.1|  unknown                                                 127   3e-31   
ref|XP_002048107.1|  GJ11526                                            127   3e-31   
ref|XP_008037591.1|  NADH dehydrogenase                                 126   3e-31   
gb|KFP53101.1|  hypothetical protein N323_09262                         126   3e-31   
ref|XP_009815144.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    126   3e-31   
gb|KFQ03890.1|  hypothetical protein N329_07841                         126   3e-31   
gb|KFP63610.1|  hypothetical protein N322_12220                         126   3e-31   
gb|EPS94725.1|  hypothetical protein FOMPIDRAFT_1133771                 126   3e-31   
ref|XP_010005482.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   3e-31   
gb|KFU84818.1|  hypothetical protein M959_04911                         126   3e-31   
gb|KIP02896.1|  hypothetical protein PHLGIDRAFT_130473                  126   3e-31   
gb|KIR68354.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    127   3e-31   
ref|XP_008636784.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   3e-31   
gb|EOB06411.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    126   4e-31   
ref|XP_005533361.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   4e-31   
ref|XP_009695607.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   4e-31   
gb|KFO07725.1|  hypothetical protein N312_01006                         126   4e-31   
gb|KEP53453.1|  putative NADH-ubiquinone oxidoreductase 39 kDa pr...    126   4e-31   
gb|EUC62263.1|  NADH-ubiquinone oxidoreductase 39 kDa protein, pu...    126   4e-31   
emb|CCM05932.1|  predicted protein                                      126   4e-31   
ref|XP_005012705.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   4e-31   
gb|EMP38439.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    125   4e-31   
ref|XP_010573634.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   4e-31   
gb|KFV62438.1|  hypothetical protein N307_14752                         126   4e-31   
emb|CCO27961.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    127   4e-31   
ref|XP_005426929.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   4e-31   
gb|KFQ91966.1|  hypothetical protein Y956_15987                         126   4e-31   
ref|XP_009473697.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    126   5e-31   
ref|XP_010310531.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   5e-31   
ref|XP_005492469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   5e-31   
ref|XP_002008276.1|  GI13402                                            126   5e-31   
gb|KIR57388.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    126   5e-31   
gb|AFR95169.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    126   5e-31   
ref|XP_009954998.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   5e-31   
gb|KIR89560.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    126   5e-31   
ref|XP_009908154.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   5e-31   
gb|KGB74721.1|  NADH dehydrogenase                                      126   5e-31   
gb|KFQ14782.1|  hypothetical protein N330_12470                         125   5e-31   
ref|XP_011067114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   5e-31   
ref|XP_003193480.1|  NADH dehydrogenase (ubiquinone)                    126   5e-31   
ref|XP_570308.1|  NADH dehydrogenase (ubiquinone)                       126   5e-31   
gb|KIR80601.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    126   6e-31   
ref|XP_011164362.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   6e-31   
ref|XP_001865472.1|  NADH-ubiquinone oxidoreductase 39 kda subunit      126   6e-31   
ref|XP_001730360.1|  hypothetical protein MGL_2742                      125   6e-31   
gb|EFZ15204.1|  hypothetical protein SINV_03405                         126   6e-31   
gb|KFQ30066.1|  hypothetical protein N332_01289                         125   7e-31   
gb|KFQ44899.1|  hypothetical protein N333_02601                         125   7e-31   
ref|XP_010021537.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   7e-31   
ref|XP_009936776.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    125   8e-31   
ref|XP_003932646.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   8e-31   
ref|XP_001702653.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      125   8e-31   
gb|KFR13833.1|  hypothetical protein N306_14448                         125   8e-31   
gb|KFW86271.1|  hypothetical protein N305_07548                         125   9e-31   
ref|XP_009076582.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   9e-31   
ref|XP_011256589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   9e-31   
ref|XP_010714872.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   9e-31   
ref|XP_001660001.1|  AAEL009414-PA                                      125   9e-31   
ref|NP_001082699.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    125   9e-31   
ref|XP_004879593.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   9e-31   
gb|KFP83910.1|  hypothetical protein N310_12825                         125   9e-31   
gb|KIR50051.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    125   9e-31   
ref|XP_008928534.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-30   
ref|XP_004869427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-30   
gb|AAH45076.1|  MGC64316 protein                                        125   1e-30   
ref|XP_002188497.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-30   
ref|XP_008549223.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-30   
ref|XP_005040230.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-30   
gb|KGL85955.1|  hypothetical protein N301_03034                         124   1e-30   
gb|KGL84591.1|  hypothetical protein N309_12483                         124   1e-30   
ref|XP_009015040.1|  hypothetical protein HELRODRAFT_98836              125   1e-30   
ref|XP_010176933.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-30   
ref|XP_009892508.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    124   1e-30   
ref|XP_009092324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-30   
gb|KFM13739.1|  hypothetical protein AS27_14184                         124   2e-30   
ref|XP_010223608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-30   
ref|XP_007056976.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-30   
ref|XP_004992628.1|  hypothetical protein PTSG_07208                    124   2e-30   
ref|XP_008309204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-30   
ref|NP_001011432.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    124   2e-30   
ref|XP_008118146.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-30   
ref|XP_003034456.1|  hypothetical protein SCHCODRAFT_14900              124   2e-30   
ref|XP_003286992.1|  hypothetical protein DICPUDRAFT_97564              124   2e-30   
ref|XP_009863298.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-30   
gb|KFP80801.1|  hypothetical protein N311_08372                         124   2e-30   
ref|NP_001006281.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    124   3e-30   
gb|KFM58002.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    124   3e-30   
ref|XP_009673696.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   3e-30   
gb|KFV81563.1|  hypothetical protein N308_11418                         124   3e-30   
ref|XP_009483609.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   3e-30   
ref|XP_009673695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   3e-30   
ref|XP_002069018.1|  GK12296                                            124   3e-30   
ref|XP_007319751.1|  39kDa subunit of NDUFA9, NADH:ubiquinone oxi...    124   3e-30   
gb|KFW67319.1|  hypothetical protein AS28_12998                         124   3e-30   
gb|KFQ62461.1|  hypothetical protein N334_13818                         123   4e-30   
ref|XP_007270771.1|  NADH dehydrogenase                                 123   4e-30   
ref|XP_005503104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   4e-30   
emb|CAX69804.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    121   4e-30   
gb|KII87009.1|  hypothetical protein PLICRDRAFT_700259                  123   4e-30   
ref|XP_005148026.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   5e-30   
gb|KFW94971.1|  hypothetical protein N336_08738                         123   6e-30   
gb|EMS25072.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    123   6e-30   
ref|XP_975235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    123   6e-30   
ref|XP_009286807.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   6e-30   
ref|XP_009510411.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   6e-30   
ref|XP_008486857.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   6e-30   
emb|CDO68262.1|  hypothetical protein BN946_scf184842.g25               122   6e-30   
ref|XP_001352990.1|  GA19302                                            123   6e-30   
ref|XP_002954591.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      123   7e-30   
ref|XP_007409682.1|  hypothetical protein MELLADRAFT_77647              123   7e-30   
ref|XP_002026863.1|  GL12793                                            123   7e-30   
ref|XP_011339338.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   7e-30   
gb|EPB89825.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    122   8e-30   
ref|XP_011188849.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   8e-30   
ref|XP_011339337.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   8e-30   
ref|XP_001948072.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   8e-30   
ref|XP_009322637.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   8e-30   
gb|KDQ25989.1|  39kDa subunit of NDUFA9, NADH ubiquinone oxidored...    122   9e-30   
ref|XP_006273618.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   9e-30   
ref|XP_005188922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   1e-29   
ref|XP_002086632.1|  GE23238                                            123   1e-29   
ref|XP_002040681.1|  GM22299                                            123   1e-29   
ref|XP_006027877.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   1e-29   
dbj|GAN07940.1|  NAD(P)-binding protein                                 122   1e-29   
ref|XP_011208110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   1e-29   
ref|XP_005307068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   1e-29   
gb|KJA24071.1|  hypothetical protein HYPSUDRAFT_39211                   122   1e-29   
ref|XP_005712083.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    122   1e-29   
ref|XP_004522227.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   1e-29   
ref|XP_011304899.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   2e-29   
ref|XP_001973503.1|  GG16121                                            122   2e-29   
emb|CAX73863.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    122   2e-29   
ref|XP_001957289.1|  GF10349                                            122   2e-29   
emb|CEP08222.1|  hypothetical protein                                   121   2e-29   
gb|AHZ64223.1|  FI24283p1                                               122   2e-29   
ref|NP_649234.1|  CG6020, isoform A                                     122   3e-29   
gb|KIK24507.1|  hypothetical protein PISMIDRAFT_401487                  121   3e-29   
gb|KIJ54415.1|  hypothetical protein M422DRAFT_775527                   121   3e-29   
ref|XP_004210520.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   3e-29   
gb|AAW26486.1|  SJCHGC05906 protein                                     121   4e-29   
ref|XP_009634820.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    120   4e-29   
gb|KFP14044.1|  hypothetical protein Z169_06947                         120   4e-29   
gb|KIL67845.1|  hypothetical protein M378DRAFT_185427                   120   4e-29   
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    120   4e-29   
emb|CEI86940.1|  Putative Genomic scaffold, msy_sf_1                    120   5e-29   
ref|XP_786784.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    120   5e-29   
gb|KIY44806.1|  NAD(P)-binding protein                                  120   6e-29   
dbj|GAA31353.2|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    120   6e-29   
gb|EHJ77228.1|  hypothetical protein KGM_02785                          120   6e-29   
ref|XP_009162600.1|  hypothetical protein T265_00532                    119   7e-29   
ref|XP_001876312.1|  predicted protein                                  119   8e-29   
emb|CEJ03407.1|  Putative Genomic scaffold, msy_sf_1                    120   8e-29   
ref|XP_007370168.1|  NADH dehydrogenase                                 119   9e-29   
emb|CEG64935.1|  Putative Genomic scaffold, msy_sf_1                    120   9e-29   
ref|XP_002423386.1|  NADH-ubiquinone oxidoreductase 40 kDa subuni...    120   9e-29   
ref|XP_006462703.1|  NdufA9 NADH ubiquinone oxidoreductase subunit      119   1e-28   
emb|CDH57814.1|  nadh-ubiquinone oxidoreductase 40 kdamitochondrial     119   1e-28   
ref|XP_007379939.1|  NAD(P)-binding protein                             119   1e-28   
emb|CEG82390.1|  Putative Genomic scaffold, msy_sf_1                    119   1e-28   
emb|CDS05157.1|  Putative NADH dehydrogenase (Ubiquinone) 1FT alp...    119   1e-28   
gb|KIY95832.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    115   2e-28   
ref|XP_011152700.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    119   2e-28   
ref|XP_007330075.1|  39kDa subunit of NdufA9, NADH ubiquinone oxi...    119   2e-28   
gb|KEY64763.1|  hypothetical protein S7711_05413                        119   2e-28   
gb|KFA45428.1|  hypothetical protein S40293_09993                       119   2e-28   
ref|XP_008876068.1|  hypothetical protein H310_11254                    118   2e-28   
gb|ELV09161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    116   3e-28   
dbj|BAM18246.1|  NADH-ubiquinone oxidoreductase 39 kda subunit          119   3e-28   
gb|ELU16423.1|  hypothetical protein CAPTEDRAFT_138749                  118   3e-28   
gb|EJT47332.1|  NADH dehydrogenase (ubiquinone)                         118   3e-28   
ref|XP_006681739.1|  hypothetical protein BATDEDRAFT_37370              118   3e-28   
gb|KDR82718.1|  hypothetical protein GALMADRAFT_238218                  118   4e-28   
gb|KFA66731.1|  hypothetical protein S40285_08501                       118   5e-28   
ref|XP_010731332.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   6e-28   
ref|XP_004927924.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   7e-28   
gb|ESZ96776.1|  putative NADH-ubiquinone oxidoreductase 39 kDa su...    117   7e-28   
ref|XP_002481461.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...    117   9e-28   
gb|KGO73423.1|  hypothetical protein PITC_085610                        117   1e-27   
gb|EFX84818.1|  hypothetical protein DAPPUDRAFT_300729                  117   1e-27   
ref|XP_001545366.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit      115   1e-27   
gb|EKV10590.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit, pu...    117   1e-27   
ref|XP_005651289.1|  NAD(P)-binding protein                             117   1e-27   
gb|KIK07979.1|  hypothetical protein K443DRAFT_128758                   116   1e-27   
gb|KIE01531.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit-lik...    116   2e-27   
gb|KID92561.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit-lik...    116   2e-27   
dbj|GAD93043.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit, p...    118   2e-27   
emb|CDM37805.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit, m...    116   2e-27   
gb|ERE67036.1|  putative polypeptide N-acetylgalactosaminyltransf...    119   2e-27   
ref|XP_002147321.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...    116   2e-27   
ref|XP_002839474.1|  hypothetical protein                               116   2e-27   
ref|XP_003145987.1|  hypothetical protein LOAG_10415                    114   2e-27   
ref|NP_001165787.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    116   2e-27   



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            YLL DQCYG  + R+AS+L  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  27   YLLPDQCYGAESTRFASSLATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  86

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE
Sbjct  87   AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  146

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH+MA+QLA I
Sbjct  147  YETRNFSFEEVNHHMAEQLALI  168



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG Q +  S+  IS+ KS+Y L DQ YG   PR+ASTL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGYQYIRHSAAPISSFKSAYSLPDQYYGADNPRWASTLATKGVGHLVRKGTGGRSSVSGI  67

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            +ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKY+PRDE+
Sbjct  68   IATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYDPRDED  127

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVVINLIGR+YETRNYSFEEVNH+MA+QLA I
Sbjct  128  SIKAVMAKANVVINLIGRDYETRNYSFEEVNHHMAEQLAVI  168



>gb|KJB42342.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=234

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  168



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL P++   S     Y LSD  YG   PR+AS+L AKG GH++RKGTGGRSSVSGI
Sbjct  8    LGHQSLKPAASLSSFKSI-YPLSDHHYGADHPRHASSLAAKGVGHLIRKGTGGRSSVSGI  66

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVVINLIGR++ETRNYSFEE+NH M +QLA I
Sbjct  127  SIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMI  167



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QS N  SP+IS+LKS Y LSD  YG   PR  STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGHQSFN-QSPAISSLKSIYPLSDHYYGADHPRLGSTLAPKGVGHLVRKGTGGRSSVSGI  66

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VA VFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VAVVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVV+NLIGREYETRNYSFEEVNH+MA+QLA I
Sbjct  127  SIKAVMAKANVVLNLIGREYETRNYSFEEVNHHMAEQLAMI  167



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL P++   S     Y LSD  YG   PR+AS+L AKG GH++RKGTGGRSSVSGI
Sbjct  8    LGHQSLKPAASLSSFKSI-YPLSDHHYGADHPRHASSLPAKGVGHLIRKGTGGRSSVSGI  66

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVVINLIGR++ETRNYSFEE+NH M +QLA I
Sbjct  127  SIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMI  167



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   257 bits (656),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LS   YGI  PRY ST++ KG GH+VRKGTGGRSSVSGI+ATVFGATGFLGRY+VQQL
Sbjct  26   YPLSSDGYGIDHPRYVSTISIKGAGHVVRKGTGGRSSVSGIIATVFGATGFLGRYVVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVV+NLIGRE
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVLNLIGRE  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+QLA I
Sbjct  146  YETRNYSFEEVNHAMAEQLAVI  167



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  168



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  168



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  143  GIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVL  322
            G   PRYAS LTA+GTGHIVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVL
Sbjct  37   GADNPRYASNLTARGTGHIVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVL  96

Query  323  VPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSF  502
            VPFRGSED HRHLKLMGDLGQIVPM+YNPRDENSIKAVMAKANVVINLIGREYETRNYSF
Sbjct  97   VPFRGSEDSHRHLKLMGDLGQIVPMQYNPRDENSIKAVMAKANVVINLIGREYETRNYSF  156

Query  503  EEVNHYMAKQLASI  544
            EEVNH+MA++LA I
Sbjct  157  EEVNHHMAEELAMI  170



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LS   YGI  PR+ ST++ KG GHI+RKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  26   YPLSSDGYGIDHPRHVSTISVKGGGHIIRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVV+NLIGRE
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVLNLIGRE  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+QLA I
Sbjct  146  YETRNYSFEEVNHAMAEQLAVI  167



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  168



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL P++   S     Y LSD  YG   PR+AS+L AKG  H++RKGTGGRSSVSGI
Sbjct  8    LGHQSLKPAASLSSFKSI-YPLSDHHYGADHPRHASSLAAKGVCHLIRKGTGGRSSVSGI  66

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVVINLIGR++ETRNYSFEE+NH M +QLA I
Sbjct  127  SIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMI  167



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  168



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA+I
Sbjct  146  YETRNFSFEEVNHSMAQQLATI  167



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  168



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y +SD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPVSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA+I
Sbjct  146  YETRNFSFEEVNHSMAEQLATI  167



>gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 136/161 (84%), Gaps = 4/161 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LGQQ+ NP++   S      L     YG   PRY STLT KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGQQAHNPAASIASLKSIYPL----YYGTDHPRYGSTLTPKGVGHLVRKGTGGRSSVSGI  63

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            +ATVFGATGFLGRY+VQQLAKMG+QVLVPFRGSED HRHLKLMGDLGQIVPM YNPRDEN
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGTQVLVPFRGSEDSHRHLKLMGDLGQIVPMLYNPRDEN  123

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVVINLIGREYETRNYSFEEVNH MA+QLA I
Sbjct  124  SIKAVMAKANVVINLIGREYETRNYSFEEVNHGMAEQLAMI  164



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y +SD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPVSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA+I
Sbjct  146  YETRNFSFEEVNHSMAEQLATI  167



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA+I
Sbjct  146  YETRNFSFEEVNHSMAQQLATI  167



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            +ETRN+SFEEVNH MA+QLA+I
Sbjct  146  FETRNFSFEEVNHSMAQQLATI  167



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  64   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  123

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVM+KANVVINLIGR+
Sbjct  124  AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMSKANVVINLIGRD  183

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA+I
Sbjct  184  YETRNFSFEEVNHSMAQQLATI  205



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LGQQSL PS+   S     Y +SD  YG+   RY STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGQQSLRPSTSLKSI----YPISDHHYGMDHERYVSTLATKGVGHLVRKGTGGRSSVSGI  63

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            +ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYNPRDES  123

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            S+KAVMAKANVVINLIGR+YETRNYSFEEV+++MA+QLA I
Sbjct  124  SVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKI  164



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LGQQSL PS+   S     Y +SD  YG+   RY STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGQQSLRPSTSLKSI----YPISDHHYGMDHERYVSTLATKGVGHLVRKGTGGRSSVSGI  63

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            +ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYNPRDES  123

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            S+KAVMAKANVVINLIGR+YETRNYSFEEV+++MA+QLA I
Sbjct  124  SVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKI  164



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y  SD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  24   YPTSDHYYGAERPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  83

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGRE
Sbjct  84   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKANVVINLIGRE  143

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA I
Sbjct  144  YETRNFSFEEVNHSMAEQLAMI  165



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LS    G+  PRY ST+  KGTGH++RKGTGGRSSVSGIVATVFGATGFLGRY+V QL
Sbjct  27   YPLSSSECGVDRPRYGSTVAVKGTGHLIRKGTGGRSSVSGIVATVFGATGFLGRYVVSQL  86

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAK+NVV NLIGRE
Sbjct  87   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKSNVVFNLIGRE  146

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+QLA I
Sbjct  147  YETRNYSFEEVNHAMAEQLAVI  168



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG   P+  STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKCGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH MA+QLA+I
Sbjct  146  YETRNFSFEEVNHSMAQQLATI  167



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LGQQSL P+    S     Y L    YG   PRY STL A KG GH+VRKGTGGRSSVSG
Sbjct  8    LGQQSLRPTPSIYSIECI-YPLFHHYYGCDHPRYGSTLAAHKGLGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA I
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVI  168



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 136/162 (84%), Gaps = 10/162 (6%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LGQQSL P+           + S + YG   PRY STL A KG GH+VRKGTGGRSSVSG
Sbjct  8    LGQQSLRPTPS---------IYSIEYYGCDHPRYGSTLAAHKGLGHLVRKGTGGRSSVSG  58

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  59   IIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  118

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NSIKAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA I
Sbjct  119  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVI  160



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LS   YG+   R+ ST++ KGTGH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  26   YPLSSDGYGLDHLRHVSTISVKGTGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  85

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM YNPRDENSIKAVMAKANVV+NLIGRE
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMNYNPRDENSIKAVMAKANVVLNLIGRE  145

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+QLA I
Sbjct  146  YETRNYSFEEVNHAMAEQLAVI  167



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   249 bits (635),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG   PRY STL  +G GH++RKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  21   YPLSDHLYGADHPRYGSTLATRGVGHLIRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  80

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGS+D  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR+
Sbjct  81   AKMGSQVLVPFRGSDDDPRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRD  140

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEE+NH MA QLA I
Sbjct  141  YETRNYSFEELNHAMAGQLAMI  162



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL+PS    +     + L D  YG   PR  STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGHQSLSPSPSISALKSI-HPLFDSYYGADHPRCGSTLATKGLGHLVRKGTGGRSSVSGI  66

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRG ED HRHLKLMGDLGQIVPMKYNPRDE 
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMKYNPRDEA  126

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            SIKAVMAKANVV+NLIGREYETRNYSFE  NH+MA+QLA+I
Sbjct  127  SIKAVMAKANVVVNLIGREYETRNYSFEVANHFMAEQLATI  167



>gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LS    G   PRY STL  +G GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  28   YPLSHHYCGADRPRYDSTLATRGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  87

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLK+MGDLGQIVPMKYNPRDENS+KAVMAKANVV+NLIGRE
Sbjct  88   AKMGSQVLVPFRGSEDSPRHLKIMGDLGQIVPMKYNPRDENSVKAVMAKANVVLNLIGRE  147

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+QLA+I
Sbjct  148  YETRNYSFEEVNHSMAEQLATI  169



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LSD  YG+   RY STL  KG  H+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  22   YALSDPRYGVDHSRYGSTLATKGVAHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  81

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE SIKAVMAKANVVINLIGRE
Sbjct  82   AKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYDPRDECSIKAVMAKANVVINLIGRE  141

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH+MA+ LA I
Sbjct  142  YETRNYSFEEVNHHMAEHLAMI  163



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   244 bits (624),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSD-QCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSG  238
            LG QSL   SP+IS+ KS Y LSD   YG  TPRYAS L   G G ++RKGTGGRSSVSG
Sbjct  8    LGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNLATGGVGPLIRKGTGGRSSVSG  67

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            IVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE
Sbjct  68   IVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDE  127

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NS+KAVMAKANVVINLIGR+YETRNYSF+EVN +MA+QLA I
Sbjct  128  NSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHMAEQLAMI  169



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y LS    G   PRY STL  +G GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  29   YPLSHHYCGADRPRYDSTLATRGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  88

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLK+MGDLGQIVPMKYNPRDE+S+KAVMAKANVV+NLIGRE
Sbjct  89   AKMGSQVLVPFRGSEDSPRHLKIMGDLGQIVPMKYNPRDESSVKAVMAKANVVLNLIGRE  148

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+QLA+I
Sbjct  149  YETRNYSFEEVNHSMAEQLATI  170



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 4/159 (3%)
 Frame = +2

Query  68   QQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVA  247
             QSL PS+   S     Y +SD  YG    R+ ST+  KG GH+VRKGTGGRSSVSGIVA
Sbjct  10   HQSLKPSTSLKSI----YPISDHHYGADHERFVSTIATKGVGHLVRKGTGGRSSVSGIVA  65

Query  248  TVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSI  427
            TVFGATGFLGRY+VQ LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ+VPMKYNPRDE+S+
Sbjct  66   TVFGATGFLGRYVVQHLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQVVPMKYNPRDESSV  125

Query  428  KAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            KAVMAKANVVINLIGR++ETRNYS+E+V+++MA QLA I
Sbjct  126  KAVMAKANVVINLIGRDFETRNYSYEQVHYHMADQLARI  164



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL     S ++L++ Y +SD  Y     R+ ST+  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGHQSLK----SSTSLRAIYPISDHHYVADHERFVSTIANKGVGHLVRKGTGGRSSVSGI  63

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            +ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSEDC RHLKLMGDLGQIVPMKYNPRDE+
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDCPRHLKLMGDLGQIVPMKYNPRDES  123

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            S+KAVMAKANVVINLIGR+YETRNYSFEEVN++MA+ LA I
Sbjct  124  SVKAVMAKANVVINLIGRDYETRNYSFEEVNYHMAENLAKI  164



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  140  YGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  319
            Y    PRY STL  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQV
Sbjct  32   YVTDHPRYGSTLAPKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQV  91

Query  320  LVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYS  499
            LVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVV+NLIGREYETRN+S
Sbjct  92   LVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKANVVLNLIGREYETRNFS  151

Query  500  FEEVNHYMAKQLASI  544
            FEEVNH MA+QLA I
Sbjct  152  FEEVNHSMAEQLAMI  166



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSD-QCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSG  238
            LG QSL   SP+IS+ KS Y LSD   YG  TPRYAS L   G G ++RKGTGGRSSVSG
Sbjct  8    LGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNLATGGAGPLIRKGTGGRSSVSG  67

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            IVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE
Sbjct  68   IVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDE  127

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            NS+KAVMAKANVVINLIGR+YETRNYSF+EVN ++A+QLA I
Sbjct  128  NSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHIAEQLAMI  169



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y +SD  YG+   RY ST+  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  23   YPISDHYYGVDHERYVSTVATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  82

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQ+LVPFRGSEDC RHLKLMGDLGQ+VPMKYNPRDE+S+KAVMA+ANVVINL+GR+
Sbjct  83   AKMGSQILVPFRGSEDCPRHLKLMGDLGQVVPMKYNPRDESSVKAVMARANVVINLLGRD  142

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEV+++MA++ A I
Sbjct  143  YETRNYSFEEVHYHMAEKFAKI  164



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  337
            RY STLT KG  H+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQ+LAKMGSQVLVPFRG
Sbjct  40   RYVSTLTPKGVAHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQRLAKMGSQVLVPFRG  99

Query  338  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  517
            SED HRHLKLMGDLGQIVPMKYNPRDE SIKAVMAKANVVINLIGREYETRNYSFEEVNH
Sbjct  100  SEDSHRHLKLMGDLGQIVPMKYNPRDEASIKAVMAKANVVINLIGREYETRNYSFEEVNH  159

Query  518  YMAKQLASI  544
             MA+QLA I
Sbjct  160  GMAEQLAMI  168



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y L +  YG    RY ST+  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  21   YPLCNHYYGADDGRYVSTVATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  80

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFR SED HRHLKLMGDLGQIVPM++NPRDE SIKAVMAKANVVINLIGRE
Sbjct  81   AKMGSQVLVPFRCSEDSHRHLKLMGDLGQIVPMQFNPRDEGSIKAVMAKANVVINLIGRE  140

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNYSFEEVNH MA+ LA+I
Sbjct  141  YETRNYSFEEVNHSMAEVLANI  162



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            A     KGTGH+VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMG+QVLVPFRGSE
Sbjct  3    ARAPAVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGTQVLVPFRGSE  62

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            DCHRHLKLMGDLGQIVPMKYNPRD NSIKAVMAK+NVVINLIGREYETRNY FEEVNH+M
Sbjct  63   DCHRHLKLMGDLGQIVPMKYNPRDVNSIKAVMAKSNVVINLIGREYETRNYGFEEVNHHM  122

Query  524  AKQLASI  544
            A+QLA I
Sbjct  123  AEQLAMI  129



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y + D  +GI   RY+S+L  KG GH+ RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQL
Sbjct  29   YEVPDHYHGIDDRRYSSSLATKGMGHLARKGTGGRSSVSGIIATVFGATGFLGRYLVQQL  88

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK+NPRDE+SIKAVMAKANVVINLIGR+
Sbjct  89   AKMGSQVLVPFRGSEDDPRHLKLMGDLGQIVPMKFNPRDEDSIKAVMAKANVVINLIGRD  148

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEEVNH+M+++LA +
Sbjct  149  YETRNFSFEEVNHHMSEKLAML  170



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   239 bits (609),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y +SD  YG+   RY ST+  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  23   YPISDHYYGVNHERYVSTIATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  82

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK+NPRDE+S+KAVMA+ANVVINLIGR+
Sbjct  83   AKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKFNPRDESSVKAVMARANVVINLIGRD  142

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+S+EEV+++MA++LA I
Sbjct  143  YETRNFSYEEVHYHMAEKLAKI  164



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   239 bits (609),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y +SD   G  + RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  29   YGVSDHLNGTDSRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  88

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGRE
Sbjct  89   AKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGRE  148

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFEE NH+MA++LA +
Sbjct  149  YETRNFSFEEANHHMAEKLALV  170



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL  S    S         DQ YG    R+AS +   G GH+ RKGTGGRSSVSGI
Sbjct  8    LGHQSLKHSPAISSFKSLYPPSDDQYYG---SRFASNVATSGGGHLARKGTGGRSSVSGI  64

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDEN
Sbjct  65   VATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDEN  124

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            S+KAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA I
Sbjct  125  SVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMI  165



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSDHLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFEEVNH+MA++LA +
Sbjct  151  TRNFSFEEVNHHMAEKLALV  170



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  182  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  361
            KGTGH+VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL
Sbjct  57   KGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  116

Query  362  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  541
            KLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGREYETRNY F+EVNH+MA+QLA 
Sbjct  117  KLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNYGFDEVNHHMAEQLAM  176

Query  542  I  544
            I
Sbjct  177  I  177



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSDHLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFEEVNH+MA++LA +
Sbjct  151  TRNFSFEEVNHHMAEKLALV  170



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  182  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  361
            KGTGH+VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL
Sbjct  57   KGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  116

Query  362  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  541
            KLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGREYETRNY F+EVNH+MA+QLA 
Sbjct  117  KLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNYGFDEVNHHMAEQLAM  176

Query  542  I  544
            I
Sbjct  177  I  177



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  241
            LG QSL   SP+IS+ KS Y  SD  Y  G+ R+AS +   G GH+ RKGTGGRSSVSGI
Sbjct  8    LGHQSLK-HSPAISSFKSLYPPSDDHY-CGS-RFASNVATSGGGHLARKGTGGRSSVSGI  64

Query  242  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  421
            VATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDEN
Sbjct  65   VATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDEN  124

Query  422  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            S+KAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA I
Sbjct  125  SVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMI  165



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   236 bits (603),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  32   VSDYLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  91

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  92   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  151

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFEEVNH+MA++LA +
Sbjct  152  TRNFSFEEVNHHMAEKLALV  171



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   236 bits (603),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            Y +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  31   YGVSDHLNGTDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  90

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGRE
Sbjct  91   AKMGSQVLVPFRGSEDDPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGRE  150

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRN+SFE+VNH+MA++LA +
Sbjct  151  YETRNFSFEDVNHHMAEKLALV  172



>ref|XP_006296717.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
 gb|EOA29615.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
Length=323

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +S+   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSNHLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFEEVNH++A++LA +
Sbjct  151  TRNFSFEEVNHHIAEKLALV  170



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  128  SDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKM  307
            S   +G    RY+S+L AKG GH+ RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKM
Sbjct  32   SSHHHGKDNRRYSSSLAAKGVGHLARKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKM  91

Query  308  GSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYET  487
            GSQVLVPFRGSED  RHLKLMGDLGQIVPMK+NPRDE+SIKAVMAKANVVINL GREYET
Sbjct  92   GSQVLVPFRGSEDDPRHLKLMGDLGQIVPMKFNPRDEDSIKAVMAKANVVINLTGREYET  151

Query  488  RNYSFEEVNHYMAKQLA  538
            RN+SFEEVNH+MA++LA
Sbjct  152  RNFSFEEVNHHMAEKLA  168



>ref|XP_006854436.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  337
            RY S++  KG+G++VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRG
Sbjct  37   RYGSSVALKGSGYLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  96

Query  338  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  517
             ED HRHLKLMGDLGQIVPMKY+PRDE SIKAVMAKANVVINLIGREYETRNYSFEEVNH
Sbjct  97   CEDSHRHLKLMGDLGQIVPMKYDPRDEGSIKAVMAKANVVINLIGREYETRNYSFEEVNH  156

Query  518  YMAKQLASI  544
             MA+QL+ I
Sbjct  157  VMAEQLSMI  165



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSDHFNGNDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SF+EVNH+MA++LA +
Sbjct  151  TRNFSFKEVNHHMAEKLALV  170



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            + D   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VPDYLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFEEVNH+MA++LA +
Sbjct  151  TRNFSFEEVNHHMAEKLALV  170



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            + D   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  32   VPDYLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  91

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  92   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  151

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFEEVNH+MA++LA +
Sbjct  152  TRNFSFEEVNHHMAEKLALV  171



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            +S L  KG GH++RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAK GSQVLVPFRGSE
Sbjct  2    SSNLATKGVGHLIRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKNGSQVLVPFRGSE  61

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGREYETRN+SFEEVNH M
Sbjct  62   DSSRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHRM  121

Query  524  AKQLASI  544
            A+QLA+I
Sbjct  122  AEQLAAI  128



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  337
            RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG
Sbjct  43   RYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  102

Query  338  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  517
            SED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYETRN+SFEEVNH
Sbjct  103  SEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNH  162

Query  518  YMAKQLASI  544
            +MA++LA +
Sbjct  163  HMAEKLALV  171



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  337
            RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG
Sbjct  43   RYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  102

Query  338  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  517
            SED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYETRN+SFEEVNH
Sbjct  103  SEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNH  162

Query  518  YMAKQLASI  544
            +MA++LA +
Sbjct  163  HMAEKLALV  171



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  119  YLLSDQ-CYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  295
            Y +SD    G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGVSDHHLNGADNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  296  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  475
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  476  EYETRNYSFEEVNHYMAKQLASI  544
            EYETRN+SFEEVNH+MA++LA +
Sbjct  149  EYETRNFSFEEVNHHMAEKLALV  171



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 123/132 (93%), Gaps = 3/132 (2%)
 Frame = +2

Query  158  RYASTLTA---KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  328
            RY S+  A   KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP
Sbjct  46   RYMSSARAPAVKGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  105

Query  329  FRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEE  508
            FRG ED HRHLK+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEE
Sbjct  106  FRGCEDSHRHLKIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEE  165

Query  509  VNHYMAKQLASI  544
            VNH+MA+QLA+I
Sbjct  166  VNHHMAEQLATI  177



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +S+   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSNHLNGTDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFE+ NH++A++LA +
Sbjct  151  TRNFSFEDANHHIAEKLALV  170



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYAST-LTAKGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S     Y LSD   G    R+ +T +   GTGH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLQPATSISSLKSV-YPLSDYYNGADHRRFGTTSIATPGTGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK+NPRD+
Sbjct  67   IIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMKFNPRDD  126

Query  419  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            N+IKA MAKANVVINLIGREYETRNYSFE+VNH+MA+++A I
Sbjct  127  NTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGI  168



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   231 bits (589),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  304
            +S+   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSNHLNGTDNCRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRN+SFE+ NH++A++LA +
Sbjct  151  TRNFSFEDANHHIAEKLALV  170



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKG-TGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  295
            Y +S+   G    RYAS+L  KG  GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGVSNHLNGTDNRRYASSLAKKGGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  296  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  475
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  476  EYETRNYSFEEVNHYMAKQLASI  544
            EYETRN+SFE+VNH++A++LA +
Sbjct  149  EYETRNFSFEDVNHHIAEKLALV  171



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAK-GTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  295
            Y +S+   G    RYAS+L  K G GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGVSNHLNGTDNRRYASSLANKWGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  296  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  475
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  476  EYETRNYSFEEVNHYMAKQLASI  544
            EYETRN+SFE+VNH++A++LA +
Sbjct  149  EYETRNFSFEDVNHHIAEKLALV  171



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  119  YLLSDQCYGIGTPRYASTLTAKG-TGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  295
            Y  S+   G    RYAS+L  KG  GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGFSNHLNGTDNRRYASSLANKGGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  296  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  475
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  476  EYETRNYSFEEVNHYMAKQLASI  544
            EYETRN+SFE+VNH++A++LA +
Sbjct  149  EYETRNFSFEDVNHHIAEKLALV  171



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  182  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  361
            +G+G++VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHL
Sbjct  57   EGSGYLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHL  116

Query  362  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  541
            K+MGDLGQIVPMKYNPRD +SIKAVMAK+NVV+NLIGREYETRNYSFEEVNH+MA QLA 
Sbjct  117  KIMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVVNLIGREYETRNYSFEEVNHHMAGQLAM  176

Query  542  I  544
            I
Sbjct  177  I  177



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = +2

Query  143  GIGTPRY--ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  316
            G+   RY  A T   KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ
Sbjct  42   GVDGARYMSARTPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQ  101

Query  317  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNY  496
            VLVPFRG ED HRHLKLMGDLGQIVPMKYNPRD +SIK  +AK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGCEDSHRHLKLMGDLGQIVPMKYNPRDVDSIKTAVAKSNVVINLIGREYETRNY  161

Query  497  SFEEVNHYMAKQLASI  544
             FEEVNH+MA+QLA I
Sbjct  162  GFEEVNHHMAEQLAMI  177



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            A     KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG E
Sbjct  50   ARAPAVKGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCE  109

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEEVNH+M
Sbjct  110  DSPRHLKIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHM  169

Query  524  AKQLASI  544
             +QLA+I
Sbjct  170  PEQLATI  176



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            A     KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG E
Sbjct  50   ARAPAVKGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCE  109

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEEVNH+M
Sbjct  110  DSPRHLKIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHM  169

Query  524  AKQLASI  544
             +QLA+I
Sbjct  170  PEQLATI  176



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  140  YGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  319
            Y     R AS+LT KG GH++RKGTGGRSSVSGI+ATVFGATGFLGRY+VQQLAK GSQV
Sbjct  36   YKFDHSRSASSLTDKGIGHLIRKGTGGRSSVSGIIATVFGATGFLGRYVVQQLAKTGSQV  95

Query  320  LVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYS  499
            LVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+SIKAVMAK+NVVINLIGREYETRN+S
Sbjct  96   LVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKSNVVINLIGREYETRNFS  155

Query  500  FEEVNHYMAKQLASI  544
            FEEVN  +++ LA I
Sbjct  156  FEEVNVDISEHLAKI  170



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            A     KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG E
Sbjct  103  ARAPAVKGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCE  162

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEEVNH+M
Sbjct  163  DSPRHLKIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHM  222

Query  524  AKQLASI  544
             +QLA+I
Sbjct  223  PEQLATI  229



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            A     KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRG E
Sbjct  52   ARAPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGCE  111

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D HRHLKLMGDLGQIVPM YNPRD NSIK  +AK+NVVINLIGREYETRNY FEEVNH M
Sbjct  112  DSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYETRNYGFEEVNHQM  171

Query  524  AKQLASI  544
            A+QLA I
Sbjct  172  AEQLAMI  178



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +2

Query  233  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  412
            SGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PR
Sbjct  10   SGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPR  69

Query  413  DENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            DENSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA I
Sbjct  70   DENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVI  113



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +2

Query  62   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  238
            LG QSL P++   S       LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSIC-ALSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  239  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  418
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  419  NSIKAVMAKANV  454
            NSIKAVMAKAN+
Sbjct  127  NSIKAVMAKANI  138



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +2

Query  236  GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  415
            GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRD
Sbjct  1    GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRD  60

Query  416  ENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            E+SIKAVMAKANVVINLIGREYETRN+SFE+ NH++A++LA +
Sbjct  61   EDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALV  103



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  233  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  412
            SGI+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK+NPR
Sbjct  6    SGIIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMKFNPR  65

Query  413  DENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            D+N+IKA MAKANVVINLIGREYETRNYSFE+VNH+MA+++A I
Sbjct  66   DDNTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGI  109



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +2

Query  131  DQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMG  310
            D  +G G  R +S+L   G+   V++GTGGRSSVSG+VATVFGATGFLGRY+VQQLA+MG
Sbjct  38   DLGFGSGRVRESSSLAVSGSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVVQQLARMG  97

Query  311  SQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETR  490
            SQV+VP+RG ++  RHLKLMGDLGQIVP+KY+ RDE+SIKA +A +NV++N IG+EYETR
Sbjct  98   SQVMVPYRGLDEEWRHLKLMGDLGQIVPIKYDARDEDSIKAAIANSNVIVNCIGKEYETR  157

Query  491  NYSFEEVNHYMAKQLASI  544
            N+SF++VN+ ++ +++ +
Sbjct  158  NFSFDDVNYGISNRISKL  175



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
            AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGRE
Sbjct  39   AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGRE  98

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            YETRNY F+EVNH+MA+QLA I
Sbjct  99   YETRNYGFDEVNHHMAEQLAMI  120



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  475
            ++KMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDENSIKAVMAKANVVINLIGR
Sbjct  42   MSKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDENSIKAVMAKANVVINLIGR  101

Query  476  EYETRNYSFEEVNHYMAKQLASI  544
            EYETRN+SFEEVNH+MA+QLA I
Sbjct  102  EYETRNFSFEEVNHFMAEQLAVI  124



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYE  60

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRNY F+EVNH+MA+QLA I
Sbjct  61   TRNYGFDEVNHHMAEQLAMI  80



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +2

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQ-IVPMKYNPRDENSIKAVMAKANVVINLIGREY  481
            MGSQVLVPFRGSED  RHLKLMGDLGQ IVPMKY+PRDENSIKAVMAKANVVINLIGREY
Sbjct  1    MGSQVLVPFRGSEDNPRHLKLMGDLGQQIVPMKYDPRDENSIKAVMAKANVVINLIGREY  60

Query  482  ETRNYSFEEVNHYMAKQLASI  544
            ETRNYSFEEVNH+MA+QLA I
Sbjct  61   ETRNYSFEEVNHFMAEQLAVI  81



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 14/145 (10%)
 Frame = +2

Query  119  YLLSDQC---YGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLV  289
            + L DQ    +G    R++S+L   G+   V++GTGGRSSVSG+VATVFGATGFLGRY++
Sbjct  30   HFLRDQANLGFGNAAVRHSSSLAVSGSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVI  89

Query  290  QQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLI  469
            QQLA+MGSQV+             +  G LGQIVP+KY+ RDE SIK V+A +NV++N I
Sbjct  90   QQLARMGSQVMA-----------FEAHGRLGQIVPIKYDARDEGSIKPVIANSNVIVNCI  138

Query  470  GREYETRNYSFEEVNHYMAKQLASI  544
            G+EYETRN+SFE+VNH ++ +++ +
Sbjct  139  GKEYETRNFSFEDVNHGISNRISKL  163



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  337
            R+A  L  +G   +V K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+RG
Sbjct  1    RHAFNLATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYRG  60

Query  338  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  517
             ED  RHLK+MGDLGQIVP   N RDE++I+A +AK+NVVINLIG+EYETRNY FEEVN 
Sbjct  61   LEDKPRHLKVMGDLGQIVPFVCNIRDEDAIRAAIAKSNVVINLIGQEYETRNYGFEEVNI  120

Query  518  YMAKQLASI  544
             +A+++A I
Sbjct  121  DIAQRIARI  129



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +2

Query  158  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  337
            R+A  L  +G   +V K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+RG
Sbjct  10   RHAFNLATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYRG  69

Query  338  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  517
             ED  RHLK+MGDLGQIVP   N RD+++I+A +AK+NVVINLIG+EYETRNY FEEVN 
Sbjct  70   LEDKPRHLKVMGDLGQIVPFVCNIRDDDAIRAAIAKSNVVINLIGQEYETRNYGFEEVNI  129

Query  518  YMAKQLASI  544
             +A+++A I
Sbjct  130  DIAQRIARI  138



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD NSIK  +AK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRNY FEEVNH MA+QLA I
Sbjct  61   TRNYGFEEVNHQMAEQLAMI  80



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  305  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  484
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD NSIK  +AK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  485  TRNYSFEEVNHYMAKQLASI  544
            TRNY FEEVNH MA+QLA I
Sbjct  61   TRNYGFEEVNHQMAEQLAMI  80



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  203  RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLG  382
            +KGTGGRSS SGI A VFG+TGFLGRY+V  LAK GS+VLVP R SE+  +HLK MGDLG
Sbjct  82   KKGTGGRSSYSGITAAVFGSTGFLGRYVVNHLAKNGSRVLVPTRCSENHRQHLKPMGDLG  141

Query  383  QIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            QIV   Y+ RD+ +IK  + +ANVVIN++GRE+ETRN+SFE+V+    ++LA
Sbjct  142  QIVQFDYSMRDDEAIKYAVERANVVINMVGREWETRNFSFEDVHRDFPRRLA  193



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            GTGGRSS SGI  TVFG+TGFLGRY+V  +AK GS++++P R SE+  +HLK+MGDLGQI
Sbjct  22   GTGGRSSFSGITCTVFGSTGFLGRYVVHHVAKSGSRMILPTRCSENDRQHLKVMGDLGQI  81

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            V + Y  RDE +I+  + ++NVVIN++GRE+ETRN+SFE+VN    K+LA I
Sbjct  82   VQLDYGIRDEETIRYAVERSNVVINMVGREWETRNFSFEDVNVTFPKKLAEI  133



>dbj|GAA99675.1| hypothetical protein E5Q_06378 [Mixia osmundae IAM 14324]
 gb|KEI40362.1| hypothetical protein L969DRAFT_94166 [Mixia osmundae IAM 14324]
Length=386

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = +2

Query  158  RYASTLTAKGTG--HIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  331
            RY   LT K      I+R G GGR S +G VATVFG TGFLGRYLV +LAK G+QV++P+
Sbjct  32   RYQHDLTIKQKDGRPILRSGPGGRHSFTGHVATVFGCTGFLGRYLVHKLAKKGTQVIIPY  91

Query  332  RGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            R  ED  RHLK+MGDLGQIVPM+++ R+++ I+  +  ++VV NL+GR+YET+N+ F EV
Sbjct  92   R-DEDEKRHLKVMGDLGQIVPMEWDIRNDSQIEEAVRHSDVVYNLVGRDYETKNFKFHEV  150

Query  512  NHYMAKQLASI  544
            +   A+++ASI
Sbjct  151  HIDGARRIASI  161



>ref|XP_005537134.1| NADH dehydrogenase I alpha subcomplex 9, mitochondrial precursor 
[Cyanidioschyzon merolae strain 10D]
 dbj|BAM81098.1| NADH dehydrogenase I alpha subcomplex 9, mitochondrial precursor 
[Cyanidioschyzon merolae strain 10D]
Length=392

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  206  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  385
            +GTGGRSSVSGI+ATVFG+TGFLGRY+V QL ++GS V V +RG E  +RHLK+MGDLGQ
Sbjct  46   EGTGGRSSVSGIIATVFGSTGFLGRYVVSQLGRIGSTVFVAWRGDELDNRHLKVMGDLGQ  105

Query  386  IVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            I P++   RD NS++  +A +NVVINLIG+ Y+TR YS E+VN  +A+ +A +
Sbjct  106  INPIQIEARDINSLRRSIAGSNVVINLIGKWYDTRYYSLEDVNIGVAETIARL  158



>ref|XP_007872120.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
 gb|EMR11825.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
Length=361

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            +++KGT GRSS+SG +AT+FGATGFLGRYLV  LAK G+ +++P+R  +D  RHLK++GD
Sbjct  43   LIKKGTEGRSSISGHIATIFGATGFLGRYLVNNLAKQGTTIIIPWR-DQDSKRHLKVLGD  101

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQIV M+++ RDE SIK  +  +N+V NLIGR+YET+N+S+E+V+ + A ++A
Sbjct  102  LGQIVMMEFDLRDEISIKESVRHSNIVYNLIGRDYETKNFSYEDVHIHGAAKIA  155



>ref|XP_004339653.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR17640.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
Length=376

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  394
            GGRSSVSG+VATVFG TGFLGR++V +L K+GSQV+VP+RG E   RHLK+MGDLGQI P
Sbjct  37   GGRSSVSGVVATVFGCTGFLGRFVVNRLGKIGSQVIVPYRGEESAFRHLKVMGDLGQIAP  96

Query  395  MKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            + ++ RD+ +++  +  +NVVINL+G+ +ETRN+SF++V+    + +A
Sbjct  97   VWFDLRDKETVRRAVQYSNVVINLLGKRWETRNFSFDDVHPEATRTIA  144



>ref|XP_005681037.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Capra hircus]
Length=380

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>gb|KIO18953.1| hypothetical protein M407DRAFT_153532 [Tulasnella calospora MUT 
4182]
Length=374

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSG VATVFG TGFLGRYLV +LAK G+QV+VPFR  ED  RHLK+MGD
Sbjct  31   VISYGPAGRSSVSGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPFR-DEDEKRHLKVMGD  89

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++P+ ++ RD ++I   +  ++VV NL GREYET+N++FE+VN   A+ +A +
Sbjct  90   LGQVIPLMWDMRDPDTIAECVRHSDVVYNLAGREYETKNFTFEDVNVTGAQLIAEV  145



>ref|XP_004006995.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ovis aries]
Length=380

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>ref|XP_006957558.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
 gb|EIM22301.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
Length=378

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  352
            +T K    ++R G GGRSS +G VATVFG TGFLGRYLVQ++A+ G+QV+VP+R  E   
Sbjct  29   ITPKSKSPVLRLGPGGRSSTTGHVATVFGCTGFLGRYLVQKIARTGAQVVVPYR-DEMEK  87

Query  353  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  532
            RHLK+MGDLGQIVPM+++ R  + I   +  ++VV NL+GR++ET+N+S+E+V+  +A  
Sbjct  88   RHLKVMGDLGQIVPMEWDARRPDQIAECLRHSDVVYNLVGRDHETKNFSYEDVHTKVASD  147

Query  533  LASI  544
            +ASI
Sbjct  148  IASI  151



>ref|XP_008274666.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Stegastes partitus]
Length=381

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+ KG GGRSS SG  ATVFGATGFLGRY+V +L +MGSQV+VP R       +++ MGD
Sbjct  43   IIPKGKGGRSSFSGFSATVFGATGFLGRYVVNRLGRMGSQVIVPHRCDRYDLMYMRPMGD  102

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ M+++ RD++SIK  MA +NVVINL+GRE+ETRNY FE+V   + +Q+A
Sbjct  103  LGQIIFMEWDARDKDSIKQAMASSNVVINLVGREWETRNYRFEDVFVSIPQQIA  156



>ref|XP_002736180.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Saccoglossus kowalevskii]
Length=253

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +2

Query  185  GTGH--IVRKGTGGRSSVSGIVATVFG-ATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  355
            GT H  +V +G GGRSS SG++ATVFG +TGF+GRY++ +L + GSQ++VP+R   D  R
Sbjct  41   GTYHDAMVPRGRGGRSSFSGVIATVFGGSTGFVGRYVINRLGREGSQIIVPYRCDPDDIR  100

Query  356  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  535
            HLK+MGDLGQI+P+ ++   ++S++ +M  +NVVINL+G++YETRNY FE+++  +A ++
Sbjct  101  HLKVMGDLGQIIPLTFDVNSDDSLREMMQHSNVVINLMGKDYETRNYRFEDIHIDIAGRV  160

Query  536  ASI  544
            ASI
Sbjct  161  ASI  163



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 102/141 (72%), Gaps = 8/141 (6%)
 Frame = +2

Query  122  LLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  301
            L S Q +     R AS+L    TG    +GTGGRSS+SGI +TVFG++GFLGRY+V  + 
Sbjct  28   LASQQVFS----RDASSLPVTYTG----RGTGGRSSISGITSTVFGSSGFLGRYVVNHIG  79

Query  302  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  481
            K GS++++P R +E+  +HLK+MGDLGQIV + ++ RD ++IK  + ++NVV+N++GRE+
Sbjct  80   KSGSKMILPNRCNENARQHLKVMGDLGQIVHLDFSIRDADAIKYAVERSNVVVNMVGREW  139

Query  482  ETRNYSFEEVNHYMAKQLASI  544
            ETRN+SFE+V+     +LA I
Sbjct  140  ETRNFSFEDVHVEFPAKLAEI  160



>ref|XP_007902354.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Callorhinchus milii]
Length=370

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  32   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  91

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI  + ++ RD++SI+  +  +NVVINL+GRE+ET NY FE+VN  + +Q+A
Sbjct  92   LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIA  145



>gb|KIJ17694.1| hypothetical protein PAXINDRAFT_167681 [Paxillus involutus ATCC 
200175]
Length=359

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  355
            T  G   +V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  R
Sbjct  27   TLPGRKAVVSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEKR  85

Query  356  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  535
            HLKLMGDLGQIVPM+++ R+EN I   +  +++V NL+GR+YET+N+ + +V+   A+++
Sbjct  86   HLKLMGDLGQIVPMEWDIRNENQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTGAERI  145

Query  536  ASI  544
            A +
Sbjct  146  AKL  148



>ref|NP_001094222.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Rattus norvegicus]
 sp|Q5BK63.2|NDUA9_RAT RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; AltName: Full=Sperm flagella protein 3; Flags: 
Precursor [Rattus norvegicus]
 gb|EDM01826.1| rCG30092 [Rattus norvegicus]
 gb|AAI68777.1| Ndufa9 protein [Rattus norvegicus]
Length=377

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V
Sbjct  100  LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDV  144



>ref|XP_003126608.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sus scrofa]
Length=377

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ M++N +D++SI+ V+  +NVVINL+GRE+ET+N+ FE+V
Sbjct  100  LGQIIFMEWNGKDKDSIRKVVEHSNVVINLVGREWETKNFDFEDV  144



>gb|AAH91192.1| Ndufa9 protein, partial [Rattus norvegicus]
Length=370

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  33   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  92

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V
Sbjct  93   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDV  137



>ref|NP_001279619.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Callorhinchus milii]
 gb|AFK11425.1| Ndufa9 protein [Callorhinchus milii]
Length=380

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  42   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  101

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI  + ++ RD++SI+  +  +NVVINL+GRE+ET NY FE+VN  + +Q+A
Sbjct  102  LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIA  155



>ref|XP_006237562.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Rattus norvegicus]
Length=373

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  36   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  95

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V
Sbjct  96   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDV  140



>ref|XP_001626712.1| predicted protein [Nematostella vectensis]
 gb|EDO34612.1| predicted protein [Nematostella vectensis]
Length=372

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 7/141 (5%)
 Frame = +2

Query  125  LSDQCYG---IGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  295
            L  QC G   IGT    + ++ +   ++ +KGTGGRSS +G+ ATVFGATGFLGRY++ +
Sbjct  9    LVAQCQGKPLIGT----AVVSTRKISYLPKKGTGGRSSFNGVSATVFGATGFLGRYVINR  64

Query  296  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  475
            L ++G+Q+ VP+RG E   RHL+LMGDLGQI    ++ +DE SI  ++  +NVV+NLIGR
Sbjct  65   LGRVGTQLTVPYRGDEHDIRHLRLMGDLGQIDFFDFHLKDEESIAKMVKHSNVVVNLIGR  124

Query  476  EYETRNYSFEEVNHYMAKQLA  538
             +ETRN++FEEV+   A+ +A
Sbjct  125  GFETRNFNFEEVHVDGARTIA  145



>ref|XP_005084120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mesocricetus auratus]
Length=377

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+ MGDLGQI+ ++++ RD++SIK  +  +NVVINL+GR++ETRN+ FE
Sbjct  83   PYRCDPYDTMHLRPMGDLGQIIFLEWDARDKDSIKRAVQHSNVVINLVGRDWETRNFDFE  142

Query  506  EV  511
            +V
Sbjct  143  DV  144



>ref|XP_007469502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Lipotes vexillifer]
Length=377

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>gb|KDN41067.1| putative NADH2 dehydrogenase 40K chain [Tilletiaria anomala UBC 
951]
Length=398

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +2

Query  215  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  394
            GGR+SVSG VATVFG TGFLGRYLV +LA+ G+QV+VPFR  ED  RHLK+MGDLGQ+VP
Sbjct  64   GGRNSVSGHVATVFGCTGFLGRYLVSRLAQKGTQVIVPFR-DEDEKRHLKIMGDLGQVVP  122

Query  395  MKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            M+++ RDE  I+  +  ++ V NL GR YET+N+SF +VN   A+++A +
Sbjct  123  MEWDIRDEGMIEECLRHSDTVYNLTGRAYETKNFSFADVNRDGARRIAEV  172



>ref|XP_002712902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Oryctolagus cuniculus]
Length=377

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVQHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQV  155



>gb|AAH05760.1| Ndufa9 protein, partial [Mus musculus]
Length=348

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  11   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGD  70

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ+  ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V
Sbjct  71   LGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDV  115



>ref|XP_004610502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sorex araneus]
Length=378

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            +V  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  41   VVPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  100

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ +++N RD++SI+  + ++NVVINL+GRE+ETRN+ FE+V
Sbjct  101  LGQIIFLEWNGRDKDSIRRAVEQSNVVINLVGREWETRNFGFEDV  145



>gb|KIK91888.1| hypothetical protein PAXRUDRAFT_830459 [Paxillus rubicundulus 
Ve08.2h10]
Length=359

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  355
            T  G   +V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  R
Sbjct  27   TLPGRKAVVSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEKR  85

Query  356  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  535
            HLKLMGDLGQIVPM+++ R+E+ I   +  +++V NL+GR+YET+N+ + +V+   A+++
Sbjct  86   HLKLMGDLGQIVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTGAERI  145

Query  536  ASI  544
            A +
Sbjct  146  AKL  148



>gb|EAW88839.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_c [Homo sapiens]
Length=254

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  23   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  82

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  83   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQL  134



>gb|KDQ62587.1| hypothetical protein JAAARDRAFT_30488 [Jaapia argillacea MUCL 
33604]
Length=373

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+  G  GRS+++G VATVFG TGFLGRYLV +LAK G+QV+VP+R S+D  RHLK MGD
Sbjct  36   IISYGPPGRSALTGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPYRESDDA-RHLKPMGD  94

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ+VPM+++ R+E+ I   +  +++V NL+GR+YET+NYSF +VN   A ++A +
Sbjct  95   LGQVVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNYSFGDVNAAGAGRIAKV  150



>ref|XP_008574858.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Galeopterus variegatus]
Length=377

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++PFR       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPFRCERYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ +++N RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A +
Sbjct  100  LGQLIFLEWNGRDKDSIQRAVQHSNVVINLIGREWETRNFYFEDVFVKIPQAIAQV  155



>dbj|BAK63310.1| NADH dehydrogenase [Pan troglodytes]
Length=284

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  4    GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCGKYDIMHLRPMGDLGQL  63

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+NY FE+V   + + +A +
Sbjct  64   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQL  115



>ref|NP_079634.2| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Mus musculus]
 sp|Q9DC69.2|NDUA9_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Mus musculus]
 gb|AAH58378.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Mus musculus]
 gb|EDK99844.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Mus musculus]
Length=377

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T    G+ H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFCGSSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+LMGDLGQ+  ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE
Sbjct  83   PYRCDVYDIMHLRLMGDLGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFE  142

Query  506  EVNHYMAKQLA  538
            +V   + + +A
Sbjct  143  DVFVNIPRAIA  153



>ref|XP_004279068.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orcinus orca]
Length=377

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQI  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + +++N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFGFEDVFVKIPQAIAQV  155



>ref|XP_005334075.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ictidomys tridecemlineatus]
Length=354

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDVMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N RD++SI+  +  +NVVINL+GR++ETRN+ FE+V   + + +A I
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGRDWETRNFDFEDVFVKIPQTIAQI  155



>ref|XP_006053611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bubalus bubalis]
Length=380

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQV  155



>ref|XP_010843290.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bison bison bison]
Length=376

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  36   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  95

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ETRN+ FE+V   + + +A +
Sbjct  96   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETRNFDFEDVFVKIPQAIAQV  151



>ref|XP_004347048.1| Ndufa9 protein [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94781.1| Ndufa9 protein [Capsaspora owczarzaki ATCC 30864]
Length=324

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  170  TLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  349
            TL     G + R GTGGRSSVSG+VATVFG+TGF+GRYLV +L ++GSQ+++P+RG E  
Sbjct  56   TLAKWSGGPVSRAGTGGRSSVSGVVATVFGSTGFIGRYLVNRLGRVGSQLILPYRGDEHA  115

Query  350  HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAK  529
            +RHLK MGDLGQ     Y+ RD++++K ++  +NVV NL+G+E+ TRN+S  +V+   A+
Sbjct  116  YRHLKPMGDLGQFSFPFYHLRDKDTVKRLVEHSNVVFNLVGQEFATRNFSLHDVHVTGAE  175

Query  530  QLA  538
             +A
Sbjct  176  TIA  178



>ref|XP_006795902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Neolamprologus brichardi]
Length=303

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 99/140 (71%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  LSDQCY-GIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            +S  CY  + +    +T+  +   H ++ KG GGRSS SGI ATVFGATGFLGRY+V +L
Sbjct  17   ISSNCYPALLSAASVTTVQQRKLHHALIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRL  76

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
             ++GSQ+++P R  +    H + MGDLGQI+ ++++ R+++SIK  M  +NVVINL+GRE
Sbjct  77   GRIGSQIIIPHRCDQYDLMHFRPMGDLGQILFLQWDARNKDSIKRAMEHSNVVINLVGRE  136

Query  479  YETRNYSFEEVNHYMAKQLA  538
            +ETRN+ FE+V   + +Q+A
Sbjct  137  WETRNFRFEDVYVTIPQQIA  156



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            GTGGRSS SGI  TVFG+TGFLGRY+   +AK GS++++P R  E+  +HLK+MGDLGQI
Sbjct  21   GTGGRSSFSGITCTVFGSTGFLGRYVTHHVAKSGSRMILPTRCGENDRQHLKVMGDLGQI  80

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + M Y   DE +I+  + ++NVVIN++GRE+ETRN+SFE+V+    K+LA I
Sbjct  81   LQMDYAISDEGAIRHAVERSNVVINMVGREWETRNFSFEDVHVTFPKKLAEI  132



>ref|XP_005957904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pantholops hodgsonii]
Length=380

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQVIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>ref|XP_003496081.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 ref|XP_007637435.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 gb|EGV98504.1| hypothetical protein I79_001369 [Cricetulus griseus]
Length=377

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDTYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  506  EV  511
            ++
Sbjct  143  DI  144



>ref|NP_001073383.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pan troglodytes]
 ref|XP_008972004.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pan paniscus]
 sp|Q0MQB4.1|NDUA9_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pan troglodytes]
 gb|ABH12229.1| mitochondrial complex I subunit NDUFA9 [Pan troglodytes]
Length=377

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+NY FE+V
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDV  144



>gb|ABH12231.1| mitochondrial complex I subunit NDUFA9 [Pongo pygmaeus]
Length=381

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  103

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ETRN+ FE+V
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDV  148



>ref|XP_007935381.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orycteropus afer afer]
Length=377

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGDLGQI  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + +++N RD++SI+  +  +NVVINL+GRE+ET+N+ FE++   + + +A +
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQV  155



>ref|XP_007170262.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Balaenoptera acutorostrata scammoni]
Length=377

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQI  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + M+++ RD++SI+  +  +NVV+NL+GRE+ET+N+ FE+V   + + +A +
Sbjct  104  IFMEWSGRDKDSIRRAVEHSNVVVNLVGREWETKNFDFEDVFVKIPQAIAQV  155



>ref|NP_001127602.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pongo abelii]
 sp|P0CB81.1|NDUA9_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo abelii]
 sp|P0CB82.1|NDUA9_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo pygmaeus]
 emb|CAH92896.1| hypothetical protein [Pongo abelii]
Length=377

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ETRN+ FE+V
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDV  144



>ref|XP_006987942.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Peromyscus maniculatus bairdii]
Length=377

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPPHRQLHHAVMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+ MGDLGQI+ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDVYDTMHLRPMGDLGQIIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  506  EV  511
            +V
Sbjct  143  DV  144



>ref|XP_009546417.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW81816.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
Length=347

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+  G  GRS+V+G VATVFG TGFLGRYLV +LAK G+QV++P+R  ED  RHLK+MGD
Sbjct  20   ILSYGPAGRSAVTGHVATVFGCTGFLGRYLVSKLAKTGTQVIIPYR-DEDEKRHLKVMGD  78

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQIVPM+++ R++N  +  +  +++V NL+GREYET+N+S+ + N     ++A I
Sbjct  79   LGQIVPMEWDLRNDNQTEECVRHSDIVYNLVGREYETKNFSYRDANALGPARIADI  134



>ref|NP_001013477.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Danio rerio]
 gb|AAH91545.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Danio 
rerio]
 gb|AAI64086.1| Ndufa9 protein [Danio rerio]
Length=309

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  301
            LS  C  +       T+  +   H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  302  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  481
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  482  ETRNYSFEEVNHYMAKQLA  538
            ET NY +E+V   +  Q+A
Sbjct  137  ETSNYKYEDVFVSIPLQIA  155



>ref|XP_003390219.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Amphimedon queenslandica]
Length=367

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +2

Query  173  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  352
            LT K     V++GTGGRSS SG VATVFG TGF GRY+V +L ++GSQ++ P+RG E  +
Sbjct  23   LTKKSISSDVKRGTGGRSSFSGTVATVFGCTGFCGRYIVNRLGQVGSQIVAPYRGDEHDY  82

Query  353  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVN  514
            RHL+ MGDLGQI+   +N RD  S+   +  +NVV+N IGR+YETRN+ F++V+
Sbjct  83   RHLRPMGDLGQILFRSFNLRDPESVTKTLEYSNVVVNAIGRDYETRNFKFDDVH  136



>gb|AAH03351.1| Similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 
9 (39kD), partial [Homo sapiens]
Length=338

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  5    GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  64

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  65   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQL  116



>ref|XP_003796469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Otolemur garnettii]
Length=377

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDFMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ +++N RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  100  LGQLIFLEWNGRDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQV  155



>gb|KDN34621.1| hypothetical protein RSAG8_12283, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=161

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+  G  GRS+VSG VATVFG TGFLGRYLV +LAK G+QV++P+R  ED  RHLK++GD
Sbjct  33   IISYGPSGRSAVSGHVATVFGCTGFLGRYLVSKLAKAGTQVIIPYR-DEDEKRHLKILGD  91

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQIV ++++ R E+ I   M  +++V NL+GR+YET+N+ +E V+   A  +A+I
Sbjct  92   LGQIVALEWDLRREDQIAECMRHSDIVYNLVGRDYETKNFDYESVHVTGAATIANI  147



>ref|XP_009266962.1| hypothetical protein J056_003464 [Wallemia ichthyophaga EXF-994]
 gb|EOR02902.1| hypothetical protein J056_003464 [Wallemia ichthyophaga EXF-994]
Length=372

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  352
            +T K    I+R+G GGRSSV+G VATVFG TGFLGRY VQ++A+ G+QV+ P+R  E   
Sbjct  27   ITPKSKSPILRQGPGGRSSVTGHVATVFGCTGFLGRYTVQKIARTGAQVVTPYR-DELER  85

Query  353  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  532
            RHLK MGDLGQIVPM+++ R+   I   +  ++VV NL+GR++ET+N+++++V+   A  
Sbjct  86   RHLKPMGDLGQIVPMEWDARNHQQIAECLRHSDVVYNLVGRDHETKNFNYDDVHVKAAAD  145

Query  533  LASI  544
            +ASI
Sbjct  146  IASI  149



>ref|XP_005365322.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Microtus ochrogaster]
Length=377

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 6/133 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHALIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDIYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  506  EVNHYMAKQLASI  544
            +V   + + +A +
Sbjct  143  DVFVKIPQTIAQV  155



>ref|XP_005365321.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Microtus ochrogaster]
Length=377

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 6/133 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHALIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDIYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  506  EVNHYMAKQLASI  544
            +V   + + +A +
Sbjct  143  DVFVKIPQTIAQV  155



>sp|Q0MQB3.2|NDUA9_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Gorilla gorilla gorilla]
Length=377

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDV  144



>ref|NP_001266630.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Gorilla gorilla]
 gb|ABH12230.1| mitochondrial complex I subunit NDUFA9 [Gorilla gorilla]
Length=381

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  103

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDV  148



>ref|XP_003988339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Felis catus]
Length=377

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N +D++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>gb|ELR54825.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial, partial [Bos mutus]
Length=363

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  82

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  83   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQV  138



>gb|AAA36350.1| NADH dehydrogenase (ubiquinone), partial [Homo sapiens]
Length=375

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  42   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  101

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V
Sbjct  102  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDV  142



>gb|AIC62000.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDV  144



>gb|ABF57357.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
Length=369

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  29   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  88

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  89   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQV  144



>ref|NP_991386.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Bos taurus]
 sp|P34943.1|NDUA9_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Bos taurus]
 emb|CAA42053.1| NADH dehydrogenase (ubiquinone) 42 kDa subunit [Bos taurus]
 gb|AAI02360.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
 tpg|DAA29189.1| TPA: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 
9, mitochondrial precursor [Bos taurus]
Length=380

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQV  155



>ref|NP_004993.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Homo sapiens]
 sp|Q16795.2|NDUA9_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Homo sapiens]
 gb|AAD42055.1|AF050641_1 NADH-ubiquinone oxidoreductase 39kDa subunit [Homo sapiens]
 gb|AAH09311.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAH15837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAI11547.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|EAW88837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_a [Homo sapiens]
 gb|ADQ31784.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[synthetic construct]
 gb|AIC49261.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDV  144



>gb|EFB28697.1| hypothetical protein PANDA_009221 [Ailuropoda melanoleuca]
Length=360

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  82

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  83   LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  138



>gb|AAI53423.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  301
            LS  C  +       T+  +   H IV +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAIVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  302  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  481
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  482  ETRNYSFEEVNHYMAKQLA  538
            ET NY +E+V   +  Q+A
Sbjct  137  ETSNYKYEDVFVSIPLQIA  155



>ref|XP_001515711.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Ornithorhynchus anatinus]
Length=405

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  68   VMPHGQGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVVIPYRCEPYDIMHLRPMGD  127

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ M++N RD+ SI+  +A +NVVINLIGR++ET+N+ F++V   + + +A +
Sbjct  128  LGQLLFMEWNARDKESIRRALAHSNVVINLIGRDWETKNFDFDDVFVKIPQSIAQL  183



>ref|XP_005897993.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bos mutus]
Length=380

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQV  155



>ref|XP_010963120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus bactrianus]
Length=377

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYIVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A +
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQV  155



>ref|XP_006210904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vicugna pacos]
Length=376

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A +
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQV  155



>ref|XP_006633741.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Lepisosteus oculatus]
Length=380

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++ +G GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    +L+ MGD
Sbjct  42   VIPRGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRVGSQIVIPHRCDQYDIMYLRPMGD  101

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ RD+ SI+  +A +NVVINL+GRE+ETR++SFE+V+  + KQ+A
Sbjct  102  LGQIIFLEWDARDKESIRRALAHSNVVINLVGREWETRHFSFEDVHVNIPKQIA  155



>gb|KDQ20806.1| hypothetical protein BOTBODRAFT_26820 [Botryobasidium botryosum 
FD-172 SS1]
Length=366

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +2

Query  149  GTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  328
             T R A  LT   +  ++  G  GRS+VSG VATVFGATGFLGRYL+ +LAK G+QV+VP
Sbjct  16   STRRAAHDLTVLPSKPVISYGPAGRSAVSGHVATVFGATGFLGRYLIAKLAKGGTQVIVP  75

Query  329  FRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEE  508
            FR  ED  RHL++ GDLGQIVP++++ R+E  I+  +  +++V NL+GR+YET+N+ ++ 
Sbjct  76   FR-EEDEARHLRVTGDLGQIVPLEWDLRNEEQIRECVRHSDIVYNLVGRDYETKNFDYQS  134

Query  509  VNHYMAKQLASI  544
            V+   A+ +A I
Sbjct  135  VHVKGAELIAQI  146



>ref|XP_006175621.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus ferus]
 ref|XP_010981110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus dromedarius]
Length=363

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  30   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  89

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A +
Sbjct  90   LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQV  141



>dbj|BAB22596.1| unnamed protein product [Mus musculus]
Length=377

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 93/131 (71%), Gaps = 6/131 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T    G+ H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFCGSSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+LMGD GQ+  ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE
Sbjct  83   PYRCDVYDIMHLRLMGDPGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFE  142

Query  506  EVNHYMAKQLA  538
            +V   + + +A
Sbjct  143  DVFVNIPRAIA  153



>gb|EAW88838.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_b [Homo sapiens]
Length=399

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  66   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  125

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  126  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQL  177



>ref|XP_002920485.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ailuropoda melanoleuca]
Length=377

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>ref|XP_006739694.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Leptonychotes weddellii]
Length=377

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 97/142 (68%), Gaps = 12/142 (8%)
 Frame = +2

Query  155  PRYASTLTAKGTG------------HIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            P   S++TA+ T              ++  G GGRSSVSGIVATVFGATGFLGRY+V  L
Sbjct  14   PMSRSSITARATAVFHGPPQRQLHHALIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHL  73

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
             +MGSQV+VP+R       HL+ MGDLGQI+ ++++ R+++SI+  +  +NVVINL+GRE
Sbjct  74   GRMGSQVIVPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGRE  133

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            +ET+N+ FE++   + + +A +
Sbjct  134  WETKNFDFEDIFVKIPRAIAQV  155



>ref|XP_006754928.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis davidii]
Length=377

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>ref|XP_007089756.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Panthera tigris altaica]
Length=462

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  125  LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  184

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N +D++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  185  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  240



>ref|XP_002920484.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ailuropoda melanoleuca]
Length=401

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  64   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  123

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  124  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  179



>gb|EFA77105.1| NADH dehydrogenase 1 alpha subcomplex subunit 9 [Polysphondylium 
pallidum PN500]
Length=369

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +2

Query  176  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  355
            T +  G IV      R+  SG+VATVFG TGF GRY+VQ L K G QV+VP+RG +   R
Sbjct  35   TIRNIGSIVH---ASRTHSSGLVATVFGVTGFTGRYIVQLLTKSGIQVVVPYRGEDYSFR  91

Query  356  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  535
             LK++G+LGQI+P++Y+ RD++SI+  M+ +N+VIN+I R YETRN+SFE+VN   A ++
Sbjct  92   DLKVLGELGQIIPVRYDIRDQDSIERAMSHSNIVINMISRNYETRNFSFEDVNIDAATKI  151

Query  536  ASI  544
            A +
Sbjct  152  AKL  154



>ref|XP_001494651.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus caballus]
Length=377

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVMVPYRCDTYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ +++N R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDV  144



>ref|XP_006862735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chrysochloris asiatica]
Length=377

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDLMHLRPMGDLGQI  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + +++N RD++SI+  +  +NVVINL+GRE+ET+N+ +E+V   + + +A +
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDYEDVFVKIPQAIAQV  155



>ref|XP_008528773.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus przewalskii]
Length=377

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ +++N R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDV  144



>ref|XP_005174380.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Danio rerio]
Length=380

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  301
            LS  C  +       T+  +   H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  302  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  481
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  482  ETRNYSFEEVNHYMAKQLA  538
            ET NY +E+V   +  Q+A
Sbjct  137  ETSNYKYEDVFVSIPLQIA  155



>gb|AAI52140.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  125  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  301
            LS  C  +       T+  +   H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  302  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  481
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  482  ETRNYSFEEVNHYMAKQLA  538
            ET NY +E+V   +  Q+A
Sbjct  137  ETSNYKYEDVFVSIPLQIA  155



>ref|XP_008823675.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nannospalax galili]
Length=377

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ RD  SI+  +  +NVVINL+GRE+ETRN+ FE V   + + +A +
Sbjct  100  LGQIIFLEWDARDRASIRRAVEYSNVVINLVGREWETRNFDFENVFVKIPQAIAQV  155



>ref|XP_005950396.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Haplochromis burtoni]
Length=381

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIA  156



>ref|XP_005950395.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Haplochromis burtoni]
Length=382

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIA  157



>gb|AAH68378.1| Ndufa9 protein, partial [Danio rerio]
Length=374

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  36   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  95

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A
Sbjct  96   LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIA  149



>ref|XP_005734821.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Pundamilia nyererei]
Length=381

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIA  156



>ref|XP_005734820.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Pundamilia nyererei]
Length=382

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIA  157



>ref|XP_007503809.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Monodelphis domestica]
Length=345

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N +D++SI+  +  +NVVINL+GR++ETRN+ F +V   + + +A +
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQL  155



>ref|XP_534915.3| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform 1 [Canis lupus familiaris]
Length=377

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 97/142 (68%), Gaps = 12/142 (8%)
 Frame = +2

Query  155  PRYASTLTAKGTGH------------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            P   S++TA+ T              ++  G GGRSSVSG+VATVFGATGFLGRY+V  L
Sbjct  14   PMSRSSITARATAMFHGPLRRQLHHALIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHL  73

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
             +MGSQV++P+R       HL+ MGDLGQI+ ++++ R+++SI+  +  +NVVINLIGRE
Sbjct  74   GRMGSQVIIPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIQRAVKHSNVVINLIGRE  133

Query  479  YETRNYSFEEVNHYMAKQLASI  544
            +ET+N+ FE+V   + + +A +
Sbjct  134  WETKNFDFEDVFVKIPQAIAKV  155



>ref|XP_003410681.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Loxodonta africana]
Length=380

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +2

Query  194  HIVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  370
            H++R  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ M
Sbjct  41   HVLRPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMYLRPM  100

Query  371  GDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            GDLGQI+ +++N RD++SI+  +  +NVVINL+G+++ETRN+ FE+V   + + +A +
Sbjct  101  GDLGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGQDWETRNFDFEDVFVKIPQAIAQV  158



>ref|XP_004459092.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Dasypus novemcinctus]
Length=384

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+S+E+V
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFSYEDV  144



>ref|XP_010357461.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Rhinopithecus roxellana]
Length=377

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGDLGQL  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            + ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  104  LFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQV  155



>ref|XP_001372251.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Monodelphis domestica]
Length=377

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N +D++SI+  +  +NVVINL+GR++ETRN+ F +V   + + +A +
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQL  155



>gb|ETS63618.1| hypothetical protein PaG_01917 [Pseudozyma aphidis DSM 70725]
Length=385

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  34   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  92

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPM+++ R++  I+  +  ++VV NL GR YET+N+SF +V+   
Sbjct  93   DEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVAG  152

Query  524  AKQLASI  544
            A+++A I
Sbjct  153  AQRIAQI  159



>gb|ETN62206.1| NADH-ubiquinone oxidoreductase 39 kda subunit [Anopheles darlingi]
Length=401

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDL  379
            +++GTGGRSS +GIVATVFG+TGFLGRY+  +L K+GSQV++P+R        LKL+GDL
Sbjct  45   IKRGTGGRSSFNGIVATVFGSTGFLGRYVCNKLGKIGSQVIIPYRADHYEALRLKLVGDL  104

Query  380  GQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            GQ++   Y+ RDE++I+  +  +NVVINL+GR++ET+N+SF++V+   A++LA I
Sbjct  105  GQVLFHPYDLRDEDAIRKAVKYSNVVINLVGRDWETKNFSFKDVHVEGARRLARI  159



>ref|XP_004416912.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Odobenus rosmarus divergens]
Length=377

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 92/131 (70%), Gaps = 12/131 (9%)
 Frame = +2

Query  155  PRYASTLTAKGTG------------HIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  298
            P   S++TA+ T              ++  G GGRSSVSGIVATVFGATGFLGRY+V  L
Sbjct  14   PMSRSSITARATAVFHGPPQRQLHHALIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHL  73

Query  299  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  478
             +MGSQV+VP+R       HL+ MGDLGQI+ ++++ R+++SI+  +  +NVVINL+GRE
Sbjct  74   GRMGSQVIVPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIQRAVKHSNVVINLVGRE  133

Query  479  YETRNYSFEEV  511
            +ET+N+ FE++
Sbjct  134  WETKNFDFEDI  144



>dbj|GAC73597.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
antarctica T-34]
Length=385

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  34   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  92

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPM+++ R++  I+  +  ++VV NL GR YET+N+SF +V+   
Sbjct  93   DEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVAG  152

Query  524  AKQLASI  544
            A+++A I
Sbjct  153  AQRIAQI  159



>ref|XP_005877078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis brandtii]
 ref|XP_006096122.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis lucifugus]
 gb|EPQ14420.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Myotis brandtii]
Length=377

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQV  155



>ref|XP_006923900.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pteropus alecto]
 gb|ELK02573.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Pteropus alecto]
Length=377

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ+++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQIIIPHRCERYDIMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+NY FE+V   + + +A +
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGRDWETKNYDFEDVFVKIPQAIAQV  155



>dbj|GAK62286.1| NAD(P)-binding protein [Pseudozyma antarctica]
Length=386

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  35   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  93

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPM+++ R++  I+  +  ++VV NL GR YET+N+SF +V+   
Sbjct  94   DEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVAG  153

Query  524  AKQLASI  544
            A+++A I
Sbjct  154  AQRIAQI  160



>emb|CBQ67793.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Sporisorium 
reilianum SRZ2]
Length=392

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRYLV +LA+ G+QV++P+R  E
Sbjct  41   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYLVNRLAQKGTQVIIPYR-DE  99

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQIVPM+++ R +  I+  +  ++VV NL+GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQIVPMEWDLRHDEQIEECVRHSDVVYNLVGRHYETKNFTFNDVHVTG  159

Query  524  AKQLASI  544
            A+++A I
Sbjct  160  AQRIAQI  166



>dbj|BAF83756.1| unnamed protein product [Homo sapiens]
Length=377

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  209  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  388
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  389  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE V
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEGV  144



>ref|XP_003447104.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oreochromis niloticus]
Length=381

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ R+++SIK  M  ++VVINL+GRE+ETRN+ FE+V   + +Q+A
Sbjct  103  LGQIIFLEWDARNKDSIKRAMEHSDVVINLVGREWETRNFRFEDVFVTIPQQIA  156



>gb|EXX58721.1| hypothetical protein RirG_195270 [Rhizophagus irregularis DAOM 
197198w]
Length=386

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = +2

Query  134  QCYGIGT------PRYASTLTAKGT--GHIVRKGTGGRSSVSGIVATVFGATGFLGRYLV  289
            Q +GI T       R+A  L  + T    I++ G GGRSSVSG +ATVFG+TGFLGRYLV
Sbjct  16   QNFGIITFKQFKQKRFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLV  75

Query  290  QQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLI  469
             +LAK G+QV++P+R  ED  RHLK+ GDLGQ+V ++++ R+E +I   +  +++V NLI
Sbjct  76   SKLAKHGTQVVLPYR-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLI  134

Query  470  GREYETRNYSFEEVNHYMAKQLASI  544
            GR+YET+N+++E+V+   A+++A +
Sbjct  135  GRDYETKNFTYEKVHIEGAERIAKL  159



>gb|ESA03096.1| hypothetical protein GLOINDRAFT_336975 [Rhizophagus irregularis 
DAOM 181602]
Length=384

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = +2

Query  134  QCYGIGT------PRYASTLTAKGT--GHIVRKGTGGRSSVSGIVATVFGATGFLGRYLV  289
            Q +GI T       R+A  L  + T    I++ G GGRSSVSG +ATVFG+TGFLGRYLV
Sbjct  14   QNFGIITFKQFKQKRFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLV  73

Query  290  QQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLI  469
             +LAK G+QV++P+R  ED  RHLK+ GDLGQ+V ++++ R+E +I   +  +++V NLI
Sbjct  74   SKLAKHGTQVVLPYR-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLI  132

Query  470  GREYETRNYSFEEVNHYMAKQLASI  544
            GR+YET+N+++E+V+   A+++A +
Sbjct  133  GRDYETKNFTYEKVHIEGAERIAKL  157



>ref|XP_007882091.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
 gb|EPQ26151.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
Length=390

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I+R+G   GGRSSVSG VATVFG TGFLGRYLV +L++ G+QV+VP+R  E
Sbjct  39   TIKRKTGKPIIRQGPYGGGRSSVSGHVATVFGCTGFLGRYLVNRLSQKGTQVIVPYR-DE  97

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQ+VP++++ R++  I+  +  ++ V NL GR+YET+N+SF +V+   
Sbjct  98   DEKRHLKVMGDLGQVVPLEWDIRNDQQIQECIRHSDTVYNLTGRQYETKNFSFSDVHVTG  157

Query  524  AKQLASI  544
            A+++A +
Sbjct  158  ARRIAEM  164



>gb|ERE67037.1| putative polypeptide N-acetylgalactosaminyltransferase 8-like 
protein [Cricetulus griseus]
Length=958

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +2

Query  164  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDTYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  506  EV  511
            ++
Sbjct  143  DI  144



>ref|XP_007304718.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
 gb|EIM85758.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
Length=379

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+  G  GRS+ +G VATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHLK+MGD
Sbjct  35   IIAYGPPGRSATTGHVATVFGCTGFLGRYLVSKLAKAGTQVVVPYR-DEDEKRHLKVMGD  93

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQIVP++++ R EN I+  +  +++V NL GREY+T+ +S  +VN   A ++AS+
Sbjct  94   LGQIVPLEWDIRSENQIEECLRHSDIVYNLTGREYDTKRFSLHDVNSTGAGRIASV  149



>ref|XP_004692611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Condylura cristata]
Length=569

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCEPYDVMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWDARNKDSIRRAVEHSNVVINLVGREWETRNFDFEDVYVKIPQAIAQV  155



>ref|XP_004778323.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
 ref|XP_004823819.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
Length=377

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+ +SI   +  +NVVINL+GRE+ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWDGRNRDSIHRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQV  155



>ref|XP_001835685.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
 gb|EAU86256.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
Length=366

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  146  IGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            +G   Y   +T      +V  G  G S+VSG   TVFG TGFLGRYLV +L K+G+QV+ 
Sbjct  17   VGKRAYHDLVTLPSKKPVVSYGPPGYSAVSGHTVTVFGCTGFLGRYLVSKLGKIGTQVVA  76

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R  ED  RHLKLMGDLGQIV M+++ RDE SI   +  ++ VINL+GR+Y T+N+ F+
Sbjct  77   PYR-DEDESRHLKLMGDLGQIVRMEWDLRDEKSIAECLRHSDTVINLVGRDYTTKNFDFK  135

Query  506  EVNHYMAKQLASI  544
            +VN   A+++A I
Sbjct  136  QVNALGAERIAKI  148



>ref|XP_008141973.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eptesicus fuscus]
Length=377

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+ FE+V   + + +A +
Sbjct  100  LGQIIFLEWNVRNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQV  155



>gb|KIJ64483.1| hypothetical protein HYDPIDRAFT_28424 [Hydnomerulius pinastri 
MD-312]
Length=359

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  352
            +T  G   I+ +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  
Sbjct  26   VTLPGRKPIISQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEK  84

Query  353  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  532
            RHLK MGDLGQIVPM+++ R+E  I   +  +++V NL+GR+YET+N+   +V+   A++
Sbjct  85   RHLKPMGDLGQIVPMEWDIRNEEQIAECLRHSDIVYNLVGRDYETKNFKSADVHVAGAER  144

Query  533  LASI  544
            +A +
Sbjct  145  VAKV  148



>ref|XP_003463318.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cavia porcellus]
Length=377

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNRLGQMGSQVILPYRCDTYDIMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ+  ++++ RD++SI+  +  +NVVINL+GR++ETRN+ FE+V
Sbjct  100  LGQLTFLEWDARDKDSIRRAVQYSNVVINLVGRDWETRNFDFEDV  144



>ref|XP_008703114.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ursus maritimus]
Length=434

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  97   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  156

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE++   + + +A +
Sbjct  157  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQV  212



>ref|XP_008703115.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ursus maritimus]
Length=410

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  73   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  132

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE++   + + +A +
Sbjct  133  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQV  188



>ref|XP_007870444.1| NAD P-binding protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ50996.1| NAD P-binding protein [Gloeophyllum trabeum ATCC 11539]
Length=368

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRS+VSG VATVFG TGFLGRYLV +LAK G+QV+ P+R  ++  RHLKLMGD
Sbjct  36   VISYGPPGRSAVSGHVATVFGCTGFLGRYLVAKLAKNGTQVITPYRDPDEA-RHLKLMGD  94

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ+V M+++ RDE+ I   +  +++V NL+GREYET+N+++ +VN   A ++A +
Sbjct  95   LGQVVHMEWDIRDEDQIAECLRHSDIVYNLVGREYETKNFTYNDVNAAGAGRIAKV  150



>ref|XP_007527887.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Erinaceus europaeus]
Length=377

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N R+++SI+  +  +NVVINLIG+++ETRN+ FE++   +   +A +
Sbjct  100  LGQIIFLEWNGRNKDSIRRTVEHSNVVINLIGKDWETRNFDFEDIYVKIPHAIAQV  155



>ref|XP_009178280.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Papio anubis]
Length=377

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQV  155



>ref|XP_009178281.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Papio anubis]
Length=375

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  38   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  97

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  98   LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQV  153



>ref|XP_003771339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sarcophilus harrisii]
Length=377

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N +D++SI+  +  +NVVINL+GR++ET+N+ F +V   + + +A +
Sbjct  100  LGQIIFLEWNAKDKSSIQRALEHSNVVINLVGRDWETKNFDFSDVFAVIPETIAQL  155



>ref|XP_006891427.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Elephantulus edwardii]
Length=377

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+  G GGRSS SGIVATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  40   IIPHGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ ++++ RD++SI+  +  +NVVINL+GRE+ET+N+ +E+V
Sbjct  100  LGQIIFLEWSGRDKDSIRRAVEHSNVVINLVGREWETKNFDYEDV  144



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +2

Query  206  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  385
            +GTGGRSS+SGI +TVFGATG+LGRY+V  L K GS++++P R  ++  +HLK+MGDLGQ
Sbjct  13   RGTGGRSSISGITSTVFGATGYLGRYVVNHLGKSGSRMILPTRCGDNAKQHLKVMGDLGQ  72

Query  386  IVPMK-YNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            IV +     RD+++IK  + ++NVV+NL+GRE+ETRN+SF++V+    ++LA I
Sbjct  73   IVDLAGLKIRDDSAIKYAVERSNVVVNLLGREWETRNFSFDDVHRDFPERLARI  126



>ref|XP_004381326.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Trichechus manatus latirostris]
Length=359

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGD
Sbjct  40   VMPHGKGGRSSVSGVVATVFGATGFLGRYIVNHLGRMGSQVIIPYRCDAYELMYLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQI+ +++N RD++SI+  +  +NVVINL+GRE+ETRN+ +++V   + + +A +
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETRNFDYDDVFVKIPQAIAQV  155



>emb|CCF54116.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
hordei]
Length=392

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  99

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQ+VPM+++ R++  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHATG  159

Query  524  AKQLASI  544
            A+++A I
Sbjct  160  AQRIAQI  166



>ref|XP_006123105.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pelodiscus sinensis]
Length=379

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQ+++P+R  +    HL+LMGD
Sbjct  42   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQIIIPYRCDQYDLMHLRLMGD  101

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEE  508
            LGQI+ M ++ RD++S +  +  +NVVINL+G+E+ET+N+SFE+
Sbjct  102  LGQILFMDWDSRDKDSTRRALEHSNVVINLVGQEWETKNFSFED  145



>gb|KIM65954.1| hypothetical protein SCLCIDRAFT_1211966 [Scleroderma citrinum 
Foug A]
Length=356

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  355
            T  G   ++  G  G S+VSG VATVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  R
Sbjct  24   TLPGRKPVISHGPPGYSAVSGHVATVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEKR  82

Query  356  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  535
            HLK MGDLGQIV M+++ R+E+ I   +  +++V NL+GR+YET+N+ F +V+   A+++
Sbjct  83   HLKPMGDLGQIVSMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKFADVHVAGAERI  142

Query  536  ASI  544
            A +
Sbjct  143  AKV  145



>gb|KFV11223.1| hypothetical protein N339_08758, partial [Pterocles gutturalis]
Length=251

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  24   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  83

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K +A I
Sbjct  84   LGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKSIAQI  139



>ref|XP_005378797.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chinchilla lanigera]
Length=377

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVILPYRCDTYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQI+ ++++ RD+ SI+  +  +NVVINL+GR++ET N+ FE+V   + + +A
Sbjct  100  LGQIIFLEWDVRDKESIRRAVQHSNVVINLVGRDWETTNFDFEDVFVKIPRAIA  153



>gb|KDR23820.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Zootermopsis nevadensis]
Length=401

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDL  379
            +++GTGGRSS +GIVATVFGATGF+GRY+  +L K+G+Q+++P+RG    +  LKL+GDL
Sbjct  45   LKRGTGGRSSFNGIVATVFGATGFVGRYVCNRLGKIGTQLILPYRGDHYDNLRLKLVGDL  104

Query  380  GQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            GQ++ + Y+ RDE SI   +  +NVVINL+GR++ETRN+SF +V+   A+ LA +
Sbjct  105  GQVLFVPYDLRDEESIYKAIQYSNVVINLVGRDWETRNFSFHDVHVQGARTLARL  159



>ref|XP_008071131.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarsius syrichta]
Length=461

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG V TVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  124  LIPHGKGGRSSVSGFVVTVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  183

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLA  538
            LGQ++ +++N +D++SI+ V+  +NVVINL+GR++ETRN+ FE+V   + + +A
Sbjct  184  LGQLIFLEWNGKDKDSIRRVVQHSNVVINLVGRDWETRNFDFEDVFVKIPRAIA  237



>gb|KFV03415.1| hypothetical protein N340_03010, partial [Tauraco erythrolophus]
Length=361

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  24   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  83

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ+V ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K++A I
Sbjct  84   LGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKRIAQI  139



>ref|XP_010076803.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Pterocles gutturalis]
Length=270

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  43   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  102

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K +A I
Sbjct  103  LGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKSIAQI  158



>ref|XP_009989270.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Tauraco erythrolophus]
Length=360

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  23   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  82

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ+V ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K++A I
Sbjct  83   LGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKRIAQI  138



>ref|XP_007353556.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD38366.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
Length=390

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  GTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLK  364
            G   +   G  GRS+V+G +ATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHL+
Sbjct  26   GPQRVAASGPPGRSAVTGQIATVFGCTGFLGRYLVAKLAKAGTQVVVPYR-DEDKKRHLR  84

Query  365  LMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            +MGDLGQ+VP++++ R+E  I+  +  +++V NL+GR+YET+N+ +  VN   A+++A +
Sbjct  85   VMGDLGQVVPLEFDARNEAQIEECVRHSHIVYNLVGRDYETKNFDYNAVNVAAAQRIAEV  144



>ref|XP_007965492.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chlorocebus sabaeus]
Length=377

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMYLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A +
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQV  155



>ref|XP_007008648.1| hypothetical protein TREMEDRAFT_72592 [Tremella mesenterica DSM 
1558]
 gb|EIW65481.1| hypothetical protein TREMEDRAFT_72592 [Tremella mesenterica DSM 
1558]
Length=411

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +2

Query  197  IVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  370
            I+++G  TGGRSSVSG V TVFG TGFLGRY V ++AK G+QV+VP+R  ED  RHL++M
Sbjct  44   IIKRGPPTGGRSSVSGNVVTVFGCTGFLGRYTVAKIAKQGAQVIVPYR-DEDEKRHLRVM  102

Query  371  GDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            GDLGQIVPM+++ R+ + I   +  ++ V NL GR++ET+N++FE++N   A  +A +
Sbjct  103  GDLGQIVPMEWDARNPDQIYECVKHSDTVYNLAGRDWETKNFTFEDINVKAAGLIARV  160



>gb|KIM89048.1| hypothetical protein PILCRDRAFT_812944 [Piloderma croceum F 1598]
Length=361

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  352
            +T   +  I+  G  G S+VSG + TVFG TGFLGRY+V +L KMG+QV++P+R  ED  
Sbjct  26   VTPVPSKPIISSGIPGYSAVSGHIVTVFGCTGFLGRYVVSKLGKMGTQVIIPYR-EEDDK  84

Query  353  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  532
            RHLKL GDLGQIVPM+++ R+E  I+  +  +++V NL+GR+YET+N+S+ +V+   A++
Sbjct  85   RHLKLTGDLGQIVPMEWDIRNEQQIEECLRHSDIVYNLVGRDYETKNFSYSDVHAKGAQR  144

Query  533  LASI  544
            +A I
Sbjct  145  IARI  148



>ref|XP_004643624.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Octodon degus]
Length=377

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VLPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVILPYRCDTYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQI+ ++++ RD+ SI+  +  +NVVINL+GR++ET N+ FE+V
Sbjct  100  LGQIIFLEWDARDKESIRRAVQHSNVVINLVGRDWETTNFDFEDV  144



>gb|KIK69637.1| hypothetical protein GYMLUDRAFT_992204 [Gymnopus luxurians FD-317 
M1]
Length=369

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = +2

Query  161  YASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  340
            Y    T      IV +G  G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  
Sbjct  22   YHDLTTLPSKKPIVAQGPPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-D  80

Query  341  EDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHY  520
            ED  RHLK MGDLGQIVPM+++ R+EN I   +  +++V NL+GR+Y T+++ F  V   
Sbjct  81   EDEKRHLKPMGDLGQIVPMEWDLRNENQIAECVRHSDIVFNLVGRDYATKSFDFASVQVD  140

Query  521  MAKQLASI  544
             A+++A I
Sbjct  141  GAERIAQI  148



>gb|EST09999.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
brasiliensis GHG001]
Length=392

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+VP+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIVPYR-DE  99

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHVTG  159

Query  524  AKQLASI  544
            A+++A I
Sbjct  160  AQRIAQI  166



>ref|XP_003331391.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP86972.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
Length=386

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  152  TPRYASTLTAK-GTGHIVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  325
            T R+   L  + GTG +++  G  GR S +G+VATVFGATGFLGRYLV +LAK G+QV+V
Sbjct  28   TKRWRHDLIKQSGTGKVIQSSGPSGRHSNTGLVATVFGATGFLGRYLVHKLAKQGTQVIV  87

Query  326  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  505
            P+R  ED  RHL++MGDLGQIVP++++  +E  I   +  ++VV NL+GRE+ET+NYSF+
Sbjct  88   PYR-DEDSKRHLRVMGDLGQIVPLEFDLENEGFINECVRHSHVVYNLLGREHETKNYSFD  146

Query  506  EV  511
             +
Sbjct  147  RL  148



>gb|KDN34620.1| hypothetical protein RSAG8_12282, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=363

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            I+  G  GRS+VSG VATVFG TGFLGRYLV +LAK G+QV++P+R  ED  RHLK++GD
Sbjct  33   IISYGPSGRSAVSGHVATVFGCTGFLGRYLVSKLAKAGTQVIIPYR-DEDEKRHLKILGD  91

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQIV ++++ R E+ I   M  +++V NL+GR+YET+N+ +E V+   A  +A+I
Sbjct  92   LGQIVALEWDLRREDQIAECMRHSDIVYNLVGRDYETKNFDYESVHVTGAATIANI  147



>gb|EMD40072.1| hypothetical protein CERSUDRAFT_112285 [Ceriporiopsis subvermispora 
B]
Length=368

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 98/150 (65%), Gaps = 10/150 (7%)
 Frame = +2

Query  122  LLSDQCYGIGTPRYASTLTAKGTGHIV---------RKGTGGRSSVSGIVATVFGATGFL  274
            +L+   + +  PR   +   +  G IV         R G  GRS+V+G VATVFG TGFL
Sbjct  1    MLATASHCVRLPRILRSQQKRAFGDIVIPPSGKPAIRYGPPGRSAVTGNVATVFGCTGFL  60

Query  275  GRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANV  454
            GRYLV +LAKMG+QV++P+R  ED  RHLK+ GDLGQIV M+++ R E+ I+  +  +++
Sbjct  61   GRYLVSKLAKMGTQVIIPYR-EEDAKRHLKVTGDLGQIVSMEWDLRSEDQIEECVRHSDI  119

Query  455  VINLIGREYETRNYSFEEVNHYMAKQLASI  544
            V NL+GR+YET+N+  + V+   A ++A +
Sbjct  120  VYNLVGRDYETKNFDHDAVHAEGAARIAEV  149



>emb|CDI51333.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Melanopsichium 
pennsylvanicum 4]
Length=388

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+VP+R  E
Sbjct  37   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIVPYR-DE  95

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  96   DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHVTG  155

Query  524  AKQLASI  544
            A+++A I
Sbjct  156  AQRIAQI  162



>dbj|GAC95510.1| hypothetical protein PHSY_003086 [Pseudozyma hubeiensis SY62]
Length=392

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  170  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  343
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  99

Query  344  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  523
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECLRHSDVVYNLTGRHYETKNFTFNDVHVAG  159

Query  524  AKQLASI  544
            A+++A I
Sbjct  160  AQRIAQI  166



>ref|XP_007435737.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Python bivittatus]
Length=363

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = +2

Query  140  YGIGTPRYASTLTAKGTGH--IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGS  313
            YGI +P     L    + H  ++  G  GRSSVSGI ATVFGATGFLGRY+V  L ++GS
Sbjct  5    YGI-SPWVLPVLQQDRSIHYSVLPHGRSGRSSVSGIAATVFGATGFLGRYVVNHLGRVGS  63

Query  314  QVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRN  493
            QV++P+R  E    +L+ MGDLGQI+ M+++ R+++SI+  +  +NVVINLIGRE+ETRN
Sbjct  64   QVVIPYRCDEYDLLYLRPMGDLGQIIFMEWDSRNKDSIQRALEHSNVVINLIGREWETRN  123

Query  494  YSFEEVNHYMAKQLASI  544
            +++E+V   + + +A +
Sbjct  124  FTYEDVFVTIPRDIAQL  140



>ref|XP_003273859.2| PREDICTED: probable polypeptide N-acetylgalactosaminyltransferase 
8 [Nomascus leucogenys]
Length=722

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIV TVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVTTVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  511
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V
Sbjct  100  LGQLLFLEWDARDKDSIRRVVEHSNVVINLIGRDWETKNFDFEDV  144



>ref|XP_005569923.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Macaca fascicularis]
Length=304

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  197  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  376
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  377  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASI  544
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ F++V   + + +A +
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQV  155



>ref|XP_002108719.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV29517.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=358

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  167  STLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  346
            S++  +    +V+ G GGRSS SGI+ATVFG TGF GRY++ +L ++G+Q++VP+R  E 
Sbjct  26   SSINDRKLHQLVKSGRGGRSSYSGILATVFGGTGFTGRYVINRLGRVGTQIMVPYRCDEH  85

Query  347  CHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMA  526
              RH++LMGDLGQI+   ++ RD +++  ++  +NVVINLIG+++ETRNY++E+ N   A
Sbjct  86   DIRHIRLMGDLGQIMFRPFSLRDTDAVSELVKHSNVVINLIGQDWETRNYTYEDANVEGA  145

Query  527  KQLA  538
            + +A
Sbjct  146  RAIA  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335