BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016C05

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091007.1|  PREDICTED: pectinesterase-like                   97.4    4e-20   Sesamum indicum [beniseed]
ref|XP_009761202.1|  PREDICTED: pectinesterase                        96.7    7e-20   Nicotiana sylvestris
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                   95.9    1e-19   Nicotiana tomentosiformis
emb|CDO98834.1|  unnamed protein product                              95.9    2e-19   Coffea canephora [robusta coffee]
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...  95.9    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...  94.0    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                   93.2    1e-18   Nicotiana sylvestris
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                   92.8    2e-18   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...  92.4    2e-18   Cucumis sativus [cucumbers]
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...  92.0    3e-18   Solanum tuberosum [potatoes]
ref|XP_004252915.1|  PREDICTED: pectinesterase                        92.0    3e-18   Solanum lycopersicum
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...  92.0    3e-18   Cucumis melo [Oriental melon]
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                   91.3    6e-18   Nicotiana tomentosiformis
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...  90.5    6e-18   Solanum tuberosum [potatoes]
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...  90.9    1e-17   Morus notabilis
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                   90.5    1e-17   Nicotiana tomentosiformis
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                   90.5    1e-17   Sesamum indicum [beniseed]
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                   90.1    1e-17   Sesamum indicum [beniseed]
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...  89.0    5e-17   Morus notabilis
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                   88.6    5e-17   Nicotiana sylvestris
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...  87.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010667122.1|  PREDICTED: pectinesterase                        87.0    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...  87.0    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                   86.7    2e-16   Sesamum indicum [beniseed]
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg              86.7    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...  86.7    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...  86.7    3e-16   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...  86.3    4e-16   Eucalyptus grandis [rose gum]
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg           86.3    4e-16   Prunus persica
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                   85.9    4e-16   Sesamum indicum [beniseed]
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                   85.9    4e-16   Sesamum indicum [beniseed]
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg              85.9    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                   85.9    5e-16   Sesamum indicum [beniseed]
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...  85.5    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...  85.5    7e-16   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...  84.7    1e-15   Prunus mume [ume]
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg           84.7    1e-15   Prunus persica
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...  84.7    1e-15   Vitis vinifera
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg           84.7    1e-15   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...  84.7    1e-15   Prunus mume [ume]
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg              84.7    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...  84.0    2e-15   Cicer arietinum [garbanzo]
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...  84.3    2e-15   Elaeis guineensis
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg              84.0    2e-15   Erythranthe guttata [common monkey flower]
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg              84.0    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...  84.0    2e-15   Glycine max [soybeans]
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...  84.0    2e-15   Prunus mume [ume]
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                   83.6    3e-15   Sesamum indicum [beniseed]
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...  83.6    3e-15   Prunus mume [ume]
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...  83.2    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...  83.6    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                   83.2    3e-15   Solanum lycopersicum
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21   83.2    3e-15   Glycine soja [wild soybean]
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...  83.2    4e-15   Glycine max [soybeans]
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...  83.2    4e-15   Phoenix dactylifera
emb|CBI22967.3|  unnamed protein product                              84.0    4e-15   Vitis vinifera
emb|CDO98832.1|  unnamed protein product                              83.2    4e-15   Coffea canephora [robusta coffee]
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g           82.8    5e-15   Phaseolus vulgaris [French bean]
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g           82.8    5e-15   Phaseolus vulgaris [French bean]
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg              82.8    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...  82.8    6e-15   Tarenaya hassleriana [spider flower]
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...  82.8    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...  82.8    6e-15   Tarenaya hassleriana [spider flower]
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg           82.4    7e-15   Prunus persica
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...  82.4    8e-15   Phoenix dactylifera
gb|EPS70728.1|  pectinesterase                                        82.0    9e-15   Genlisea aurea
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...  82.8    1e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB38560.1|  hypothetical protein B456_006G260600                  82.0    1e-14   Gossypium raimondii
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g           81.6    1e-14   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                   81.3    2e-14   Sesamum indicum [beniseed]
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                   81.3    2e-14   Elaeis guineensis
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...  81.3    2e-14   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...  81.3    2e-14   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...  81.3    2e-14   Vitis vinifera
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...  81.3    2e-14   Nelumbo nucifera [Indian lotus]
emb|CBI39537.3|  unnamed protein product                              81.6    2e-14   Vitis vinifera
ref|XP_006382447.1|  pectin methylesterase family protein             80.9    2e-14   Populus trichocarpa [western balsam poplar]
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg              80.5    3e-14   Erythranthe guttata [common monkey flower]
emb|CDP21547.1|  unnamed protein product                              80.9    3e-14   Coffea canephora [robusta coffee]
gb|AGT17860.1|  pollen-specific pectin methylesterase                 80.5    3e-14   Pisum sativum [garden pea]
gb|KDP27833.1|  hypothetical protein JCGZ_18913                       80.5    3e-14   Jatropha curcas
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...  80.5    3e-14   Populus euphratica
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...  80.5    4e-14   
ref|XP_003626199.1|  Pectinesterase                                   80.1    4e-14   
ref|XP_002872255.1|  pectinesterase family protein                    80.1    4e-14   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...  80.1    5e-14   Fragaria vesca subsp. vesca
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...  79.7    5e-14   Cicer arietinum [garbanzo]
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                   79.7    6e-14   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700        79.7    7e-14   Amborella trichopoda
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...  79.3    8e-14   Prunus mume [ume]
ref|XP_007031044.1|  Pectinesterase, putative                         79.3    9e-14   
gb|EPS59322.1|  pectinesterase                                        79.0    9e-14   Genlisea aurea
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...  78.6    1e-13   Cicer arietinum [garbanzo]
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...  78.6    1e-13   Gossypium arboreum [tree cotton]
gb|KJB38561.1|  hypothetical protein B456_006G260700                  78.6    2e-13   Gossypium raimondii
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg           79.0    2e-13   Capsella rubella
gb|KDP27834.1|  hypothetical protein JCGZ_18914                       78.6    2e-13   Jatropha curcas
ref|XP_002512459.1|  Pectinesterase precursor, putative               78.2    2e-13   Ricinus communis
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...  78.2    2e-13   Brassica rapa
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...  78.2    2e-13   Cicer arietinum [garbanzo]
emb|CDY05295.1|  BnaC05g45080D                                        78.2    2e-13   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                   78.2    2e-13   Sesamum indicum [beniseed]
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...  77.8    2e-13   Gossypium arboreum [tree cotton]
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg           78.2    2e-13   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...  77.8    2e-13   Gossypium arboreum [tree cotton]
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...  77.8    3e-13   Prunus mume [ume]
gb|KJB38563.1|  hypothetical protein B456_006G260900                  77.8    3e-13   Gossypium raimondii
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...  77.8    3e-13   Cucumis sativus [cucumbers]
emb|CDY24663.1|  BnaA05g30620D                                        77.8    3e-13   Brassica napus [oilseed rape]
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...  77.8    3e-13   Eucalyptus grandis [rose gum]
gb|KJB38562.1|  hypothetical protein B456_006G260800                  77.4    3e-13   Gossypium raimondii
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...  77.4    3e-13   Cucumis melo [Oriental melon]
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg           77.4    4e-13   Prunus persica
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                   77.0    4e-13   Solanum tuberosum [potatoes]
ref|XP_003604119.1|  Pectinesterase                                   77.4    5e-13   
ref|XP_003591164.1|  Pectinesterase                                   77.0    5e-13   Medicago truncatula
ref|XP_003591166.1|  Pectinesterase                                   77.0    5e-13   Medicago truncatula
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...  77.4    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...  77.0    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...  76.6    5e-13   Malus domestica [apple tree]
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...  76.6    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg           77.0    6e-13   Eutrema salsugineum [saltwater cress]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...  76.6    7e-13   Populus euphratica
ref|XP_002314364.1|  putative pectinesterase family protein           76.6    7e-13   Populus trichocarpa [western balsam poplar]
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...  76.3    8e-13   Fragaria vesca subsp. vesca
gb|KJB45338.1|  hypothetical protein B456_007G302000                  76.3    9e-13   Gossypium raimondii
gb|KDP23449.1|  hypothetical protein JCGZ_23282                       76.3    1e-12   Jatropha curcas
dbj|BAO02509.1|  predicted pectin esterase ortholog                   75.9    1e-12   Nicotiana alata [flowering tobacco]
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...  75.9    1e-12   Brassica rapa
gb|EPS72184.1|  pectinesterase family protein                         75.9    1e-12   Genlisea aurea
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780        75.5    1e-12   Sorghum bicolor [broomcorn]
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                   75.5    1e-12   Nicotiana tomentosiformis
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21   75.5    1e-12   Glycine soja [wild soybean]
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...  75.5    1e-12   Glycine max [soybeans]
emb|CDY05188.1|  BnaC05g46150D                                        75.5    2e-12   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                   74.7    2e-12   Solanum lycopersicum
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                   74.7    2e-12   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g           74.7    3e-12   Phaseolus vulgaris [French bean]
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg           74.7    3e-12   Capsella rubella
emb|CDX74078.1|  BnaA03g29690D                                        74.3    4e-12   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                   73.9    5e-12   Sesamum indicum [beniseed]
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg           73.9    5e-12   Prunus persica
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg           73.9    6e-12   Eutrema salsugineum [saltwater cress]
emb|CDX99968.1|  BnaC09g03330D                                        73.9    6e-12   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...  73.9    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_003591168.1|  Pectinesterase                                   73.6    7e-12   Medicago truncatula
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                   73.6    7e-12   Solanum tuberosum [potatoes]
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...  73.6    7e-12   Setaria italica
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21   73.6    8e-12   Glycine soja [wild soybean]
tpg|DAA64233.1|  TPA: pectinesterase                                  73.6    8e-12   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...  73.6    8e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42986.1|  putative pectinesterase                              73.6    8e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08032.1|  BnaC03g34910D                                        72.4    8e-12   Brassica napus [oilseed rape]
ref|NP_001151322.1|  pectinesterase-1 precursor                       73.2    8e-12   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...  73.2    9e-12   Brassica rapa
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...  73.2    9e-12   Citrus sinensis [apfelsine]
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                 73.2    9e-12   Citrus sinensis [apfelsine]
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...  73.2    1e-11   
ref|XP_002884519.1|  pectinesterase family protein                    73.2    1e-11   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg           73.2    1e-11   
ref|XP_003604120.1|  Pectinesterase                                   73.2    1e-11   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor               72.8    1e-11   Medicago truncatula
ref|XP_010489679.1|  PREDICTED: probable pectinesterase/pectinest...  71.6    1e-11   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   Camelina sativa [gold-of-pleasure]
emb|CDY27751.1|  BnaA05g31600D                                        72.8    1e-11   Brassica napus [oilseed rape]
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   Brassica rapa
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g           72.8    1e-11   Phaseolus vulgaris [French bean]
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg           72.8    1e-11   
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...  72.8    1e-11   Cicer arietinum [garbanzo]
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg           72.8    2e-11   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...  72.4    2e-11   Populus euphratica
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...  72.4    2e-11   Glycine max [soybeans]
emb|CDX74137.1|  BnaA03g29100D                                        72.4    2e-11   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg           72.4    2e-11   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21   72.0    2e-11   Glycine soja [wild soybean]
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                  72.4    2e-11   Arabis alpina [alpine rockcress]
emb|CDY40720.1|  BnaC03g34360D                                        68.9    2e-11   Brassica napus [oilseed rape]
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...  72.4    2e-11   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg           72.0    2e-11   Capsella rubella
gb|AEL79481.1|  pectin methylesterase-like protein                    72.0    2e-11   Capsicum annuum
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...  72.0    3e-11   Brassica rapa
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg           71.6    3e-11   Eutrema salsugineum [saltwater cress]
gb|EYU40534.1|  hypothetical protein MIMGU_mgv11b016088mg             68.2    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...  72.0    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...  72.0    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                   71.2    3e-11   Nicotiana sylvestris
ref|XP_002865716.1|  pectinesterase family protein                    71.6    3e-11   Arabidopsis lyrata subsp. lyrata
emb|CDO98833.1|  unnamed protein product                              71.2    4e-11   Coffea canephora [robusta coffee]
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                  71.2    4e-11   Arabis alpina [alpine rockcress]
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...  71.2    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1        71.2    4e-11   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...  71.2    4e-11   Brassica rapa
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg           71.2    4e-11   Capsella rubella
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900        70.9    5e-11   Sorghum bicolor [broomcorn]
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...  70.9    5e-11   Setaria italica
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...  70.9    5e-11   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...  70.9    6e-11   Glycine max [soybeans]
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...  70.9    6e-11   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg           70.5    7e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...  70.5    7e-11   Glycine max [soybeans]
emb|CDX80613.1|  BnaC07g28310D                                        70.5    9e-11   
ref|XP_002882495.1|  pectinesterase family protein                    70.1    9e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...  70.1    9e-11   Glycine max [soybeans]
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28   70.1    1e-10   Glycine soja [wild soybean]
ref|XP_003557034.1|  PREDICTED: putative pectinesterase/pectinest...  69.3    1e-10   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21   69.7    1e-10   Glycine soja [wild soybean]
gb|EMS65303.1|  putative pectinesterase/pectinesterase inhibitor 21   68.9    1e-10   Triticum urartu
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                   70.1    1e-10   Nicotiana sylvestris
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...  69.7    1e-10   Glycine max [soybeans]
gb|KHN04169.1|  Putative pectinesterase/pectinesterase inhibitor 21   69.7    1e-10   Glycine soja [wild soybean]
emb|CDY68790.1|  BnaAnng28400D                                        69.7    1e-10   Brassica napus [oilseed rape]
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...  69.7    1e-10   Glycine max [soybeans]
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...  69.7    1e-10   Brassica rapa
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...  69.3    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049858.1|  Os03g0300500                                     68.9    2e-10   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551            68.9    2e-10   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...  68.9    2e-10   Brassica rapa
emb|CDY33925.1|  BnaA02g30620D                                        68.6    3e-10   Brassica napus [oilseed rape]
dbj|BAC42959.2|  putative pectin methylesterase                       68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...  68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAF63815.1|  pectin methylesterase, putative                       68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008370617.1|  PREDICTED: pectinesterase                        68.6    4e-10   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...  68.6    4e-10   Cicer arietinum [garbanzo]
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...  68.2    4e-10   Tarenaya hassleriana [spider flower]
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg              68.6    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                   67.8    6e-10   Vitis vinifera
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28   67.8    6e-10   
emb|CDY34927.1|  BnaA01g32580D                                        67.8    6e-10   Brassica napus [oilseed rape]
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...  67.4    6e-10   Brassica rapa
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...  67.8    6e-10   Glycine max [soybeans]
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                  67.0    1e-09   Arabis alpina [alpine rockcress]
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g           66.6    1e-09   Phaseolus vulgaris [French bean]
ref|XP_011462740.1|  PREDICTED: pectinesterase-like                   66.2    2e-09   Fragaria vesca subsp. vesca
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...  66.2    2e-09   Oryza brachyantha
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg              66.2    2e-09   Erythranthe guttata [common monkey flower]
emb|CAN67129.1|  hypothetical protein VITISV_040170                   66.6    2e-09   Vitis vinifera
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...  66.2    2e-09   Oryza brachyantha
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21   65.9    2e-09   
gb|EMS57827.1|  putative pectinesterase/pectinesterase inhibitor 21   65.9    2e-09   Triticum urartu
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...  65.9    2e-09   Oryza brachyantha
ref|XP_002516960.1|  Pectinesterase precursor, putative               65.9    2e-09   Ricinus communis
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                   65.9    2e-09   Brachypodium distachyon [annual false brome]
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28   65.9    2e-09   Triticum urartu
dbj|BAK06954.1|  predicted protein                                    65.9    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063            65.9    3e-09   
gb|KEH37214.1|  pectinesterase/pectinesterase inhibitor               65.1    3e-09   Medicago truncatula
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...  65.1    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...  65.1    4e-09   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor               65.1    4e-09   Glycine soja [wild soybean]
ref|NP_001060715.1|  Os07g0691100                                     64.7    5e-09   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...  63.5    1e-08   Glycine max [soybeans]
ref|XP_006651293.1|  PREDICTED: probable pectinesterase/pectinest...  62.8    1e-08   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor               63.5    1e-08   Glycine soja [wild soybean]
gb|EAZ05229.1|  hypothetical protein OsI_27427                        63.5    1e-08   Oryza sativa Indica Group [Indian rice]
gb|EAZ41174.1|  hypothetical protein OsJ_25671                        63.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...  63.2    2e-08   Sesamum indicum [beniseed]
ref|XP_009594458.1|  PREDICTED: pectinesterase                        63.2    2e-08   Nicotiana tomentosiformis
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...  62.8    2e-08   Setaria italica
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...  62.4    3e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...  62.4    3e-08   Tarenaya hassleriana [spider flower]
gb|AGV54687.1|  pectinesterase                                        62.4    4e-08   Phaseolus vulgaris [French bean]
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...  62.4    4e-08   Solanum tuberosum [potatoes]
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...  62.0    4e-08   Camelina sativa [gold-of-pleasure]
gb|EPS58111.1|  pectinesterase                                        61.6    4e-08   Genlisea aurea
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850        62.0    4e-08   Sorghum bicolor [broomcorn]
gb|EPS65387.1|  pectinesterase                                        62.0    5e-08   Genlisea aurea
ref|XP_008380988.1|  PREDICTED: probable pectinesterase/pectinest...  62.0    5e-08   Malus domestica [apple tree]
gb|EMT12798.1|  Putative pectinesterase/pectinesterase inhibitor 21   61.6    6e-08   
gb|EPS61142.1|  pectinesterase                                        61.2    6e-08   Genlisea aurea
dbj|BAF42038.1|  pectin methylesterase 1                              61.2    8e-08   Pyrus communis
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                   61.2    8e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010315470.1|  PREDICTED: pectinesterase                        61.2    8e-08   
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g           61.2    9e-08   Phaseolus vulgaris [French bean]
ref|XP_002865971.1|  pectinesterase family protein                    60.8    9e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                   60.8    9e-08   Vitis vinifera
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...  61.2    9e-08   Pyrus x bretschneideri [bai li]
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g           60.8    9e-08   Phaseolus vulgaris [French bean]
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                   60.5    1e-07   Elaeis guineensis
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...  60.8    1e-07   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...  60.5    1e-07   
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...  60.5    1e-07   
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...  60.5    1e-07   
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...  60.5    1e-07   
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...  60.5    1e-07   
ref|NP_200149.1|  pectin methylesterase PCR fragment F                60.5    2e-07   
gb|ACF79975.1|  unknown                                               60.1    2e-07   
gb|ACF74360.1|  pectinesterase                                        57.4    2e-07   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor               60.1    2e-07   
gb|EAY94388.1|  hypothetical protein OsI_16156                        59.7    2e-07   
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...  59.7    2e-07   
ref|NP_001052981.1|  Os04g0458900                                     59.7    2e-07   
emb|CAH67075.1|  OSIGBa0097P08.5                                      59.7    2e-07   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...  59.7    2e-07   
gb|EAY94391.1|  hypothetical protein OsI_16158                        59.7    2e-07   
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...  59.7    3e-07   
gb|AEK07905.1|  pectin methylesterase                                 59.3    3e-07   
gb|KJB45965.1|  hypothetical protein B456_007G340800                  59.7    3e-07   
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...  59.3    4e-07   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                   58.9    4e-07   
gb|KDP27467.1|  hypothetical protein JCGZ_20123                       58.9    4e-07   
ref|XP_003588521.1|  Pectinesterase                                   58.9    4e-07   
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...  58.5    6e-07   
ref|XP_007039038.1|  Plant invertase/pectin methylesterase inhibi...  58.5    6e-07   
ref|XP_010100757.1|  putative pectinesterase/pectinesterase inhib...  58.5    6e-07   
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg           58.5    6e-07   
gb|KDO54263.1|  hypothetical protein CISIN_1g017225mg                 58.2    7e-07   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...  58.2    8e-07   
gb|EPS69059.1|  hypothetical protein M569_05708                       58.2    9e-07   
gb|KDP43632.1|  hypothetical protein JCGZ_16919                       57.4    1e-06   
gb|KHG08526.1|  putative pectinesterase/pectinesterase inhibitor ...  57.4    1e-06   
gb|KJB39472.1|  hypothetical protein B456_007G015300                  57.4    1e-06   
ref|XP_008465502.1|  PREDICTED: probable pectinesterase/pectinest...  57.0    2e-06   
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg           57.0    2e-06   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                   57.0    2e-06   
ref|XP_004146219.1|  PREDICTED: probable pectinesterase/pectinest...  57.0    2e-06   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g           56.6    2e-06   
ref|XP_004298254.1|  PREDICTED: pectinesterase-like                   56.6    2e-06   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor               56.2    3e-06   
gb|KJB52586.1|  hypothetical protein B456_008G268900                  56.2    3e-06   
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg           55.8    4e-06   
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...  55.8    4e-06   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                   55.8    4e-06   
ref|XP_010489680.1|  PREDICTED: probable pectinesterase/pectinest...  55.1    6e-06   
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative             55.5    6e-06   
dbj|BAE98780.1|  pectinesterase like protein                          55.1    7e-06   
dbj|BAF00948.1|  pectinesterase like protein                          54.7    7e-06   
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...  55.1    8e-06   
gb|KJB26381.1|  hypothetical protein B456_004G238800                  55.1    8e-06   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...  55.1    9e-06   
ref|XP_002321999.2|  pectin methylesterase family protein             54.7    9e-06   
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...  54.7    9e-06   
ref|XP_006374102.1|  hypothetical protein POPTR_0015s01610g           54.7    1e-05   
ref|XP_002875955.1|  pectinesterase family protein                    54.7    1e-05   
emb|CDX83075.1|  BnaA01g20750D                                        54.3    1e-05   
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...  54.3    1e-05   
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg           54.3    1e-05   
emb|CBI26012.3|  unnamed protein product                              54.3    1e-05   
ref|XP_002275000.1|  PREDICTED: pectinesterase                        54.3    1e-05   
ref|XP_002516698.1|  Pectinesterase PPE8B precursor, putative         54.3    2e-05   
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...  54.3    2e-05   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                   53.9    2e-05   
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...  53.9    2e-05   
gb|KFK34211.1|  hypothetical protein AALP_AA5G115200                  53.5    2e-05   
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...  53.5    3e-05   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g           53.5    3e-05   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g           53.1    3e-05   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                   53.1    3e-05   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250        53.1    3e-05   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative             52.8    4e-05   
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...  52.4    6e-05   
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...  52.0    7e-05   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                   52.0    8e-05   
ref|XP_010550514.1|  PREDICTED: probable pectinesterase/pectinest...  52.0    9e-05   
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                  51.6    1e-04   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...  51.6    1e-04   
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...  51.2    1e-04   
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310        51.2    1e-04   
gb|KJB74684.1|  hypothetical protein B456_012G002600                  51.2    1e-04   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...  51.2    1e-04   
ref|XP_010519424.1|  PREDICTED: probable pectinesterase/pectinest...  51.2    2e-04   
ref|XP_009407599.1|  PREDICTED: putative pectinesterase/pectinest...  50.8    2e-04   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...  50.8    2e-04   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                   50.8    2e-04   
gb|KDO37799.1|  hypothetical protein CISIN_1g046024mg                 50.8    2e-04   
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg           50.8    2e-04   
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                 50.8    2e-04   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg              50.8    2e-04   
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...  50.8    2e-04   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...  50.4    2e-04   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                   50.4    2e-04   
emb|CDY69946.1|  BnaUnng03540D                                        50.4    3e-04   
gb|ABJ99594.1|  pectinesterase inhibitor                              50.4    3e-04   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020        50.4    3e-04   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                       50.4    3e-04   
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                      50.4    3e-04   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...  50.1    3e-04   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                   50.1    3e-04   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...  50.1    4e-04   
gb|AEX12602.1|  hypothetical protein 2_5258_01                        48.1    4e-04   
ref|XP_008375511.1|  PREDICTED: putative pectinesterase/pectinest...  49.7    4e-04   
ref|XP_003602238.1|  Pectinesterase                                   49.7    4e-04   
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...  49.7    5e-04   
emb|CDP17031.1|  unnamed protein product                              49.7    5e-04   
ref|XP_010679479.1|  PREDICTED: probable pectinesterase/pectinest...  49.7    6e-04   
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...  49.3    6e-04   
ref|XP_007149847.1|  hypothetical protein PHAVU_005G103500g           49.3    6e-04   
ref|XP_009589773.1|  PREDICTED: pectinesterase-like                   49.3    7e-04   
ref|XP_004303759.1|  PREDICTED: pectinesterase 3                      49.3    7e-04   
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                   49.3    7e-04   
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...  48.9    8e-04   
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...  48.9    0.001   



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            + NI  S KA+  +C+ T++++ C+  LS AT S+DTK+L+  +F   M+E+  V+K+S 
Sbjct  35   SNNINPSQKAIVDLCQNTYYQQTCINSLSKATISSDTKDLIRTSFRTAMEELGNVIKQSA  94

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            TLQ A+K+P T+EA++ CQ+LL DSI D+++ L+R
Sbjct  95   TLQEASKNPETAEAYRTCQKLLNDSILDLQKTLER  129



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   MK +  +Q
Sbjct  48   ISTSTKSVQAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQ  107

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AAKDPRT +A + C+ LL  SIDD++R+ D++
Sbjct  108  EAAKDPRTKDALQTCESLLNVSIDDLRRSFDKV  140



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   MK +  +Q
Sbjct  48   ISTSTKSVKAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQ  107

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AAKDPRT +A + C+ LL  SIDD++R+ D++
Sbjct  108  EAAKDPRTKDALQTCESLLNVSIDDLRRSFDKV  140



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            + SS+KA++ +C+ T ++E C   LS A N++D +ELV+VAF  T+  + +V+K S  LQ
Sbjct  51   VTSSSKAIQSLCQHTDYKETCEDSLSKAKNTSDPRELVKVAFQTTVDNLGEVIKNSSLLQ  110

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AAKDPRTS+A  IC+E+L  +IDD KR+ D++
Sbjct  111  NAAKDPRTSDALDICKEVLNTAIDDFKRSFDKV  143



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +1

Query  274  KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            K + +S KA+E +C+P  ++E CVK L +A  N TD KEL++  FNV MK+IS+  +KS 
Sbjct  44   KEVSASMKAIEAMCQPADYKESCVKSLETAGPNVTDPKELIKAGFNVAMKKISEAAEKSV  103

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            TL+  AKDPRTS+A + C+EL++ +IDD++ + D++
Sbjct  104  TLKELAKDPRTSQALQNCKELMEYAIDDLQSSFDKL  139



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            +I SS KA++ +C+PT ++E CV+ LS AA N+TD KELV V F V MK I + + +S+T
Sbjct  58   DIQSSMKAIKAICQPTDYKETCVQSLSSAAGNTTDPKELVRVGFQVAMKHIREALSQSET  117

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L+   KDPR  +A   CQEL+  +IDD+K + D++
Sbjct  118  LKEVEKDPRAKQALLSCQELMDYAIDDLKNSFDKL  152



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            N  + +STK V+ +C+PT ++E C K LS+A N++D KEL++ AF+ T+ EI+  +K S 
Sbjct  40   NSQVSTSTKNVQAMCQPTQYKETCEKSLSSAKNTSDPKELIKTAFDSTINEIASSIKNSA  99

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              + AA DPRT +A K+C E+L  SI++IKR+ ++ 
Sbjct  100  PFKEAANDPRTKDALKVCDEVLDRSIEEIKRSFNKF  135



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            N  I +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   +K + 
Sbjct  40   NGGISTSTKSVQAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTD  99

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             ++ AA DPRT EA   C  LL  SIDD++R+ D++
Sbjct  100  LIKDAANDPRTKEALNTCDGLLDVSIDDLRRSFDKV  135



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SSTKA++ +C+PT ++E C K L A A N+TD KELV+V F +  + +++ +K S TL
Sbjct  60   ITSSTKAIQAICQPTDYKETCEKSLEAEAGNTTDPKELVKVGFKIATRSLNEAIKNSTTL  119

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  AKDPRT++A + C+ELL+ +IDD+ ++ +R+
Sbjct  120  KELAKDPRTNQALQNCRELLEYAIDDLNQSFERI  153



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            + +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   +K +  ++
Sbjct  47   VSTSTKSVKAICQPTDYKETCEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTDLIK  106

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AAKDPRT EA   C+ LL  SIDD++R+ D++
Sbjct  107  DAAKDPRTKEALHTCEGLLDVSIDDLRRSFDKV  139



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I SSTK+V+ +C+PT ++E C K L +A N+T+ KEL++ AF+ T+ EI+  +K S   +
Sbjct  44   ISSSTKSVQAMCQPTQYKETCAKSLGSAKNTTNPKELIKAAFDNTLTEITNSIKNSAPFK  103

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AA DPRT  A K+C E+L  SI++IKR+  ++
Sbjct  104  EAANDPRTKNALKVCDEVLDRSIEEIKRSFSKI  136



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SSTKA++ +C+PT ++E C K L A A N+TD KELV+V F +  + +++ ++ S TL
Sbjct  59   ISSSTKAIQAICQPTDYKETCEKSLMAEAGNTTDPKELVKVGFKIATRSLNEAIRNSTTL  118

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            Q  +KDPRT++A + C+ELL+ +IDD+  + +R+
Sbjct  119  QELSKDPRTNQALQNCRELLEYAIDDLNESFERI  152



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            N  + +STK V+ +C+PT ++E C K LS+A N++D KEL++ AF+ ++ EI+  +K S 
Sbjct  40   NSQVSTSTKNVQAMCQPTQYKETCEKSLSSAKNTSDPKELIKTAFDSSVNEIASSIKNSA  99

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              + AA DPRT +A K+C E+L  SI++IKR+ ++ 
Sbjct  100  PFKEAANDPRTKDALKVCDEVLDRSIEEIKRSFNKF  135



>ref|XP_006349952.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Solanum tuberosum]
Length=430

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I SS+K+V+ +C+PT ++E C K L +A N++D KEL++ AF+ TM EIS  +K S   +
Sbjct  44   ISSSSKSVQAMCQPTQYKEACEKSLGSAKNTSDPKELIKTAFDNTMTEISNSIKNSAPFK  103

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AA DPRT  A K+C E+L  SI++ KR+  ++
Sbjct  104  EAANDPRTKNALKVCDEVLDRSIEEFKRSFSQI  136



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ ++TKA++ +C+PT +RE C   L SAA N++D KEL++ AFNV +  IS  ++ S T
Sbjct  56   SVSTTTKAIQAICQPTDYRETCENSLTSAAGNTSDPKELIKAAFNVAIDHISAAIRNSST  115

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L+  AKD RT++A   C ELL+ +IDD+K + DR+
Sbjct  116  LKELAKDSRTNQALSNCDELLKYAIDDLKESFDRI  150



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            + ++ +STK+V+ +C+PT ++E C K L+ A N  D KEL++VAFN T+ ++S V+K S 
Sbjct  40   DSHLSTSTKSVQAICQPTDYKETCEKSLANAKNINDPKELIKVAFNATINDLSNVIKNSA  99

Query  451  TL-QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +L   A KDPRT +A + CQ LL  +IDD+ R+ D+ 
Sbjct  100  SLIDEAKKDPRTKDALQTCQGLLDVAIDDLTRSFDKF  136



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
             STKAV+ +C PT ++E C   LS A N+TD KELV+ AF  T K I +V+K S   Q A
Sbjct  38   GSTKAVQSICAPTDYKETCESSLSHA-NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEA  96

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALD  552
            AKD  T +A +ICQE+L  +IDD+KR+ D
Sbjct  97   AKDNGTKQALEICQEVLDTAIDDLKRSFD  125



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
             STKAV+ +C PT ++E C   LS A N+TD KELV+ AF  T K I +V+K S   Q A
Sbjct  38   GSTKAVQSICAPTDYKETCESSLSDA-NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEA  96

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALD  552
            AKD  T +A +ICQE+L  +IDD+KR+ D
Sbjct  97   AKDNGTKQALEICQEVLDTAIDDLKRSFD  125



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G+  + +S KA++ +C+PT ++E C+  LS+ + N+TD K+L++  F V MK +S+  KK
Sbjct  50   GSHEVSASMKAIKSICQPTDYKEECINSLSSESGNTTDPKKLIQAGFKVAMKYLSEAAKK  109

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S  LQ   KDPR S+A   C++L+++SIDD+K ++D++
Sbjct  110  SVVLQDLEKDPRASKALGHCKQLMENSIDDLKHSVDKL  147



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL-  456
            + +STK+V+ +C+PT ++E C K L+ A N  D KEL++VAFN T+ ++S V+K S +L 
Sbjct  43   LSTSTKSVQAICQPTDYKETCEKSLANAKNINDPKELIKVAFNATINDLSDVIKNSASLI  102

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              A KDPRT +A + CQ L+  +IDD+ R+ D+ 
Sbjct  103  DEAKKDPRTKDALQTCQGLVDVAIDDLTRSFDKF  136



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K V+  C+PT ++E C   LS+ A    D KEL+ +AFN+T+K I+  +  S  L
Sbjct  39   LSTSVKNVQDFCRPTDYKETCENTLSSVAGPDADPKELLNLAFNITVKHINDAIDHSTVL  98

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              AAKDP TSEA + C+ELL  +IDD++R++DR+
Sbjct  99   SEAAKDPSTSEALENCRELLDYAIDDLRRSVDRL  132



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G   I + TKA++ +C+PT +++ C   L+ +  N+ D KELV+ AF V  +E++K ++K
Sbjct  41   GENKIAAGTKAIQSICQPTRYKQACESTLTNSGGNTNDPKELVKTAFRVAKEEVAKALEK  100

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            SKT+QAA  DPR +E  +IC+E++  +I+D++R ++
Sbjct  101  SKTIQAAKDDPRAAEGIEICREVVGYAINDLERTVE  136



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +STKA++ +C+PT +++ C + LS AA N TD KEL++V F VTM  +  V++KS TL+ 
Sbjct  50   TSTKAIQAICQPTDYKKTCEESLSGAAGNVTDPKELIKVGFQVTMDMLRGVIEKSTTLKD  109

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AKDP T +A + C+ELL+ +IDD+  + DR+
Sbjct  110  LAKDPSTGDALQNCKELLEYAIDDLGDSFDRI  141



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
             STKAV++VC PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + A
Sbjct  39   GSTKAVQNVCAPTDYKDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A D  T +A  ICQE+L  +IDD+KR+ D++
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKV  128



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            G   + +STKAV+ +C PT ++E C   LS A N+TD KEL+ +AFN  +  I   +K S
Sbjct  47   GGGGVSTSTKAVQAICSPTDYKETCESSLSGA-NTTDPKELIRLAFNAAVNNIGDAIKNS  105

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               + AA D  T +AF IC ++L  +IDD+KRA D++
Sbjct  106  TLFKDAAADSSTKDAFDICDDVLGSAIDDLKRAGDKV  142



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = +1

Query  268  GNKN-----IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEIS  429
            G+KN     + +STKA++ +C+PT ++E C + L SAA NST+ K+L++  FNVTM ++ 
Sbjct  41   GHKNSDGGHVTTSTKAIKAICQPTDYKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLR  100

Query  430  KVMKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             ++K S TLQ  AKD  T++A + C+ELL+ +IDDI  +  ++
Sbjct  101  AIIKNSTTLQELAKDESTNQALENCKELLEYAIDDITTSFQKL  143



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I +STKA++ +C+PT +RE C K LS+A N+TD KEL+++ F   + EI KV+  S T++
Sbjct  166  ISTSTKAIKAICQPTDYRETCEKSLSSA-NTTDPKELIKIGFQAAISEIKKVIANSSTVK  224

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              AKDP   +A + C EL+  +IDD+K + +++
Sbjct  225  EVAKDPMARQALENCHELMDYAIDDLKNSFNQL  257



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S K+++ +C+PT +RE CVK LSAA  NSTD K+L+   F V + ++   ++ S  ++ 
Sbjct  60   TSMKSIQSICEPTDYRETCVKSLSAAGGNSTDPKDLIRTGFQVAINQVKAAIENSTVVKD  119

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AKDPR+ +A + CQ LL+ SIDD++ + +R+
Sbjct  120  LAKDPRSKQALETCQHLLEYSIDDLQSSFERL  151



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  43   GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKN  102

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+  AKDPR ++A + C+ELL+ +IDD+  + D++
Sbjct  103  STTLKELAKDPRANQALQNCKELLEYAIDDLGDSFDKL  140



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
             STKAV+++C PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + A
Sbjct  39   GSTKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A D  T +A  ICQE+L  +IDD+KR+ D++
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKV  128



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
             STKAV+++C PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + A
Sbjct  39   GSTKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A D  T +A  ICQE+L  +IDD+KR+ D++
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKV  128



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            G   + +STKAV+ +C PT ++E C   L+ A N+TD KEL+ +AFN  +  I   +K S
Sbjct  47   GGGGVSTSTKAVQAICSPTDYKETCESSLAGA-NTTDPKELIRLAFNAAVNNIGDAIKNS  105

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               + AA D  T +AF IC ++L  +IDD+KRA D++
Sbjct  106  TLFKDAAADSSTKDAFDICDDVLGSAIDDLKRAGDKV  142



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 60/91 (66%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
             STKAV+ VC PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + A
Sbjct  39   GSTKAVQSVCAPTDYKDTCEQSLSHA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEA  97

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A D  T +A  ICQE+L  +IDD+KR+ D++
Sbjct  98   ANDDGTKQALAICQEVLDTAIDDLKRSFDKV  128



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            SS K ++  C PT ++E C   LSAA  NSTD KELV +AF +T+ +I +    S  L  
Sbjct  41   SSQKNIKDFCNPTDYQETCESTLSAAAGNSTDPKELVNLAFQITIDQIKEAFNHSTVLSE  100

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            AAK+PRTS+A + C+ELL  +IDD++ ++D++
Sbjct  101  AAKNPRTSDALENCRELLDYAIDDLRSSIDQL  132



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = +1

Query  268  GNKN-----IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEIS  429
            G+KN     + +STKA++ +C+PT ++E C + L SAA NST+ K+L++  FNVTM ++ 
Sbjct  41   GHKNSDGGHVTTSTKAIKAICQPTDYKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLR  100

Query  430  KVMKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             ++K S TLQ  AKD  T++A + C+ELL+ +IDD+  +  ++
Sbjct  101  AIIKNSTTLQELAKDESTNQALENCKELLEYAIDDLTTSFQKL  143



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +STKA++ +C+PT ++E C K L SA  NST+ KEL++  F V M ++ +V+K S TLQ 
Sbjct  50   TSTKAIQAICQPTDYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQE  109

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AKDP  ++A + C+ELL  +I D+  + D++
Sbjct  110  LAKDPGANQALENCKELLDYAIGDLAASFDKL  141



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +STKA++ +C+PT ++E C K L SA  NST+ KEL++  F V M ++ +V+K S TLQ 
Sbjct  50   TSTKAIQAICQPTDYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQE  109

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AKDP  ++A + C+ELL  +I D+  + D++
Sbjct  110  LAKDPGANQALENCKELLDYAIGDLAASFDKL  141



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KA++ +C+PT ++E CV  L SA  N++D KELV  AF V + +IS  ++ S TL
Sbjct  58   ISTSVKAIQAICQPTDYKEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTL  117

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPRT  A + C EL+  +IDD++ + +++
Sbjct  118  RDLEKDPRTKGALENCHELMDYAIDDLRNSFNKL  151



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  46   GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKN  105

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+A AKD R ++A + C+ELL+ +IDD+  + D++
Sbjct  106  STTLKALAKDSRANQALQNCKELLEYAIDDLGDSFDKL  143



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +STKA++ +C+PT +++ C+  L SAA N+TD  +L+++ F  TMK+I +  KKS  LQ 
Sbjct  59   ASTKAIKAICQPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQATMKQIYEATKKSNLLQK  118

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              KDPRTS A   C+EL++ ++D+++++ +R+
Sbjct  119  LEKDPRTSMALDTCKELMELAVDELRQSFNRV  150



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            G   + ++TKAV+ +C PT +++ C + LS A NSTD KEL++VAF  T+K I + +K S
Sbjct  46   GGGGVSATTKAVQAICSPTDYKQTCTESLSGA-NSTDPKELIKVAFEYTVKNIKESIKNS  104

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               + AA D RT  A  +C E+L  SI+D++R+ +++
Sbjct  105  TLYKDAAADERTKGALDVCSEVLNTSIEDLERSFEKI  141



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            + +I SS KAV+ +C+PT +R+ C + L+A A N TD +ELV++AFN+T+ +IS  + K+
Sbjct  48   DSHISSSVKAVQTICEPTDYRKECEESLTAQAGNITDPRELVKIAFNITITKISDGLSKT  107

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            + L     D RT EA   C++L+  SID+ KR+L++
Sbjct  108  QLLHEVESDERTKEALDTCKQLMNLSIDEFKRSLEK  143



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +++KA++ +C+PT ++++C   L+ AA N++D K LVE AFNVT+  I      S  LQA
Sbjct  65   TTSKAIKSICQPTDYKDICESSLTHAAGNTSDPKALVEAAFNVTIDYIRDAFNHSSVLQA  124

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            AAKDPRTS+A   C+ELL  ++D+++ +  +
Sbjct  125  AAKDPRTSDALDDCKELLDYAVDELRNSFTK  155



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            NI +S KA++ +C+ T++++ C + LS ATNS+D + L++  F + +  ++  +++S  L
Sbjct  42   NISTSQKAIQDLCQSTYYQQTCTETLSNATNSSDPQTLIQTIFEIAISHLNNTIQQSGPL  101

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            Q  + DP+TS+A+K C ++L DSI D+++ + R
Sbjct  102  QQISNDPKTSQAYKTCTKVLDDSIQDLRKTIHR  134



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            N  + +STKAV  +C PT ++E C   L+ A N+TD KEL++VAFN  +  I+  +K S 
Sbjct  25   NGGVSTSTKAVHAICTPTDYKETCESSLAGA-NTTDPKELIKVAFNAAVNNIADAIKNST  83

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             ++ AA D  T +A  +C ++L+ ++DD++RA D++
Sbjct  84   LMKDAAADNSTKDALDVCNDVLESAVDDLRRAGDKV  119



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +CKPT + + C K LSA A N+TD +EL+++AFN+T+K+I   +KK+  
Sbjct  51   HVASSVKAVKTLCKPTDYPKECEKSLSAEAGNTTDPRELIKIAFNITIKKIGNGLKKTDI  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +     DP +  A   C++L+  SID+ KR+L+RM
Sbjct  111  MHKVENDPISKMALDTCKQLMDLSIDEFKRSLERM  145



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  44   GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKN  103

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+  AKDP +++A + C+ELL+ +IDD+  + D++
Sbjct  104  STTLKELAKDPSSNQALQNCKELLEYAIDDLGDSFDKL  141



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  468
            STKAV+ +C PT ++E C   LS A N+T+ KEL++ AF+ T+K I  ++K S   + AA
Sbjct  49   STKAVQSICAPTDYKETCESSLSHA-NTTNPKELIQAAFDFTVKNIGDIVKNSPLFKEAA  107

Query  469  KDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             D  T +A +ICQE+L  +IDD+ R+ D++
Sbjct  108  NDDDTKQALQICQEVLDVAIDDLTRSFDKV  137



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  44   GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKN  103

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+  AKDP  ++A + C+ELL+ +IDD+  + D++
Sbjct  104  STTLKELAKDPSANQALQNCKELLEYAIDDLGDSFDKL  141



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  268  GNKN---IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKV  435
            GNK    +G+  KA+E +C+PT ++E C   L   A ++TD K+L++  F V   ++++V
Sbjct  38   GNKKPAKVGAKKKAIETICQPTTYKETCQSSLEKEAGDTTDPKDLIKAGFKVAADKVNEV  97

Query  436  MKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +K S TL+  AKDP TS+A  +C+ELL+ +++D+  A+D+M
Sbjct  98   IKNSNTLKEHAKDPMTSQALGVCKELLETAVEDLLGAVDKM  138



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN  I +S KA++ VC PT +++ C + L+  A N+TD  ELV+ AF+VTMK+I++  KK
Sbjct  50   GNGEITASVKAIKEVCAPTDYKKTCEETLTKNAKNTTDPMELVKTAFDVTMKQIAEAAKK  109

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+TL    KDPRT  A   C+EL+  +ID++K + + +
Sbjct  110  SQTLVELQKDPRTKMALDQCRELMNYAIDELKSSFEEL  147



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL-  456
            I +S K+V  +C+ T ++E CVK L+ A N+ D K+L++VAF  T+ ++  V+K S  L 
Sbjct  45   ISTSAKSVNVICQQTDYKETCVKSLAKANNTNDPKDLLKVAFGATINDLFDVIKNSALLI  104

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              A+KDPRT +A K C +LL  +IDD++R+ D +
Sbjct  105  NEASKDPRTKDALKTCGDLLDVAIDDVRRSFDEI  138



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SS KAV+ +CKPT +++ C K L A A N+TD +EL+++AF +T+K++   +KK+  +
Sbjct  29   IASSVKAVKTLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFM  88

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 DPR+  A + C++L+  SID+ KR+L+RM
Sbjct  89   HEVENDPRSKMALETCKQLMNLSIDEFKRSLERM  122



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SS KAV+ +CKPT +++ C K L A A N+TD +EL+++AF +T+K++   +KK+  +
Sbjct  52   IASSVKAVKTLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFM  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 DPR+  A + C++L+  SID+ KR+L+RM
Sbjct  112  HEVENDPRSKMALETCKQLMNLSIDEFKRSLERM  145



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++   +++KA++ +C+PT ++E+C   L+ AA N++D K LVE AFNVT+  I      S
Sbjct  59   SRGFTTTSKAIKSICQPTDYKEICESSLTKAAGNASDPKVLVEAAFNVTISYIRDAFDHS  118

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
              LQA AKDPRTS+A   C++LL  +ID+++ +  +
Sbjct  119  SVLQATAKDPRTSDALDDCKKLLDYAIDELRNSFTK  154



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
             I +S KA++ +C+PT ++E CV  L SA  N++D KELV  AF V + +IS  ++ S T
Sbjct  39   GISTSVKAIQAICQPTDYKEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTT  98

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L+   KDPRT  A + C EL+  +IDD++ + +++
Sbjct  99   LRDLEKDPRTKGALENCHELMDYAIDDLRNSFNKL  133



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            G+  + +S+K+VE VCK   +++ C + LS A N++D +EL+++AF   +  I+ V++ S
Sbjct  44   GSDQVSTSSKSVESVCKHVDYKQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNS  103

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
              LQ AAKDPRT +A + C+  L  SI+D++R+ +
Sbjct  104  TLLQNAAKDPRTHQALETCKYALNTSIEDLQRSFE  138



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            N ++ SS KAV  +CKPT++++ C K L   A N+TD++EL+++ FN+TMK+I K   K 
Sbjct  46   NNHVVSSVKAVRTLCKPTYYQKECEKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKI  105

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              +  A ++PR   A   C++L+  S+ + KRAL++M
Sbjct  106  DHMLGAERNPRARMALATCKQLMNLSVGEFKRALEKM  142



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            N ++ SS KAV  +CKPT++++ C K L   A N+TD++EL+++ FN+TMK+I K   K 
Sbjct  46   NNHVVSSVKAVRTLCKPTYYQKECEKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKI  105

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              +  A ++PR   A   C++L+  S+ + KRAL++M
Sbjct  106  DHMLGAERNPRARMALATCKQLMNLSVGEFKRALEKM  142



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  468
            + KAV  +C PT ++E C   LS A N+TD KEL++VAFN  +  I + +K S  L+ AA
Sbjct  55   ANKAVHAICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAA  113

Query  469  KDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             D  T +A  IC ++L+ +IDD+KRA D++
Sbjct  114  ADNSTKDALDICNDVLESAIDDLKRAGDKV  143



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKK  444
            G+  I ++TKAV+ VC+PT ++E CV  L AA+ NST   +L+ + FN+T+  I + +KK
Sbjct  43   GDSQIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKK  102

Query  445  S-KTLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   L+A A KDP T  A  +CQEL+ D+IDD+K+  D+ 
Sbjct  103  AAHELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKF  142



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +++KA+  +C+PT + E C   L+A A N TD K+LVE++F   M  + +    S  LQ 
Sbjct  60   TTSKAIRAICRPTDYAEECQSSLAARAGNVTDPKKLVELSFTSAMDSLREAFNHSSVLQE  119

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            AAKDPRTSEA + C+ELL  +IDD+K ++ R 
Sbjct  120  AAKDPRTSEALENCKELLDYAIDDLKNSVARF  151



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKK  444
            G+  I ++TKAV+ VC+PT ++E CV  L AA+ NST   +L+ + FN+T+  I + +KK
Sbjct  43   GDSQIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKK  102

Query  445  S-KTLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   L+A A KDP T  A  +CQEL+ D+IDD+K+  D+ 
Sbjct  103  AAHELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKF  142



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  43   GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKN  102

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+  AKD R ++A + C+ELL+ +IDD+  + D++
Sbjct  103  STTLKELAKDSRANQALQNCKELLEYAIDDLGDSFDKL  140



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S KA++ VC+PT +++ C K LS+ + N++D  ELV VAFN +MK ++    KS+ L+ 
Sbjct  47   TSIKAIKAVCEPTDYKDACEKTLSSMSHNTSDPMELVNVAFNASMKYVTDAFDKSELLKD  106

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             +KDP ++EA + C ELL+ + DD+K++++++
Sbjct  107  VSKDPASAEALRTCSELLEYATDDLKKSIEQL  138



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +1

Query  292  TKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAK  471
            TKAV+ +C PT +++ C + L+ A N+TD KEL+++AF+ T+K++   +  S   + AA 
Sbjct  48   TKAVQAICSPTDYKQTCEESLAGA-NTTDPKELIKLAFDNTVKKVRAAILNSTLYKDAAA  106

Query  472  DPRTSEAFKICQELLQDSIDDIKRALDRM  558
            DPRT  A K+C+E+L + IDD++R+ D++
Sbjct  107  DPRTKGALKVCEEVLDNCIDDLQRSFDQV  135



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            ++ + +S+KAV+ +C PT +++ CVK L A   + D KELV  AF   M E+ ++   S 
Sbjct  34   DQKLAASSKAVQAICNPTDYKDACVKSL-ATVKTDDPKELVRAAFASAMAELKEIASNST  92

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             L+    DP+T++A K C+EL QD+IDD +R+ D +
Sbjct  93   ILKVLEMDPKTAQAVKDCKELFQDAIDDFQRSFDEI  128



>gb|KJB38560.1| hypothetical protein B456_006G260600 [Gossypium raimondii]
Length=563

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +1

Query  298  AVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  477
            AV+ VC+PT  ++ C K L A++NSTDTKEL+  +F   ++E+ KV+  S T+Q   KD 
Sbjct  48   AVQAVCQPTHFKDACEKSL-ASSNSTDTKELIRSSFQAAIEEVRKVLANSTTIQDLNKDD  106

Query  478  RTSEAFKICQELLQDSIDDIKRALDRM  558
               EA K+CQE+L  SIDD++ + D+M
Sbjct  107  NNREALKVCQEVLDLSIDDLQLSFDKM  133



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KAV+ +C+PT +R+ C + L  AA N+TD KEL+++AF +  K+I++  +KSK L
Sbjct  55   VSASVKAVKAICQPTDYRKTCEESLQKAAGNTTDPKELIKIAFKIAEKQINEASEKSKLL  114

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  +KDPRT  A + C+EL+  S+ ++K++LD++
Sbjct  115  EELSKDPRTRGALQSCKELMNMSVGELKQSLDKV  148



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  468
            STKAV+ +C PT ++E C   LS A NST+  EL++ AF+ T+K I  ++  S   + AA
Sbjct  49   STKAVQSICAPTDYKETCESSLSHA-NSTNPNELIKAAFDFTVKNIGDIITNSPLFKEAA  107

Query  469  KDPRTSEAFKICQELLQDSIDDIKRALD  552
             D  T +A +ICQE+L  +IDD+KR+ D
Sbjct  108  NDDGTKQALEICQEVLDTAIDDLKRSFD  135



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S KA++ VC+PT +++ C K LS+ + N+TD  ELV VAF+ +MK ++ V  +S+ L+ 
Sbjct  49   TSIKAIQTVCQPTDYKDACEKTLSSFSHNTTDHMELVNVAFSASMKYVTDVFDRSELLKE  108

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRAL  549
             +KDP ++EA + C+ELL+ ++DD+K+++
Sbjct  109  VSKDPASTEALQTCRELLEYAMDDLKKSI  137



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +STKAV+ +C+PT ++E C K LS A TN++D +EL++  FNV + EI   +  S TL
Sbjct  53   ISTSTKAVKALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTL  112

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            + AA DP   +A   C EL+  +IDD+  +  R+
Sbjct  113  KEAASDPMAKQALDACGELMDYAIDDLVISFQRI  146



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +STKAV+ +C+PT ++E C K LS A TN++D +EL++  FNV + EI   +  S TL
Sbjct  50   ISTSTKAVKALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTL  109

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            + AA DP   +A   C EL+  +IDD+  +  R+
Sbjct  110  KEAASDPMAKQALDACGELMDYAIDDLVISFQRI  143



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  274  KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            + I SS KA++ +C+PT +++ CV  L S A N+TD K+LV+ AF   M+ +S   K S 
Sbjct  50   QEISSSMKAIQAICQPTDYKDACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNST  109

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             LQ   KDPR S+A + C++L+  +IDD+K++ +++
Sbjct  110  LLQELNKDPRASQALQNCEDLVNYAIDDLKKSFNQV  145



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ I +S KA++ +C+PT ++E C+K LS AA N+TD K+LV++AF +  K+I + + +S
Sbjct  50   DEQIQTSMKAIKAICQPTDYKETCIKSLSSAAGNTTDPKDLVKIAFKIATKQIKEAVNRS  109

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              L+   KDPR S+A   C+EL+  +ID++  + D +
Sbjct  110  VVLKELEKDPRASKALANCRELMDYAIDELNSSFDEL  146



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SS KA++ +C+PT +++ CV  L S A N+TD K+LV+ AF   M+ +S   K S  L
Sbjct  52   ISSSMKAIQAICQPTDYKDACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLL  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            Q   KDPR S+A + C++L+  +IDD+K++ +++
Sbjct  112  QELNKDPRASQALQNCEDLVNYAIDDLKKSFNQV  145



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KAV+ +C+PT +R+ C + L  AA N+TD +EL+++AF +  K +++  KKSK L
Sbjct  55   VSASMKAVKAICQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHVNEASKKSKVL  114

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  +KDPRT  A + C+EL+  S+D++K++L+++
Sbjct  115  EELSKDPRTRGALQSCRELMTMSVDELKQSLNKV  148



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  468
            + KAV  +C PT ++E C   LS A N+TD KEL++VAFN  +  I + +K S  L+ AA
Sbjct  55   ANKAVHAICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAA  113

Query  469  KDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             D  T +A  IC ++L+ +IDD+KRA D++
Sbjct  114  ADNSTKDALDICNDVLESAIDDLKRAGDKV  143



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ +  S KA++ +C+PT ++E C+K L A A NSTD KEL++ AF  T   I++  K S
Sbjct  40   HQAVSDSQKAIQTICEPTDYKETCIKTLQAEAGNSTDPKELIQAAFKATTNYINEAAKNS  99

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
              LQ   KDPRT  A + C+EL   +++D++R+  +
Sbjct  100  TVLQELQKDPRTKLALENCKELAHQAVEDLERSFAK  135



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ S+ +AV+ +C+PT +++ CV  L+A   A N TD KEL+++AFNVTMK+I + +K +
Sbjct  52   HVSSTMRAVQTICQPTDYKKECVDTLTAEAEAGNVTDPKELIKIAFNVTMKKIGEQIKAT  111

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              +    KDPR+ +A   C++L+  SI +  RA+D +
Sbjct  112  DLMHEVEKDPRSKDAIDTCKQLMDLSIGEFARAMDGI  148



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S+K+V+ +C+PT +RE+C K LS AA N+TD  +LV+  F VT+  + + ++ S TL
Sbjct  52   ISTSSKSVQAICQPTDYREICGKSLSKAAGNTTDPLKLVQAGFQVTIDALQQALQNSSTL  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  AKDP   +A   C+EL+ D+I D+K + + +
Sbjct  112  KDVAKDPMAKQALDNCKELMDDAIHDLKVSFEEV  145



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KAV+ +C+PT +R+ C + L  AA N+TD +EL+++AF +  K +++  KKSK L
Sbjct  55   VSASMKAVKAICQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHLNEASKKSKVL  114

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  +KDPRT  A + C+EL+  S+D++K++L+++
Sbjct  115  EELSKDPRTRGALQSCKELMTMSVDELKQSLNKV  148



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G++ I +S KA++ VC PT +++ C   L   A N++D  ELV+ AFN TMK+I++V KK
Sbjct  46   GDEEITTSVKAIKDVCAPTDYKKTCEDTLRKDAQNTSDPLELVKTAFNATMKQITEVAKK  105

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  +I ++ ++ + +
Sbjct  106  SQTMIELQKDPRTKMALDQCKELMDYAIGELSKSFEEL  143



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++  S KAV+ +C PT +++ C   L A A N T+ KEL+++AFN+T+ +IS+ +KK+  
Sbjct  51   HVSQSVKAVKTLCAPTDYKKECEDSLIAHAGNITEPKELIKIAFNITIAKISEGLKKTHL  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            LQ A KD RT +A   C++++Q SID+ +R+L+R 
Sbjct  111  LQEAEKDERTKQALDTCKQVMQLSIDEFQRSLERF  145



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G   I +S KA++ VC PT ++E C   L   A N++D  ELV+ AFN TMK+IS V KK
Sbjct  45   GEGEITTSVKAIKDVCAPTDYKETCEDTLRKDAKNTSDPLELVKTAFNATMKQISDVAKK  104

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  +I ++ ++ + +
Sbjct  105  SQTMIELQKDPRTKMALDQCKELMDYAIGELSKSFEEL  142



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Fragaria vesca subsp. vesca]
Length=567

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +++KA+E VC+PT ++E C   LS  A N TD KELV++ F + ++++ +V+  S TL+ 
Sbjct  49   TTSKAIETVCQPTDYKETCQNALSEKAGNVTDPKELVKIGFQIAIEKLQEVINNSDTLKE  108

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AKD   ++A + C+EL++ SIDD+KR+ D++
Sbjct  109  IAKDNLGNQALQNCRELIEYSIDDLKRSADKI  140



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ S+ KAV+ +C PT +++ C + L A   A N TD KEL+++AFNVTMK I   +K++
Sbjct  51   HVASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              L    KDPR+ +A   C++L+  SID+  R+LD +
Sbjct  111  DLLHEVEKDPRSKDALDTCKQLMDLSIDEFTRSLDGI  147



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +STKAV+ +C+PT ++E C K LS A TN++D +EL++  F+V + EI   +  S  L
Sbjct  50   ISTSTKAVQALCQPTDYKETCEKALSEAGTNTSDPRELIKSGFHVAVNEIKWAIGNSTQL  109

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            + AA DP   +A   C EL+  +IDD+  + DR+
Sbjct  110  KEAASDPMAKQALDACGELMDYAIDDLVISFDRI  143



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLS--AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            S KA++ +C+PT ++E CV  L+  A +N+TD KELV+++F V ++++ KV  +S  L+ 
Sbjct  65   SMKAIKTICQPTDYKEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSALLKE  124

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              KDP T +A  IC E++  +ID++K ++D++
Sbjct  125  VEKDPGTRQALSICDEIMDYAIDELKNSIDQV  156



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            S KA+E +C+PT ++E C   L   A ++TD KELV+  F V   ++++V++ S TL+  
Sbjct  45   SKKAIEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDL  104

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            AKDP  S+A  IC+ELL  +++D+  A+D+M
Sbjct  105  AKDPMASQALDICKELLNTAVEDLLGAVDKM  135



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +1

Query  295  KAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAK  471
            KA++ VC+PT  R+ C ++L A A ++TD KELV+ AF   MK  S+ ++ S TL+   K
Sbjct  59   KAIKSVCQPTDFRKTCEEQLRAEAGDTTDIKELVQAAFKAAMKSASQAVQNSTTLRDLEK  118

Query  472  DPRTSEAFKICQELLQDSIDDIKRALDRM  558
            DPRT +A  +C++L+  SI ++K++LD++
Sbjct  119  DPRTKKALDVCKQLMTYSIKELKKSLDQI  147



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            +S KAV+ VC PT +RE C + L+ A N++D KEL+   F V +  I + +KKS  L+ A
Sbjct  32   TSNKAVQAVCSPTSYRETCEQTLAKA-NTSDPKELIRYGFGVAVDGIGEALKKSALLKQA  90

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A D  T +AF +C+++L  ++ D+++++DR+
Sbjct  91   AADQSTKDAFYVCEDVLDLAVYDLQKSIDRI  121



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +I S+ KAV+ +C PT +++ C + L A   A N TD KEL+++AFNVTMK I   +K++
Sbjct  51   HIASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              L    KDPR+ +A   C++L+  SI++  R+LD +
Sbjct  111  DLLHEVEKDPRSKDALDTCKQLMDLSIEEFTRSLDGI  147



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = +1

Query  271  NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  438
            NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  30   NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  88

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              S T+Q   KD     A  +CQE+L  +IDD +++ D +
Sbjct  89   GHSVTVQELTKDENNKAALGVCQEVLDLAIDDFQKSFDML  128



>gb|KJB38561.1| hypothetical protein B456_006G260700 [Gossypium raimondii]
Length=564

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I SSTKAV+ VC+PT  +E C K L ++ NSTD KEL+  +F   ++EI KV+  S T+Q
Sbjct  40   ISSSTKAVQTVCQPTQFKEACEKSLESS-NSTDPKELIRTSFQAAIEEIRKVLANSATIQ  98

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               KD     A K+C+E+L  SI D++ + D++
Sbjct  99   DLNKDDNNKAALKVCKEVLDLSIADLQLSFDKL  131



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/98 (41%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G + I +S KA++ VC PT +++ C   L   A N++D  ELV+ AFNVTMK+IS V KK
Sbjct  44   GEEEITTSVKAIKEVCAPTDYKKTCEDTLRKDAQNTSDPLELVKTAFNVTMKQISDVAKK  103

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPR   A   C+EL+  +I ++  + + +
Sbjct  104  SQTMIELQKDPRAKMALDQCKELMDYAIGELSNSFEEL  141



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S+K+V+ +C+PT +RE+C K L  AA N+TD  +LV+  F VT+  + + ++ S TL
Sbjct  52   ITTSSKSVQSICQPTDYREICEKSLRKAAGNTTDPHKLVQAGFQVTIDALQQALQNSSTL  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  AKDP   +A   C+EL+ D+I D+K + + +
Sbjct  112  KEVAKDPMAKQALDNCKELMDDAIHDLKVSFEEV  145



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +K + +S KA++ +C+PT++++ C + L+ +A N+TD KEL+++AF +  K+I    KKS
Sbjct  53   SKEVSASMKAIKTLCQPTYYKQTCERSLAKSAGNTTDPKELIKIAFKLAEKQIDSASKKS  112

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             TL    KDPRT  A   C+EL+  SI++++ +L+++
Sbjct  113  LTLLELEKDPRTRGALNSCKELMTMSINELRSSLEKV  149



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I ++TKAV  VC PT  +E CVK L  A+ NST+  EL++++FN T+K I+  +KK
Sbjct  38   NENQIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKK  97

Query  445  SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +       A KDP    AF++C+ L+ D+IDD+K+ +DR
Sbjct  98   ASEDVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR  136



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +I S+ KAV+ +C PT +++ C + L A   A N TD KEL+++AFNVTM+ IS+ +K++
Sbjct  51   HIASTMKAVQTICHPTEYKKECEETLVAEAQADNVTDPKELIKIAFNVTMRRISEKIKET  110

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
              +    KDPR+ +A   C++L+  SI +  R+LD
Sbjct  111  DLMHEVEKDPRSKDALDTCKQLMDLSIGEFTRSLD  145



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I ++TKAV  VC PT  +E CVK L  A+ NST+  EL++++FN T+K I+  +KK
Sbjct  38   NENQIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKK  97

Query  445  SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +       A KDP    AF++C+ L+ D+IDD+K+ +DR
Sbjct  98   ASEDVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR  136



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +1

Query  268  GNKNIGS-STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G++ I + STKAV+ +C PT +++ C K LS A N+T+ +EL++ AF  T+K I  V+K 
Sbjct  42   GDRQISAGSTKAVQSICAPTDYKDTCEKGLSHA-NTTNPQELIKAAFEFTVKNIGDVVKN  100

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            S   + A+ D  T EA +ICQ +L+ +IDD+K + D
Sbjct  101  SPLFKEASHDKSTKEALEICQLVLEIAIDDLKMSFD  136



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = +1

Query  271  NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  438
            NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  30   NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  88

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              S T+Q   KD     A  +CQE+L  +IDD +++ D +
Sbjct  89   AHSVTVQELIKDENNKAALGVCQEVLDLAIDDFQKSFDML  128



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +STKA++ +C+PT +++ C+  L SAA N+TD  +L+++ F   MK+I +  KKS  LQ 
Sbjct  59   ASTKAIKAICQPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQAAMKQIYEATKKSNLLQK  118

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              KD RTS A   C+EL++ ++D++ ++ +R+
Sbjct  119  LEKDHRTSMALDTCKELMELAVDELNQSFNRL  150



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = +1

Query  271  NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  438
            NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  14   NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  72

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              S T+Q   KD     A  +CQE+L  +IDD +++ D +
Sbjct  73   AHSVTVQELIKDKNNKAALGVCQEVLDLAIDDFQKSFDML  112



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            NK   SS KA+E +C+ T ++E C   L  AA +++D KEL++  F V   ++ +V++ S
Sbjct  41   NKGTASSKKAIETICQTTSYKETCQSSLEKAAGDTSDPKELIKAGFQVAADKLDEVIQNS  100

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             TL+  AKDP  S+A  +C+E+L  S +D+  A+D+M
Sbjct  101  NTLKDLAKDPMASQALDVCKEMLDTSTEDLLAAVDKM  137



>gb|KJB38563.1| hypothetical protein B456_006G260900 [Gossypium raimondii]
Length=561

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = +1

Query  271  NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  438
            NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  30   NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  88

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              S T+Q   KD     A  +CQE+L  +IDD +++ D +
Sbjct  89   AHSVTVQELIKDENNKAALGVCQEVLDLAIDDFQKSFDML  128



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = +1

Query  268  GNKN--IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVM  438
            GNK+  I SS KA++ +C+PT +++ CV  L A   NS+D KELV+  F   MK I    
Sbjct  48   GNKSHEISSSMKAIKAICQPTDYKQECVASLKATGNNSSDPKELVQAGFKAAMKLIQAAA  107

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             KS  L    KDPR S+A   C+EL+  +ID++K +++++
Sbjct  108  NKSVALNQLEKDPRASKALAGCKELMDFAIDELKYSMNKL  147



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (66%), Gaps = 4/99 (4%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I ++TKAV  VC PT  +E CVK L  A+ NST+  EL++++FN T+K I+   KK
Sbjct  38   NENQIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNFKK  97

Query  445  SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +       A KDP    AF++C+ L+ D+IDD+K+ +DR
Sbjct  98   ASEDVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR  136



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA+E +C+PT ++E CV+ L  A  N+ D KEL++ +F   MK I++  KKS  L
Sbjct  53   VSASIKAIEGICQPTDYKEACVRSLREAGANTADPKELIKASFKAAMKHIAEAAKKSTVL  112

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   K PR  +A   C++L+  +I+D++R+ D++
Sbjct  113  KELEKTPRAQQALSNCKKLMGFAINDLERSFDKL  146



>gb|KJB38562.1| hypothetical protein B456_006G260800 [Gossypium raimondii]
Length=561

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+  S T+Q
Sbjct  37   ISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVLAHSVTVQ  95

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               KD     A  +CQE+L  +IDD +++ D +
Sbjct  96   ELIKDENNKAALGVCQEVLDLAIDDFQKSFDML  128



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +1

Query  268  GNKN--IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVM  438
            GNK+  I SS KA++ +C+PT +++ C+  L A   NS+D +ELV+  F   MK I    
Sbjct  48   GNKSHEISSSMKAIKAICQPTDYKQECIASLKATGNNSSDPQELVQAGFKAAMKLIQAAA  107

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             KS  L+   KDPRTS+A   C+EL+  +ID++K +++++
Sbjct  108  NKSVDLKQLEKDPRTSKALAGCKELMDFAIDELKYSMNKL  147



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            NK   SS KA+E +C+ T ++E C   L  AA +++D KEL++  F V   ++ +V+K S
Sbjct  41   NKGTSSSKKAIETICQTTSYKETCQSSLEKAAGDTSDPKELIKTGFQVAADKLDEVIKNS  100

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             TL+  AKDP  S+A  +C+E+L  + +D+  A+D+M
Sbjct  101  NTLKDLAKDPMASQALDVCKEMLDTAAEDLLGAVDKM  137



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +K ++ +
Sbjct  37   GVATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNALKNTEPI  96

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            + AA DP T +A   C+EL   +++D++ ++ ++
Sbjct  97   KKAASDPYTKDALLACEELFDLAVEDLRGSVAKI  130



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            + S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K+++
Sbjct  56   VASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETE  115

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              +   KDPR+ +A   C++L+  SI +  R+LD +
Sbjct  116  MFREIEKDPRSKDALDTCKQLMHLSIGEFTRSLDGI  151



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ S+ KA+  +C+PT +++ C + L A   A N TD KEL+++AFNVT+K+I + +K++
Sbjct  50   HVASTMKAIRTICQPTDYKKECEESLRAEAEADNVTDPKELIKIAFNVTIKKIGEKLKET  109

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              L    KDPR+ +A   C++L+  SID+  R+LD +
Sbjct  110  DMLCELEKDPRSKDALDTCKQLMDLSIDEFTRSLDGI  146



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K++
Sbjct  55   HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  114

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +      KDPR+ +A   C++L+  SI +  R+LD +
Sbjct  115  EMFSEIEKDPRSKDALDTCKQLMHLSIGEFTRSLDGI  151



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G++ I +S KA++ VC PT ++E C   L   A +++D  ELV+ AFN TMK+IS V KK
Sbjct  46   GDEEITTSVKAIKDVCAPTDYKETCEDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKK  105

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPR   A   C+EL+  +I ++ ++ + +
Sbjct  106  SQTMIELQKDPRAKMALDQCKELMDYAIGELSKSFEEL  143



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC PT +++ C   L   A N++D  ELV+ AF VTMK+I++   KSKTL
Sbjct  54   VTASVKAIKEVCAPTDYKKTCEDTLRKNANNTSDPLELVKTAFEVTMKQIAEAAAKSKTL  113

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                KDPRT  A   C+EL+  + D++K + D +
Sbjct  114  IEIQKDPRTKMALDQCKELMDYAFDELKSSFDEL  147



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +1

Query  268  GNKN---IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKV  435
            GNK    +G+  KA+E +C+ T ++E C   L   T ++TD K+L++  F V   ++++V
Sbjct  38   GNKKPAKVGAKKKAIETICQATTYKETCQSSLEKETGDTTDPKDLIKAEFQVAADKVNEV  97

Query  436  MKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +K S TL+  AKDP  S+A  +C+ELL+ +++D+  A+D+M
Sbjct  98   IKNSNTLKEYAKDPMASQALGVCKELLETAVEDLLGAVDKM  138



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K ++  C+PT ++  C   LSA A N+TD KELV +AF VT+  + +    S  L
Sbjct  39   LSTSNKNIKDFCRPTDYQATCESSLSAVAGNTTDPKELVNLAFQVTIDHMKEAFNHSTVL  98

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              AAKD RTS+A + C+ELL  +I D+K ++DR+
Sbjct  99   SEAAKDSRTSDALENCRELLDYAIYDLKSSIDRL  132



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN+ I +S KA++ VC PT +++ C   L   A N +D  ELV+ AFN TMK+IS V KK
Sbjct  44   GNEEITTSVKAIKDVCAPTDYKKTCEDTLRKDAKNISDPLELVKTAFNATMKQISNVAKK  103

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  +I ++ ++ D +
Sbjct  104  SQTMIDLQKDPRTKMALDQCKELMDYAIVELTKSFDEI  141



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +++K+++ +C+PT +RE C + LS AA N+TD  +LV+  F VT++ +   + +S TL
Sbjct  53   ISTTSKSIKAICQPTDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTL  112

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            +  AKDP  S+A   C+EL+ D+I +++ + D
Sbjct  113  KELAKDPMASQALDNCRELMDDAIAELEHSFD  144



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +++K+++ +C+PT +RE C + LS AA N+TD  +LV+  F VT++ +   + +S TL
Sbjct  53   ISTTSKSIKAICQPTDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTL  112

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            +  AKDP  S+A   C+EL+ D+I +++ + D
Sbjct  113  KELAKDPMASQALDNCRELMDDAIAELEHSFD  144



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Fragaria vesca subsp. vesca]
Length=559

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S+KA+E VC+PT  ++ C   L+A A N TD KEL++VA  +   ++ +V+  S+T+  
Sbjct  48   TSSKAIEAVCQPTDFKDTCKTTLAANAGNVTDPKELIKVAMKIATDKLQEVVDNSQTMHE  107

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              KDP   +A + C+EL+Q SI+DIK+A   M
Sbjct  108  VVKDPLGDQALQNCKELIQYSINDIKKAFGNM  139



>gb|KJB45338.1| hypothetical protein B456_007G302000 [Gossypium raimondii]
Length=588

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            S KA+E +C+PT  +E C +++ A A N+TDT +L++ AF   MK +S+  + S TL+  
Sbjct  55   SKKAIESICQPTDFKETCEEEIGAEAGNATDTNDLIQAAFKAAMKFLSRAAQNSTTLRNL  114

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             KDPRT +A  IC +L+  SI++++++ +++
Sbjct  115  QKDPRTKKALDICIQLMTYSINELQKSFNKI  145



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KA++ +C+P  +++ C K L  +A N+TD KEL++ AF +  K+I +  KKS TL
Sbjct  53   ISASMKAIKSICQPADYKKTCEKSLEKSAGNTTDPKELIKAAFKIAQKKIREAAKKSATL  112

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPRT +A + C+EL+  SI +++ + D++
Sbjct  113  EELEKDPRTRDALQSCKELMDMSISELQNSFDKV  146



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            +STK+VE +C+PT +++ C K LS+A N++D K+ ++VAF  T+ +I   +  +  +  A
Sbjct  41   TSTKSVESMCQPTPYKQTCEKTLSSAKNASDPKDFIKVAFEATVTDIKNAIMNTDLIMQA  100

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A DP+T +A   C+EL   +I+D++ ++ ++
Sbjct  101  ASDPKTKDALHACEELFDLAIEDLRTSVSKL  131



>ref|XP_009134931.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=577

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 72/100 (72%), Gaps = 6/100 (6%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I  +TKAV+ VC PT ++E+C+K  + A+ NST+  EL+++A NVT++ I++ +KK
Sbjct  38   NENQIRQATKAVKAVCAPTDYKEICLKSIMDASPNSTEPLELIKLAINVTIESINQGLKK  97

Query  445  SKTLQAAAK---DPRTSEAFKICQELLQDSIDDIKRALDR  555
            + ++    K   DP   +AF++C++L+ D+IDD+K+ L+R
Sbjct  98   A-SIDVKPKTDEDPEAKDAFELCEKLMFDAIDDLKKCLNR  136



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  468
            +TK+V+ +C PT +++ C + L+ A NSTD K L+++AF  T+K I   +  S   + AA
Sbjct  48   TTKSVQAICSPTDYKQTCEESLAGA-NSTDPKYLIKLAFQNTVKGIRSAILNSTLYREAA  106

Query  469  KDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             DP T  A ++C+E+L +S+DD++R+ D++
Sbjct  107  ADPNTKGALQVCEEVLDNSVDDLQRSFDQV  136



>ref|XP_002461260.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
 gb|EER97781.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
Length=571

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G++N+  S K+V+  C+PT +++ C  +LS AA N++   +L +V F VT  +I K + +
Sbjct  36   GDENMSMSVKSVKAFCQPTDYKQTCEAELSKAAGNASTPSDLAKVIFGVTSDKIHKAISE  95

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+TL+    D RTS A K C ELL+ +IDD+K + D++
Sbjct  96   SETLKELKNDQRTSGALKDCNELLEYAIDDLKSSFDKL  133



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            + +STK+VE +C+PT +++ C K LS+A N TD K+ ++VAF  T+ +I   +  +  + 
Sbjct  39   VTTSTKSVEAMCQPTPYKQTCEKTLSSAKNVTDPKDFIKVAFEATVTDIKNAIMNTDLIM  98

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AA DP+T +A   C+EL   +I+D++ ++ ++
Sbjct  99   KAASDPKTKDALHACEELFDLAIEDLRTSVSKL  131



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SS KAV+ +C PT +++ C + L A A N+TD KEL+++ FN+T+ +I   +KK+  L
Sbjct  47   IASSVKAVQTLCHPTNYKKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLL  106

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                +DPR   A   C++L+  SI+++ R+LD +
Sbjct  107  HEVEEDPRAKMALDTCKQLMDLSIEELTRSLDGI  140



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SS KAV+ +C PT +++ C + L A A N+TD KEL+++ FN+T+ +I   +KK+  L
Sbjct  47   IASSVKAVQTLCHPTNYKKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLL  106

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                +DPR   A   C++L+  SI+++ R+LD +
Sbjct  107  HEVEEDPRAKMALDTCKQLMDLSIEELTRSLDGI  140



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN  I +S KAV+ +C PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KK
Sbjct  49   GNGQITASVKAVKDICAPTDYKKTCEDSLIKNGKNTTDPMELVKTAFSVTMKQITDAAKK  108

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  109  SQTIIDLQKDPRTRMALDQCKELMDYALGELSNSFEEL  146



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +K ++ +
Sbjct  37   GVATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPV  96

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            + AA DP T +A   C+E+   ++++++ ++ R+
Sbjct  97   KKAASDPYTKDALLACEEVFDLAVEELRGSIARI  130



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +K ++ +
Sbjct  37   GVATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPV  96

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            + AA DP T +A   C+E+   ++++++ ++ R+
Sbjct  97   KKAASDPYTKDALLACEEVFDLAVEELRGSIARI  130



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT +++ C   L+  A N TD +EL+++AFN+T+  IS  + K++ 
Sbjct  49   HVASSMKAVKTLCAPTDYQKECEDSLNENAGNITDPRELIKLAFNITITRISDGLGKTQL  108

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L     DPRT EA   C++L+  SI++  R+L R 
Sbjct  109  LHDVESDPRTKEALDTCKQLMHLSIEEFNRSLQRF  143



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  453
            I ++TKAV+ VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S+ 
Sbjct  48   IKTTTKAVQEVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSIKKASEE  107

Query  454  LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L+A AAKD  T +A ++C+ L+ D+ DD+K+ LD  
Sbjct  108  LKAKAAKDNETKDALELCESLMTDATDDLKKCLDNF  143



>emb|CDX74078.1| BnaA03g29690D [Brassica napus]
Length=577

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 72/100 (72%), Gaps = 6/100 (6%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I  +TKAV+ VC PT ++++C+K  + A+ NST+  EL+++A NVT++ I++ +KK
Sbjct  38   NENQIRQTTKAVKAVCAPTDYKDICLKSIMDASPNSTEPLELIKLAINVTIESINQGLKK  97

Query  445  SKTLQAAAK---DPRTSEAFKICQELLQDSIDDIKRALDR  555
            + ++    K   DP   +AF++C++L+ D+IDD+K+ L+R
Sbjct  98   A-SIDVKPKTDEDPEAKDAFELCEKLMFDAIDDLKKCLNR  136



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 58/91 (64%), Gaps = 1/91 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            +S KA   +C    ++  C K LS A NS+D +EL++VAFN  + +I + +K S   + A
Sbjct  33   NSNKAAHALCTSVDYKITCEKSLSGA-NSSDPQELIKVAFNHAITDIQEAIKNSTLYKQA  91

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A D RT  A ++C+E+L  SIDD++R+ DR+
Sbjct  92   ALDHRTKGALEVCEEVLDTSIDDLRRSFDRV  122



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +1

Query  301  VEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  477
            +E +C+PT ++E C   L   A ++TD KELV+  F V   ++++V++ S TL+  AKDP
Sbjct  51   IEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDLAKDP  110

Query  478  RTSEAFKICQELLQDSIDDIKRALDRM  558
              S+A  +C+E+L  +++D+  A+D+M
Sbjct  111  MASQALDVCKEMLNTAVEDLLGAVDKM  137



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KAV+ VC PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS+T+
Sbjct  51   INASVKAVKDVCAPTDYKKTCEDTLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTM  110

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  111  MELQKDPRTRMALDQCKELMDYALGELSNSFEEL  144



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +1

Query  274  KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            + I +S KA++ VC PT +++ C   L   A +++D  ELV  AFN TMK+IS V KKS 
Sbjct  47   EEITASVKAIKDVCAPTDYKKTCEDTLRKDAKDTSDPLELVRTAFNATMKQISNVGKKSL  106

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            T+    KDPRT  A   C EL+  +I ++ ++ D +
Sbjct  107  TMIELQKDPRTKMALDQCTELMDYAIGELSKSFDEL  142



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  47   GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPVELVKTAFRATMKQITDAAKK  106

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  107  SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN ++ S+ KAV+  C PT +++ C + + A A N+TD++EL+++AFNVT+ +IS  +KK
Sbjct  45   GNTHMASTVKAVKSFCHPTDYKKECEENVIANAGNTTDSRELIKIAFNVTVTKISDGIKK  104

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  L    K+PR   A   C++L+  SI +  R+++ +
Sbjct  105  TNLLHEVEKEPRAKMALDTCKQLMDLSIGEFDRSIEGI  142



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +   + ++
Sbjct  38   VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVTDIKNAIMNIEPIK  97

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             AA DP T +A   C+EL   +++D++ ++ ++
Sbjct  98   KAASDPYTKDALHACEELFDLAVEDLRGSVAKI  130



>ref|XP_004958780.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=565

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G+ N+  S K+V+  C+PT +++ C  +LS AA N++   EL +V F VT  +I K + +
Sbjct  36   GDDNLSMSVKSVKAFCQPTDYQQTCEAELSKAAGNASSPTELAKVIFGVTSDKIHKAISE  95

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL     D RTS A + C+E+L+ +IDD+K + D++
Sbjct  96   SATLTELKNDKRTSGALQNCKEMLEYAIDDLKSSFDKL  133



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSAATNS-TDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT +++ C   L   +N+ TD +EL+++AF+VT+ +I + ++K++ 
Sbjct  49   SVASSIKAVKTLCAPTDYKKECEDSLIEHSNNITDPRELIKIAFHVTISKIGEGLEKTEL  108

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +     DPRT EA   C++L+  SI +  R+LDR 
Sbjct  109  MHQVENDPRTKEALDTCKQLMNLSIGEFTRSLDRF  143



>tpg|DAA64233.1| TPA: pectinesterase [Zea mays]
Length=566

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G++N+  S K+V+  C+P  ++E C  +LS AA N++   +L +V F VT  +I K + +
Sbjct  35   GDENLSMSVKSVKAFCQPADYKETCEAELSKAAGNASSPSDLAKVIFKVTSDKIHKAISE  94

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+    DPRTS A   C+E+L  +ID++K + D++
Sbjct  95   SATLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKL  132



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G   + +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AFNVTMK+I+   KK
Sbjct  47   GKAEVNASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKK  106

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KD RT  A   C+EL+  ++D++  + + +
Sbjct  107  SQTIMELQKDSRTRMALDQCKELMDYALDELSNSFEEL  144



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G   + +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AFNVTMK+I+   KK
Sbjct  47   GKAEVNASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKK  106

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KD RT  A   C+EL+  ++D++  + + +
Sbjct  107  SQTIMELQKDSRTRMALDQCKELMDYALDELSNSFEEL  144



>emb|CDY08032.1| BnaC03g34910D [Brassica napus]
Length=375

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +  I  +TKAV+ VC PT ++++C+K  + A+ NST+  EL+++A NVT++ I++ +KK+
Sbjct  39   DNQIRQTTKAVKAVCAPTDYKDICLKSIMDASPNSTEPLELIKLAINVTIESINQGLKKA  98

Query  448  KTLQAAAK---DPRTSEAFKICQELLQDSIDDIKRALDR  555
             ++    K   DP   +AF++C++L+ D+IDD+K+ ++R
Sbjct  99   -SIDVKPKTDEDPEAKDAFELCEKLMFDAIDDLKKCVNR  136



>ref|NP_001151322.1| pectinesterase-1 precursor [Zea mays]
 gb|ACG42376.1| pectinesterase-1 precursor [Zea mays]
Length=567

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G++N+  S K+V+  C+P  ++E C  +LS AA N++   +L +V F VT  +I K + +
Sbjct  35   GDENLSMSVKSVKAFCQPADYKETCEAELSKAAGNASSPSDLAKVIFKVTSDKIHKAISE  94

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S TL+    DPRTS A   C+E+L  +ID++K + D++
Sbjct  95   SATLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKL  132



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            N  + +S KAV+ VC PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS
Sbjct  48   NGELAASVKAVKDVCAPTDYKKTCEDTLLKNGHNTTDPMELVKTAFSVTMKQITDAAKKS  107

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  108  QTMMDLQKDPRTRMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPR S A + C EL+ ++I+D++R+ + +
Sbjct  116  KQLEKDPRASLALEDCNELMDEAIEDLQRSFEEL  149



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  52   VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPR S A + C EL+ ++I+D++R+ + +
Sbjct  112  KQLEKDPRASLALEDCNELMDEAIEDLQRSFEEL  145



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATN--STDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            +S KA++ +C+PT +++ C+  LS A+   +TD  EL+E  F V MK ++   KKS  L+
Sbjct  59   ASMKAIKTICQPTDYKQECLDSLSYASGNTTTDPIELIEYGFKVAMKYVTDAAKKSDFLR  118

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               KDPRTS A   C+EL+  ++ +++++L R+
Sbjct  119  KLEKDPRTSNALDACEELMDLALSELRQSLVRL  151



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G   I +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AF+VTMK+I+   KK
Sbjct  47   GKGEITASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFSVTMKQITDAAKK  106

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  107  SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPR S A + C EL+ ++I+D++R+ + +
Sbjct  116  KQLEKDPRASLALEDCNELMDEAIEDLQRSFEEL  149



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K++
Sbjct  37   HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  96

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +      KD R+ +A   C++L+  SI +  R+LD +
Sbjct  97   EMFSEIEKDSRSKDALDTCKQLMHLSIGEFTRSLDGI  133



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            ++ S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K++
Sbjct  37   HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  96

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +      KD R+ +A   C++L+  SI +  R+LD +
Sbjct  97   EMFSEIEKDSRSKDALDTCKQLMHLSIGEFTRSLDGI  133



>ref|XP_010489679.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=353

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  20   GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKK  79

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  80   SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEEL  117



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 68/92 (74%), Gaps = 3/92 (3%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA  462
            +TKAV+ VC+PT  +E CV  L SA+  ST+  +L+++ F+VT+K I++ +KK S+ ++A
Sbjct  47   TTKAVQAVCEPTDFKETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASEDVKA  106

Query  463  -AAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
             A+KDP    AF++C++++ D+I+D+K+ +D 
Sbjct  107  KASKDPEAKGAFELCEKVMVDAIEDLKKCMDH  138



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            N  I +S KAV+ +C PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS
Sbjct  50   NGQITASVKAVKDICAPTDYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKS  109

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  110  QTIIDLQKDPRTRMALDQCKELMDYALGELSNSFEEL  146



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            N  I +S KAV+ +C PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS
Sbjct  50   NGQITASVKAVKDICAPTDYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKS  109

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  110  QTIIDLQKDPRTRMALDQCKELMDYALGELSNSFEEL  146



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ S+ KAV+ +C PT + + C + L A A N+TD +ELV++AFN+T+ +I   +K++  
Sbjct  52   HVASTVKAVQSLCHPTNYEKECEESLIAGAGNTTDPRELVKIAFNITITKIGDKLKETNL  111

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L    K+PR   A   C++L+  SI ++ R++D
Sbjct  112  LHDVEKEPRAKMALDTCKQLMDLSIGELSRSID  144



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPR S A + C EL+ ++I+D++R+ + +
Sbjct  116  KQLEKDPRASLALEDCNELMDEAIEDLQRSFEEL  149



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKKS  447
            N  I S+ + VE +C+ T ++E C K L  A+N T D KEL++ AFN T +E+ K +  +
Sbjct  53   NGQISSTQRNVEIICESTQYQETCHKSLDKASNETSDMKELIKAAFNATAEELIKQIHNT  112

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                  AKD  T +A  IC E+L  ++D I R++D M
Sbjct  113  TLYDELAKDNMTKQAMNICNEVLDYAVDGIHRSIDTM  149



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPR S A + C EL+ ++I+D++R+ + +
Sbjct  116  KQLEKDPRASLALEDCNELMDEAIEDLQRSFEEL  149



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KAV+ +C+PT +R+ C + L  AA N+T+ KEL+++AF +  K+I++  +KSK L
Sbjct  55   VSASVKAVKAICQPTDYRKTCEESLQKAAGNTTNPKELIKIAFKIAEKQINEASEKSKLL  114

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  +KD RT  A + C+EL+  S  ++K++L+++
Sbjct  115  EELSKDARTRGALQSCKELMNMSAGELKQSLNKV  148



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA  462
            +TKAV+ VC PT  +E CV  L SA+  ST+  +L+++ F+VT+K I++ +KK S+ ++A
Sbjct  47   TTKAVQAVCAPTDFKETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASEDVKA  106

Query  463  -AAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
             A+KDP    AF++C++++ D+I+D+K+ +D 
Sbjct  107  KASKDPEAKGAFELCEKVMVDAIEDLKKCMDH  138



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT +++ C   L   A+N TD +EL+++AF+VT+ +I + ++K++ 
Sbjct  48   HVASSMKAVKTLCAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQL  107

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +     DP T EA   C++L+  SI +  R+LD+
Sbjct  108  MHEVENDPITKEALDTCKQLMNLSIGEFTRSLDK  141



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +  I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TMK+I+   KKS
Sbjct  48   DAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKS  107

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  108  QTMMELQKDPRTKMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPR S A + C EL+ ++I+D++R+ + +
Sbjct  116  KQLEKDPRASLALEDCNELMDEAIEDLQRSFEEL  149



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT +++ C   L   A+N TD +EL+++AF+VT+ +I + ++K++ 
Sbjct  27   HVASSMKAVKTLCAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQL  86

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +     DP T EA   C++L+  SI +  R+LD+
Sbjct  87   MHEVENDPITKEALDTCKQLMNLSIGEFTRSLDK  120



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KA++ VC PT +++ C   L   A N++D  ELV+ AFN TMK+IS V KKS+T+
Sbjct  52   ITASVKAIKDVCAPTDYKKTCEDTLKKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTM  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                KDPRT  A   C+EL+  ++ ++ ++ + +
Sbjct  112  IDLQKDPRTKMALDQCKELMDYAVGELSKSFEEL  145



>emb|CDY40720.1| BnaC03g34360D [Brassica napus]
Length=193

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TM++IS   KKS+T+
Sbjct  51   ITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPIELVKTAFSATMRQISAAAKKSQTI  110

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  111  MELQKDPRTKMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +  I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TMK+I+   KKS
Sbjct  48   DAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKS  107

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  108  QTMMELQKDPRTKMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 64/92 (70%), Gaps = 3/92 (3%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA  462
            +TKAV+ VC PT  +E CV  L SA+  S +  +L+++ F+VT+K I++ +KK S  ++A
Sbjct  47   TTKAVQAVCAPTDFKETCVNSLMSASPKSAEPLDLIKLGFDVTIKSINEGLKKASGDIKA  106

Query  463  -AAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
             A KDP    AF++C++L+ D+I+D+K+ +D 
Sbjct  107  KAGKDPDAKGAFELCEKLMVDAIEDLKKCMDH  138



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            +K + +STK+V+ +C+PT +++ C K LS A N +D K+ ++VAF  T+ E+  ++K  +
Sbjct  35   SKGLATSTKSVQSMCQPTPYKQTCEKTLSIAKNVSDPKDYIKVAFEATVTELKNIIKSIE  94

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             ++ AA DP T +A   C++L   + +D++ ++ ++
Sbjct  95   PIKKAASDPYTKDALLACEQLFDLAAEDLRTSITKI  130



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            +  I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TMK+I+   KKS
Sbjct  48   DAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKS  107

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  108  QTMMELQKDPRTKMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT-  453
            I ++TKAV+ VC PT  ++ CV  L  A+ NST+  +L++++F+VT++ I   +K+S T 
Sbjct  43   IKTTTKAVQAVCSPTDFKDTCVNSLMEASPNSTEPLDLIKLSFDVTIRSIKDGIKRSSTE  102

Query  454  LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L+A AAKD  T  A ++C+ L+ D+ DD+K+  D  
Sbjct  103  LKAKAAKDEETKGALELCENLMNDATDDLKKCFDNF  138



>gb|EYU40534.1| hypothetical protein MIMGU_mgv11b016088mg, partial [Erythranthe 
guttata]
Length=152

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            ++ SS KA+  +C+ T +++ C+  L A  NST+ K+L+EVAF   +  I++  + S TL
Sbjct  41   DVSSSQKAISSICETTDYQQTCMNSL-AGHNSTNPKDLIEVAFQAAVNYINQAAENSSTL  99

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
            Q    DP    A ++CQ+L   +I+D++R+ 
Sbjct  100  QHLETDPMAKSALQVCQDLANRAINDLQRSF  130



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  47   GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKK  106

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  107  SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  47   GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKK  106

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S+T+    KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  107  SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEEL  144



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            +STK+V+ +C+PT +++ C K LS+A N+++ K+ ++VAF  T+ +I   +  +  +  A
Sbjct  41   TSTKSVKAMCQPTPYKQTCEKTLSSAKNASEPKDFIKVAFEATVTDIRNAIMNTDLIMQA  100

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            A DP+T +A   C+EL   +I+D++ ++ ++
Sbjct  101  ASDPKTKDALHACEELFDLAIEDLRTSVSKL  131



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  453
            I ++T AVE VC PT ++E CV  L  A+ +ST   +L+++ FNVT++ I   +KK S  
Sbjct  49   IKTTTNAVEAVCAPTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIKDGIKKASAE  108

Query  454  LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L+A AA D  T  A ++C++L+ D+ DD+K+ LD
Sbjct  109  LKAKAANDNETKGALELCEKLMNDATDDLKKCLD  142



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  313  CKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDPRTSEA  492
            CK   +++ C + LS A N++D +EL+++AF   +  I+ V++ S  LQ AAKDPRT +A
Sbjct  43   CKHVDYKQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQA  102

Query  493  FKICQELLQDSIDDIKRALD  552
             + C+  L  SI+D++R+ +
Sbjct  103  LETCKYALNTSIEDLQRSFE  122



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +1

Query  268  GNKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMK  441
            G++N I  +TKAV+ VC PT ++E C  ++ +A   ST+  +L++++FNVT++ I + ++
Sbjct  39   GDENEIRKTTKAVQAVCAPTDYKETCFDRMMNAEPESTEPLDLIKLSFNVTIQSIHESLQ  98

Query  442  K-SKTLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            K S+ ++A A+K+P    AF++C+ ++ D+IDD++++ DR
Sbjct  99   KASEDVKARASKNPAAKGAFQLCEHVMLDAIDDLRKSFDR  138



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA  462
            +TKAV+ VC PT  +E CV  L +A+  ST+  +L++++F+VT+K I++ +KK S  ++A
Sbjct  47   TTKAVQAVCAPTDFKETCVNSLMNASPKSTEPMDLIKLSFDVTIKSINEGLKKASGDVKA  106

Query  463  -AAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
             A+KDP    AF++C++++ D+I+D+K+ +D 
Sbjct  107  KASKDPEAKGAFELCEKVMVDAIEDLKKCMDH  138



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  468
            S KA + +C    ++  C K LS A +S++ +EL++VAFN  + +I + +K S   + AA
Sbjct  34   SNKAAQALCTSVDYKITCEKSLSDA-HSSNPQELIKVAFNHAITDIQEAIKNSTLYKQAA  92

Query  469  KDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             D RT  A ++C+E+L  SIDD++R+ DR+
Sbjct  93   TDHRTKGALEVCEEVLDTSIDDLRRSFDRV  122



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KA++ VC PT +++ C   L   A +++D  ELV  AFN TMK+IS V KKS T+
Sbjct  49   ITASVKAIKDVCAPTDYKKTCEDTLRKDAKDTSDPLELVRTAFNATMKQISNVAKKSLTM  108

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                KDPRT  A   C EL+  +I ++ ++ D +
Sbjct  109  IELQKDPRTKMALDQCTELMDFAIGELSKSFDEL  142



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AF+ TMK+I+ V KKS+T+
Sbjct  51   ITASVKAVKDVCAPTDYRKTCEDTLIQNGQNTTDPMELVKTAFSATMKQITDVAKKSQTM  110

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                KDPRT  A   C EL+  ++ ++  + + +
Sbjct  111  MELQKDPRTRMALDQCTELMDYALGELSSSFEEL  144



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K+++  C+P  +RE C K L +AA N+T   +L +  F VT   I K +++S  L
Sbjct  39   MSTSVKSIKSFCQPVDYRETCEKALRAAAGNATSPTDLAKAIFKVTSDRIEKAVRESAVL  98

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 DPRT  A   C+ELL  +IDD+K   DR+
Sbjct  99   NELKNDPRTKGALDNCRELLDYAIDDLKTTFDRL  132



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K+++  C+P  ++E C + L A A N+T   +L +V F VT   I K  ++S  L
Sbjct  37   MSTSVKSIKSFCQPVDYKETCERALEATAGNATSPTDLAKVIFKVTSDRIEKAARESAVL  96

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 DPRTS A + C+ELL  +IDD+K   DR+
Sbjct  97   NDLKNDPRTSGALRNCKELLDYAIDDLKTTFDRL  130



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L A A N+TD KELV++ FN+T+ +I   +K++  
Sbjct  56   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  115

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L    ++PR   A   C++L+  SI ++ R+LD
Sbjct  116  LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLD  148



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/90 (38%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            SS KAV+ +C PT +++ C + L A A N+TD KEL+++ FN+T+ +I   +K++  L  
Sbjct  54   SSIKAVQTLCHPTNYKKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHE  113

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALD  552
              ++PR   A + C++L+  SI ++ R+LD
Sbjct  114  VEEEPRAKMALETCKQLMDLSIGELTRSLD  143



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L A A N+TD KELV++ FN+T+ +I   +K++  
Sbjct  51   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L    ++PR   A   C++L+  SI ++ R+LD
Sbjct  111  LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLD  143



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I  +TKAV+ VC PT  +E CV  L +A+  ST+  +L+++ FNVT+K I++ ++K
Sbjct  38   NENEIRKNTKAVKAVCAPTDFKETCVNSLMNASPKSTEPLDLIKLGFNVTIKSINEALQK  97

Query  445  -SKTLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDR  555
             S+ ++A A K P    AF++C++L+ D+IDD+++ +D 
Sbjct  98   ASRDVKAKADKAPEAKGAFELCEKLMTDAIDDLQKCVDH  136



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L    ++PR   A   C++L+  SI ++ R+LD
Sbjct  111  LHEVEEEPRAKMALDTCKQLMDLSIGELTRSLD  143



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            + I +S KA++ VC PT +++ C   L   A +++D  ELV   FNVTMK+I+ V +KS+
Sbjct  34   EEITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAGFNVTMKQITNVARKSQ  93

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
            T+    KDPRT  A   C+EL+  +I ++  + 
Sbjct  94   TMIELQKDPRTKMALDQCKELMDYAIGELSNSF  126



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  450
            +I  +TKAV+ VC PT  ++ CV  L  A+ +S +  +L+++ FN+T+K I++ +KK S 
Sbjct  43   HIKKTTKAVQAVCAPTDFKDTCVNSLMGASPSSAEPLDLIKLGFNITIKSINESLKKASG  102

Query  451  TLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDR  555
             ++A A K+P    AF++C++L+ D+IDD+K+ +D 
Sbjct  103  DVKAKADKNPEAKGAFELCEKLMIDAIDDLKKCMDH  138



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L    ++PR   A   C++L+  SI ++ R+LD
Sbjct  111  LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLD  143



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            L    ++PR   A   C++L+  SI ++ R+LD
Sbjct  111  LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLD  143



>ref|XP_003557034.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=402

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L + A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L    ++PR   A   C++L+  SI ++ R+LD +
Sbjct  111  LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGI  145



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L + A N+TD KELV++ FN+T+ +I   +K++  
Sbjct  27   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  86

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L    ++PR   A   C++L+  SI ++ R+LD +
Sbjct  87   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGI  121



>gb|EMS65303.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=360

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S K+V+  C+P  ++E C  +L+    N+T   EL +  F VT ++I K + +S TL+ 
Sbjct  77   TSVKSVKAFCQPMDYKETCETELTKVGGNATSPTELAKAIFEVTSEKIRKAISESATLEE  136

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               DPRTS A + C+ELL+ +I+D+K   DR+
Sbjct  137  LKSDPRTSGALENCKELLEYAIEDLKTTFDRL  168



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +1

Query  271  NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
             +++ +S KA+E +C+ T ++  CV+ L S+A  S+D KEL++ +F VTM++I + ++ S
Sbjct  40   GQDVTTSQKAIESICQTTRYQHTCVESLESSAEGSSDPKELIQKSFQVTMEKIKEAIENS  99

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKR  543
              LQ   KDPR   A + CQ+L   +++D+ R
Sbjct  100  TMLQKLEKDPRAKLALENCQKLAWQAVNDLNR  131



>ref|XP_006578909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Glycine max]
Length=581

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL--SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  450
            ++G  T+A+   C  T  + +C+K L     +     K+LV ++FNVT++  SK +  S 
Sbjct  62   SLGKFTQAISRTCSKTRFKMLCMKSLLDFPGSQGASEKDLVHISFNVTLQHFSKALYSSA  121

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            T+   A DPR   A+  C ELL DS+D + R+L+
Sbjct  122  TISYTAMDPRVRAAYHDCLELLDDSVDALARSLN  155



>gb|KHN04169.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=494

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            ++ SS KAV+ +C PT + + C + L + A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  27   HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  86

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L    ++PR   A   C++L+  SI ++ R+LD +
Sbjct  87   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGI  121



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 57/91 (63%), Gaps = 1/91 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KA++ VC PT +++ C   L   A +++D  ELV  AFNVTMK+I+ V +KS+T+
Sbjct  50   ITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQTM  109

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
                KDPRT  A   C+EL+  +I ++  + 
Sbjct  110  IELQKDPRTKMALDQCKELMDYAIGELSNSF  140



>ref|XP_003526711.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Glycine max]
Length=584

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL--SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            +G  T+A+   C  T  + +CVK L     +     K+LV ++FNVT++  SK +  S  
Sbjct  66   LGKPTQAISRTCSKTRFKTLCVKSLLDFPGSEEASEKDLVHISFNVTLQHFSKALYSSAA  125

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            +   A DPR   A+  C ELL DS+D + R+L+
Sbjct  126  MSYTAMDPRVRAAYDDCLELLDDSVDALARSLN  158



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 57/91 (63%), Gaps = 1/91 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I +S KA++ VC PT +++ C   L   A +++D  ELV  AFNVTMK+I+ V +KS+T+
Sbjct  50   ITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQTM  109

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
                KDPRT  A   C+EL+  +I ++  + 
Sbjct  110  IELQKDPRTKMALDQCKELMDYAIGELSNSF  140



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT-  453
            I ++T AVE VC PT ++E CV  L  A+ +ST   +L+++ FNVT++ I   +KK+   
Sbjct  48   IKTATTAVEAVCAPTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIEDSIKKASVE  107

Query  454  LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            L A AA D  T  A ++C++L+ D+ DD+K+ LD  
Sbjct  108  LTAKAANDKDTKGALELCEKLMNDATDDLKKCLDNF  143



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K+++  C+P  +RE C   L   A N+T+  +L +  F  T + I K +++S  L
Sbjct  39   LSTSVKSIKSFCQPVDYRETCETTLEQTAGNATNPTDLAKAIFKATSERIEKAVRESAVL  98

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 DPRTS+A K C+ELL  +IDD+K   D++
Sbjct  99   NDLKNDPRTSDALKDCEELLDYAIDDLKTTFDKL  132



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K+++  C+P  +RE C K L AA  N+T   EL +  F VT   I+K +++S  L
Sbjct  39   MSTSVKSIKSFCQPVDYRETCEKALEAAAGNATSPTELAKAIFKVTSDRIAKAVRESALL  98

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 D RTS A   C ELL  +IDD++   DR+
Sbjct  99   NELKHDRRTSGALHNCGELLDYAIDDLRTTFDRL  132



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            NI  ++KAVE VC PT  +E CV   + A+ NST+  +L++++FN+T++ I   +KKS  
Sbjct  47   NIKMTSKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSV  106

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               A  D  T  + ++C+ L+ D+IDD+ +  D  
Sbjct  107  ELKAKADHETKGSLELCETLMNDAIDDLTKCFDNF  141



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
            NI  + KAVE VC PT  +E CV   + A+ NST+  +L++++FN+T++ I   +KKS  
Sbjct  47   NIKMTNKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSV  106

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               A  D  T  + ++C+ L+ D+IDD+ +  D  
Sbjct  107  ELKAKADHETKGSLELCETLMNDAIDDLTKCFDNF  141



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 63/92 (68%), Gaps = 3/92 (3%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA  462
            +TKAV+ VC PT  ++ CV  L  A+ +S D  +L+++ F VT+K I++ ++K S  ++A
Sbjct  47   TTKAVQAVCAPTDFKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKA  106

Query  463  AA-KDPRTSEAFKICQELLQDSIDDIKRALDR  555
             A K+P    AF++C++L+ D+IDD+K+ +D 
Sbjct  107  EADKNPEAKGAFELCEKLMIDAIDDLKKCMDH  138



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 63/92 (68%), Gaps = 3/92 (3%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA  462
            +TKAV+ VC PT  ++ CV  L  A+ +S D  +L+++ F VT+K I++ ++K S  ++A
Sbjct  47   TTKAVQAVCAPTDFKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKA  106

Query  463  AA-KDPRTSEAFKICQELLQDSIDDIKRALDR  555
             A K+P    AF++C++L+ D+IDD+K+ +D 
Sbjct  107  KADKNPEAKGAFELCEKLMIDAIDDLKKCMDH  138



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  450
            +I  +TKAV+ VC PT  ++ CV  L  A+ +S D  +L+++ F VT+K I++ ++K S 
Sbjct  43   HIRKTTKAVQAVCAPTDFKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASG  102

Query  451  TLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDR  555
             ++A A K+P    AF++C++L+ D+IDD+K+ +D 
Sbjct  103  DIKAKADKNPEAKGAFELCEKLMIDAIDDLKKCMDH  138



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLSAAT--NSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            +S KA++ +C+PT +++ C+  LS A+   +TD  +L+   F V MK +    KKS  L+
Sbjct  59   ASMKAIKAICQPTDYKQECLDSLSYASGNTTTDPVQLIGYGFKVAMKYVYDAAKKSDFLR  118

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               KDPRTS A   C+EL++ ++ +++++L R+
Sbjct  119  KLEKDPRTSNALDTCEELMELALGELRQSLVRL  151



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I S+ K+V+  C+PT +++ C + L   A N+T+ +EL+++AFNVT+K+I   +KK+  L
Sbjct  51   IASTIKSVKSFCQPTDYKKECEENLIEIAGNTTEPRELIKLAFNVTIKKIGDGIKKTNLL  110

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                K+PR   A   C++L+  SI + +R+L+ +
Sbjct  111  HEVEKEPRAKLALDTCKQLMDLSIGEFERSLEGI  144



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKS--K  450
            I ++TKAV+ VC  T ++E C+   +SA+ NST   +L+ + F++T+K I + +KK+  +
Sbjct  47   IKTTTKAVKAVCAITDYKETCINSFMSASPNSTQPLDLIRLGFDLTIKSIHEGIKKAADE  106

Query  451  TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              + AAKDP    A  +C EL+ DS DD+ +  D+ 
Sbjct  107  LKEKAAKDPEAKRALDLCHELMIDSTDDLSKCFDKF  142



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +1

Query  274  KNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  453
             ++ SS KA+  +C+ T +++ C+  L A  NST+ K+L+EVAF   +  I++  + S T
Sbjct  40   PDVSSSQKAISSICETTDYQQTCMNSL-AGHNSTNPKDLIEVAFQAAVNYINQAAENSST  98

Query  454  LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            LQ    DP    A ++CQ+L   +I+D++R+  + 
Sbjct  99   LQHLETDPMAKSALQVCQDLANRAINDLQRSFAKF  133



>ref|XP_002275819.3| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=582

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS--AATNSTDTKELVEVAFNVTMKEISKVMK  441
            GN N+ SS KAV  VC    +++ C++ LS  A   S   K+ ++ A  VTMKEI   M 
Sbjct  53   GNTNMSSSMKAVASVCATADYKDACMQTLSPVAKNGSATPKDYIQAAVQVTMKEIKSSMN  112

Query  442  KSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
             S+ L  A  D RT  A   C++LLQ +ID+++ + 
Sbjct  113  LSEKLVQATNDSRTQMALGDCKDLLQFAIDELQESF  148



>gb|EMT00807.1| Putative pectinesterase/pectinesterase inhibitor 28 [Aegilops 
tauschii]
Length=563

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDT-KELVEVAFNVTMKEISKVMKK  444
            G  N+ +S K+V+ +C PT ++E C K L++A+N T+  KE+        M+ I   +++
Sbjct  42   GEANLATSGKSVKSLCAPTLYKESCEKTLTSASNGTENPKEVFATVAKSAMESIKSAVER  101

Query  445  SKTL-QAAAKDPRTSEAFKICQELLQDSIDDIK  540
            SK++ +A + DP T  A + C+ELL+DS+DD+K
Sbjct  102  SKSIGEAKSSDPLTEGARQDCKELLEDSVDDLK  134



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 65/99 (66%), Gaps = 4/99 (4%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I  +TKAV+ VC PT ++E C+K L  A+  ST+   L++++FNVT+K I + +KK
Sbjct  38   NENEIRQNTKAVKTVCAPTDYKETCLKSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKK  97

Query  445  SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +       A K P   +AF++C++++ D+I D+K+ +D 
Sbjct  98   ASEDVKHKADKHPEAKDAFELCEKVMNDAIADLKKCVDH  136



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 65/99 (66%), Gaps = 4/99 (4%)
 Frame = +1

Query  271  NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  444
            N+N I  +TKAV+ VC PT ++E C+K L  A+  ST+   L++++FNVT+K I + +KK
Sbjct  38   NENEIRQNTKAVKTVCAPTDYKETCLKSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKK  97

Query  445  SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDR  555
            +       A K P   +AF++C++++ D+I D+K+ +D 
Sbjct  98   ASEDVKHKADKHPEAKDAFELCEKVMNDAIADLKKCVDH  136



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            G   I  S +  + +C+   ++E C K L+ A+ ++D KEL+  AFN T +EI+  +K S
Sbjct  46   GGDTIAKSQRNQQVICESAEYKETCHKSLAKASGTSDLKELIITAFNATAEEIANQIKNS  105

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
                  A D  T +A  IC+E+L  ++DDI+R++
Sbjct  106  TLYHELATDHMTKQATDICKEVLGYAVDDIRRSV  139



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            I  S KAV+ VC PT +++ C   L     N+TD  ELV+ AF +TM +I+   KKS+T+
Sbjct  52   ITPSVKAVKDVCAPTDYKKTCEDTLIKNGKNTTDPVELVKTAFRITMNQITDAAKKSQTM  111

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +   KDPRT  A   C+EL+  ++ ++  + + +
Sbjct  112  RELQKDPRTRMALDQCKELMDYALGELSNSFEEL  145



>ref|XP_007136533.1| hypothetical protein PHAVU_009G053000g [Phaseolus vulgaris]
 gb|ESW08527.1| hypothetical protein PHAVU_009G053000g [Phaseolus vulgaris]
Length=585

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +1

Query  283  GSSTKAVEHVCKPTFHREMCVKKL--SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            G  T+A+   C  T  + +CV  L     + +   K+LV ++FNVT++  SK +  S  +
Sbjct  68   GKPTQAISSTCSKTRFQTVCVNSLLDYPGSQAASEKDLVHISFNVTLQHFSKALYTSAAI  127

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
             +A  DPR   A+  C ELL DS+D + R+L
Sbjct  128  SSATMDPRVRSAYLDCLELLDDSVDALARSL  158



>ref|XP_011462740.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=593

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 58/99 (59%), Gaps = 2/99 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS--AATNSTDTKELVEVAFNVTMKEISKVMK  441
            G+KN   ++K +  +C+PT +++ C K L   A  +  D ++L  V   V + ++ +V+K
Sbjct  56   GDKNASHTSKTIVAICEPTNYKQECEKSLENEATGDKKDPQDLARVGIQVAISKLDEVLK  115

Query  442  KSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
             S  L+   KDP T EA  IC++LL  S+ D+K + ++M
Sbjct  116  NSTLLKNKGKDPMTQEALSICRQLLNASMYDLKISYNKM  154



>ref|XP_006658993.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=567

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +1

Query  289  STKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  465
            S K+V+  C+PT +++ C  +L+ AA N +   +L +  F VT ++ISK + +S TL+  
Sbjct  44   SVKSVKAFCQPTDYQQTCEAELTQAAANGSSPTDLAKAIFAVTSEKISKAISESATLEEL  103

Query  466  AKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
              D RTS A + C+ELL+ +++D+K + D++
Sbjct  104  RNDQRTSGALQNCKELLEYAVEDLKTSFDKL  134



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKK  444
            G +++ +S K+++ +C+ T ++E CV  L+++ +++ D KEL+E+AF   +K+I      
Sbjct  38   GEQDVSASQKSIQTLCQNTDYQETCVNSLTSSGSNSSDPKELIEIAFQAAIKQIRDAANN  97

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S       KDPR  EA + C+EL   +I+D++R+ D+ 
Sbjct  98   STVFHEVEKDPRGKEALESCRELADRAINDLQRSFDKF  135



>emb|CAN67129.1| hypothetical protein VITISV_040170 [Vitis vinifera]
Length=1542

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLS--AATNSTDTKELVEVAFNVTMKEISKVMK  441
            GN N+ SS KAV  VC    +++ C++ LS  A   S   K+ ++ A  VTMKEI   M 
Sbjct  36   GNTNMSSSMKAVASVCATADYKDACMQTLSPVAKNGSATPKDYIQAAVQVTMKEIKSSMN  95

Query  442  KSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
             S+ L  A  D RT  A   C++LLQ +ID+++ + 
Sbjct  96   LSEKLVQATNDSRTQMALGDCKDLLQFAIDELQESF  131


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAAT---NSTDTKELVEVAFNVTMKEISKVM  438
            G+ N+ SS KAV  VC    +++ C++ LS      +S   K+ ++ A  VT+K+I   M
Sbjct  566  GDTNMSSSMKAVASVCATADYKDACMQTLSPVPKNGSSATPKDYIQAAVQVTIKQIKSSM  625

Query  439  KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRAL  549
              S+ L  A  D RT  A   C++LLQ +ID+++ + 
Sbjct  626  NLSEKLFQATNDSRTQMALGDCKDLLQFAIDELQESF  662



>ref|XP_006652375.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Oryza brachyantha]
Length=568

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDT-KELVEVAFNVTMKEISKVMKK  444
            G  ++ +S K+V+ +C PT ++E C K L+ A+N T+  +E+      V ++ I   +++
Sbjct  41   GEASLATSGKSVKSLCAPTLYKESCEKTLTTASNGTENPREVFTAVAKVALESIKSAVER  100

Query  445  SKTLQAA-AKDPRTSEAFKICQELLQDSIDDIK  540
            SK + +A + DP T  A + C+ELL+DS+DD++
Sbjct  101  SKDIGSAKSSDPMTEGAREDCKELLEDSVDDLR  133



>gb|EMT00224.1| Putative pectinesterase/pectinesterase inhibitor 21 [Aegilops 
tauschii]
Length=543

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S K+++  C+P  ++  C K L   A N+T T EL +  F  T + I K +++S  L  
Sbjct  40   TSMKSIKSFCQPVDYKAACEKTLGETAGNATTTTELAKAIFKATSERIEKAVQESSLLNE  99

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               DPRTS A K C+E+L  +IDD+K   D++
Sbjct  100  LKHDPRTSGALKNCKEMLHYAIDDLKTTFDQL  131



>gb|EMS57827.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=481

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +S K+++  C+P  ++  C K L   A N+T T EL +  F  T + I K +++S  L
Sbjct  38   LATSVKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVQESSLL  97

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                 DPRTS A K C+E+L  +IDD+K   D++
Sbjct  98   NELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQL  131



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/98 (34%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  444
            G+  + +S K+++  C+P  +RE C   L A A N+++  +L +  F  T ++I + +++
Sbjct  35   GDGELSTSVKSIKSFCQPVDYRETCESTLEASAGNASNPTDLAKAIFKATSEKIEQAVRE  94

Query  445  SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            S  L     D RTS A K C+ELL  +IDD+K   D++
Sbjct  95   STVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKL  132



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  456
            + +STK+++ +C+PT +++ C   L+ AA N++D  +LV+  F V +  +   ++ S TL
Sbjct  61   LSTSTKSIQAICQPTDYKQTCEDSLNKAAGNTSDPHKLVQAGFQVAIDALKVAIENSTTL  120

Query  457  QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
            +  AKDP   +A   C+EL+  +I D+K +  ++
Sbjct  121  KEVAKDPMAKQALDNCKELMNTAISDLKTSFQQV  154



>ref|XP_003579894.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=563

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDT-KELVEVAFNVTMKEISKVMKK  444
            G   + +S K+V+ +C PT ++E C K L++A+N T+  KE+        M+ I   +++
Sbjct  41   GEATLATSGKSVKSLCAPTLYKESCEKTLTSASNGTENPKEVFSTVAKTAMESIKSAVER  100

Query  445  SKTL-QAAAKDPRTSEAFKICQELLQDSIDDIK  540
            SK++ +A + DP T  A + C+ELL+DS+DD+K
Sbjct  101  SKSIGEAKSSDPLTEGARQDCKELLEDSVDDLK  133



>gb|EMS49616.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=563

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDT-KELVEVAFNVTMKEISKVMKK  444
            G  N+ +S K+V+ +C PT ++E C K L++A+N T+  KE+        M+ I   +++
Sbjct  42   GEANLATSGKSVKSLCAPTLYKESCEKTLTSASNGTENPKEVFATVAKSAMESIKSAVER  101

Query  445  SKTL-QAAAKDPRTSEAFKICQELLQDSIDDIK  540
            SK++ +  + DP T  A + C+ELL+DS+DD+K
Sbjct  102  SKSIGEVKSSDPLTEGARQDCKELLEDSVDDLK  134



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +1

Query  286  SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  462
            +S K+++  C+P  ++  C K L   A N+T T EL +  F  T + I K +++S  L  
Sbjct  40   TSLKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVRESSLLND  99

Query  463  AAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               DPRTS A K C+ELL  +IDD+K   D++
Sbjct  100  LKHDPRTSGALKNCKELLHYAIDDLKTTFDQL  131



>tpg|DAA37472.1| TPA: hypothetical protein ZEAMMB73_350063 [Zea mays]
Length=562

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDT-KELVEVAFNVTMKEISKVMKK  444
            G  +I +S K+VE +C PT ++E C K LS ATN T+  KE+      V ++ +   +++
Sbjct  40   GEASIATSGKSVESLCAPTLYKESCEKTLSQATNGTENPKEVFHSVAKVALESVKTAVEQ  99

Query  445  SKTL-QAAAKDPRTSEAFKICQELLQDSIDDIKRALD  552
            SKT+ +A A D  T  A + C++LL+D++DD++  L+
Sbjct  100  SKTIGEAKASDSMTESAREDCKKLLEDAVDDLRGMLE  136



>gb|KEH37214.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=376

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  459
            I +S K V+ +C+ T ++E C K L  A+ STDTKEL++ AF+ T +E+ K +  S   Q
Sbjct  49   ISNSQKNVDMLCQSTEYKETCHKSLENAS-STDTKELIKAAFSATAEELRKHINNSALYQ  107

Query  460  AAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
               KD  T +A +IC E+L  ++D I +++  +
Sbjct  108  ELGKDSMTKQAMEICNEVLDYAVDGIHKSVGTL  140



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  277  NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  450
            +I ++TKA+  VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S 
Sbjct  47   HIQATTKAIRAVCAPTDYKETCVDSLMHASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  451  TLQA-AAKDPRTSEAFKICQELLQDSIDDIKRAL  549
             L+A AA D  T  A  +C++L+ D+ DD+++ L
Sbjct  107  ELKAKAANDNETKGALDLCEKLMTDATDDLEKCL  140



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  280  IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  453
            I ++TKA+  VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S  
Sbjct  48   IKATTKAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASGE  107

Query  454  LQA-AAKDPRTSEAFKICQELLQDSIDDIKRAL  549
            L+A AA D  T  A  +C++L+ D+ DD+++ L
Sbjct  108  LKAKAANDNETKGALDLCEKLMTDATDDLEKCL  140



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = +1

Query  268  GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  447
            G   I  S +  + +C+   ++E C K L+ A+ ++D KEL+  AFN T +EI+  +K S
Sbjct  19   GGDTIAKSQRNQQVICESAEYKETCHKSLAKASGTSDLKELIITAFNATAEEIANQIKNS  78

Query  448  KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM  558
                  A D  T +A  IC+E+L  ++DDI+R++  +
Sbjct  79   TLYHELATDHMTKQATDICKEVLGYAVDDIRRSVHTL  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840