BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016B14

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  70.5    7e-11   Nicotiana tomentosiformis
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  65.9    2e-09   Solanum tuberosum [potatoes]
emb|CDX92008.1|  BnaC03g33100D                                        62.0    1e-08   
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  62.8    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg           62.4    3e-08   
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  62.4    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002884331.1|  tRNA synthetase class I family protein           62.0    4e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  62.0    4e-08   Solanum lycopersicum
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  60.8    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  60.8    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  58.2    8e-07   Brassica rapa
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  57.0    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  57.0    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  57.0    2e-06   Fragaria vesca subsp. vesca
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  57.0    2e-06   Brassica rapa
emb|CDX74240.1|  BnaA03g28070D                                        57.0    2e-06   
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.6    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.6    2e-06   Brassica rapa
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.6    2e-06   Pyrus x bretschneideri [bai li]
ref|NP_186915.1|  tyrosyl-tRNA synthetase                             56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.6    2e-06   Nicotiana sylvestris
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.2    3e-06   
ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.2    3e-06   Nicotiana tomentosiformis
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  55.8    4e-06   Prunus mume [ume]
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg           55.8    4e-06   Prunus persica
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.7    1e-05   
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.7    1e-05   
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.3    1e-05   
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.3    1e-05   Fragaria vesca subsp. vesca
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.3    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.3    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg           52.4    5e-05   Eutrema salsugineum [saltwater cress]
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  52.4    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                52.0    9e-05   
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  50.1    3e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                 50.1    4e-04   Citrus sinensis [apfelsine]
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  49.7    4e-04   Citrus sinensis [apfelsine]



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  ARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKS  433
            A   ++RTF+LN   + F+  F++   +          SL  +S  P CS +  +   + 
Sbjct  3    AGAGAIRTFLLNATQKPFTSSFLKNISLPTCLFLHNCLSLRSFSHRPFCSISTQLTSQED  62

Query  434  EPEMESDQ---RQRRRNVVEILEERGLLESVTSENLRSICSDPNL  559
             P+ E+ Q   ++ R NV++ILEERGLLESVT+++LRS+CSDPNL
Sbjct  63   TPQPENFQHSNKKTRPNVLQILEERGLLESVTNDSLRSVCSDPNL  107



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +2

Query  263  ASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKSEPE  442
            + +R+ +LN   R F+  F++K P+          S   +S  P CS +   P   S+ +
Sbjct  12   SGLRSLLLNTTLRPFTSSFLRKLPLPTYLFLPNTPSHHNFSHRPFCSIS---PLTTSQED  68

Query  443  MESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNL  559
              S+   + R NV+ ILEERGLLESVTS++LRS+CSDPNL
Sbjct  69   NFSNPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNL  108



>emb|CDX92008.1| BnaC03g33100D [Brassica napus]
Length=262

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 42/63 (67%), Gaps = 7/63 (11%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S +PL SS +F     S   +E+     R NVV+ILEERGLLESVTSENLRS CSDP
Sbjct  49   FSTSRAPLFSSVKF-----STSSLET--AASRSNVVDILEERGLLESVTSENLRSACSDP  101

Query  554  NLP  562
            N+ 
Sbjct  102  NVA  104



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  S Q   R NVV+ILEERGLLES+TS NLRS CSDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVS-QAVSRPNVVDILEERGLLESITSNNLRSACSDP  110

Query  554  NL  559
             +
Sbjct  111  KV  112



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL S  +   Q  S P+ E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  89   FSTSTTPLFSYVKCSVQSTSTPQTE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  147

Query  554  NL  559
             +
Sbjct  148  KV  149



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SS +   Q  S PE  + Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   YSTSTTPLFSSVRCSVQSTSSPETLT-QAASRPNVVDILEERGLLESITSENLRSACSDP  110

Query  554  NLP  562
             + 
Sbjct  111  KVA  113



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +   Q  S  E E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   FSTSTTPLFSSVKCSIQSTSSLETE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  110

Query  554  NLP  562
             + 
Sbjct  111  KVA  113



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 59/109 (54%), Gaps = 4/109 (4%)
 Frame = +2

Query  236  CADNTNARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQF  415
             A    A  + +R+ +LN   R F+   ++  P+          S   +S  P CS +  
Sbjct  2    AAAGAGAINSGLRSLLLNTTLRPFTSSLLRILPLPTYVFLPNTPSRHNFSHRPFCSIS--  59

Query  416  IPQLKSEPEMESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNL  559
             P   S+ ++ S    + R NV+ ILEERGLLESVTS++LRS+CSDPNL
Sbjct  60   -PLPASQEDIFSKPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNL  107



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  110

Query  554  NLP  562
             + 
Sbjct  111  KVA  113



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  46   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  104

Query  554  NLP  562
             + 
Sbjct  105  KVA  107



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL     F P   S  E E  Q   R NVV+IL+ERGLLESVTSENLRS CSDP
Sbjct  52   FSTSTTPL-----FAPVKCSTLETEV-QAVSRPNVVDILQERGLLESVTSENLRSACSDP  105

Query  554  NLP  562
            N+ 
Sbjct  106  NVA  108



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNL  559
            R NVVEILEERGLLES+TSENLRS CS+PNL
Sbjct  76   RLNVVEILEERGLLESITSENLRSACSNPNL  106



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +2

Query  434  EPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNL  559
            EPE   +Q   R NVV+ILEERGLLES+TSENLRS CSDP L
Sbjct  72   EPE---NQVASRPNVVDILEERGLLESITSENLRSACSDPTL  110



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 6/67 (9%)
 Frame = +2

Query  380  YSSSPLCSSAQF-IPQLKSEPEMESDQR-----QRRRNVVEILEERGLLESVTSENLRSI  541
            Y S PLC  + F +P+    P + S  +       R+NVV+ILEERGLLES+TSE LR  
Sbjct  20   YYSLPLCVPSFFRVPRFHRNPILLSAVKCLQSSSGRQNVVDILEERGLLESLTSEQLRHA  79

Query  542  CSDPNLP  562
            CSDP++P
Sbjct  80   CSDPSIP  86



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  554  NLP  562
            N+ 
Sbjct  103  NVA  105



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  554  NLP  562
            N+ 
Sbjct  103  NVA  105



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R NVVEILEERGLLESVTSE+LR  CSDPNLP
Sbjct  58   RPNVVEILEERGLLESVTSEHLRQSCSDPNLP  89



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  70   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  122

Query  554  NLP  562
            N+ 
Sbjct  123  NVA  125



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R NVVEILEERGLLESVTSE+LR  CSDPNLP
Sbjct  62   RPNVVEILEERGLLESVTSEHLRQSCSDPNLP  93



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  431  SEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNL  559
            S PE E +Q   R NVV+ILEERGLLES+TSENLRS CSDP +
Sbjct  71   SSPETE-NQAVFRPNVVDILEERGLLESITSENLRSACSDPKV  112



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  550
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNSNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  551  PNL  559
             NL
Sbjct  106  SNL  108



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R NVVEILEERGLLES+TSE+LR  CSDPNLP
Sbjct  58   RPNVVEILEERGLLESITSEHLRQSCSDPNLP  89



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  550
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNNNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  551  PNL  559
             N 
Sbjct  106  SNF  108



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R+NVVEILEERGLLES+TSE+LR  CSDP+LP
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLP  91



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R+NVVEILEERGLLES+TSE+LR  CSDP+LP
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLP  91



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNL  559
            R NVVEILEERGLLES+TSE+LR +C+DPNL
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCTDPNL  92



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNL  559
            R NVVEILEERGLLES+TSE+LR +C+DPNL
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNL  88



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNL  559
            R NVVEILEERGLLES+TSE+LR +C+DPNL
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNL  88



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            RR NV++ILEERGLLES+TSE LR  CSDP++P
Sbjct  59   RRHNVIDILEERGLLESMTSEQLRHACSDPSVP  91



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R NVVEILEERGLLES+TSE+LR +CSDP LP
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCSDPILP  93



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLP  562
            R NVVEILEERGLLES+TSE+LR +CSDP LP
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCSDPILP  89



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 10/63 (16%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +   Q              R NVV+ILEERGLLES+TSE+LRS CSDP
Sbjct  52   FSASTTPLLSSVKCSIQ----------STVSRPNVVDILEERGLLESITSESLRSACSDP  101

Query  554  NLP  562
            ++ 
Sbjct  102  SVA  104



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  401  SSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            SS+Q  P+    P    D   R  NVV+IL+ERGL+ES+TSENLRS CS P
Sbjct  49   SSSQPAPETLEAPIQGLDSSTRAPNVVDILQERGLIESITSENLRSACSTP  99



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNL  559
            RR+NVV+ILEERGLLESVTS+NLRS CS   L
Sbjct  63   RRQNVVDILEERGLLESVTSDNLRSACSISTL  94



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICS-DPNLP  562
            +QR RNVVEILEERGL+ES+TS+NLRS  S D N P
Sbjct  68   QQRSRNVVEILEERGLIESITSDNLRSASSLDNNHP  103



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICS  547
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S
Sbjct  45   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS  96



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICS  547
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S
Sbjct  43   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920