BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016A21

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06456.1|  unnamed protein product                                228   2e-67   Coffea canephora [robusta coffee]
ref|XP_006363624.1|  PREDICTED: pyruvate decarboxylase 1-like           227   3e-67   Solanum tuberosum [potatoes]
ref|XP_011095042.1|  PREDICTED: pyruvate decarboxylase 1                224   6e-66   Sesamum indicum [beniseed]
ref|XP_004249069.1|  PREDICTED: pyruvate decarboxylase 1-like           223   8e-66   Solanum lycopersicum
ref|XP_006286440.1|  hypothetical protein CARUB_v10003893mg             223   2e-65   Capsella rubella
ref|XP_009769363.1|  PREDICTED: pyruvate decarboxylase 1-like           223   2e-65   Nicotiana sylvestris
ref|XP_009622836.1|  PREDICTED: pyruvate decarboxylase 1-like           222   3e-65   Nicotiana tomentosiformis
ref|XP_010447294.1|  PREDICTED: pyruvate decarboxylase 1-like           222   4e-65   Camelina sativa [gold-of-pleasure]
gb|KFK24633.1|  hypothetical protein AALP_AA8G005000                    222   4e-65   Arabis alpina [alpine rockcress]
ref|XP_006363625.1|  PREDICTED: pyruvate decarboxylase 1-like           221   6e-65   Solanum tuberosum [potatoes]
dbj|BAC23043.1|  pyruvate decarboxylase                                 221   6e-65   Solanum tuberosum [potatoes]
ref|XP_010553236.1|  PREDICTED: pyruvate decarboxylase 2-like           221   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_010253807.1|  PREDICTED: pyruvate decarboxylase 2-like           221   1e-64   Nelumbo nucifera [Indian lotus]
gb|KDO56720.1|  hypothetical protein CISIN_1g044559mg                   220   1e-64   Citrus sinensis [apfelsine]
ref|XP_006429440.1|  hypothetical protein CICLE_v10011317mg             220   1e-64   Citrus clementina [clementine]
gb|EYU41928.1|  hypothetical protein MIMGU_mgv1a003147mg                220   2e-64   Erythranthe guttata [common monkey flower]
emb|CDY66930.1|  BnaCnng52860D                                          220   2e-64   Brassica napus [oilseed rape]
gb|AGA15799.1|  pyruvate decarboxylase 5                                208   2e-64   Diospyros kaki [Japanese persimmon]
ref|XP_009125425.1|  PREDICTED: pyruvate decarboxylase 4                219   2e-64   Brassica rapa
ref|XP_007026637.1|  Thiamine pyrophosphate dependent pyruvate de...    216   3e-64   
ref|XP_010920798.1|  PREDICTED: pyruvate decarboxylase 1                219   5e-64   Elaeis guineensis
ref|XP_010092799.1|  Pyruvate decarboxylase isozyme 2                   218   6e-64   Morus notabilis
ref|XP_006429441.1|  hypothetical protein CICLE_v10011317mg             216   7e-64   
ref|XP_002870931.1|  hypothetical protein ARALYDRAFT_486945             218   8e-64   
gb|KJB36955.1|  hypothetical protein B456_006G184000                    217   1e-63   Gossypium raimondii
ref|XP_009385546.1|  PREDICTED: pyruvate decarboxylase 1-like           218   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006362373.1|  PREDICTED: pyruvate decarboxylase 2-like           218   1e-63   Solanum tuberosum [potatoes]
ref|XP_011094440.1|  PREDICTED: pyruvate decarboxylase 1-like           218   2e-63   Sesamum indicum [beniseed]
sp|A2XFI3.2|PDC2_ORYSI  RecName: Full=Pyruvate decarboxylase 2; S...    217   2e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001049811.1|  Os03g0293500                                       217   2e-63   
ref|XP_010423945.1|  PREDICTED: pyruvate decarboxylase 4                217   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006283364.1|  hypothetical protein CARUB_v10004406mg             217   3e-63   Capsella rubella
gb|KJB36954.1|  hypothetical protein B456_006G184000                    217   3e-63   Gossypium raimondii
ref|XP_006281555.1|  hypothetical protein CARUB_v10027657mg             217   3e-63   Capsella rubella
ref|XP_002867205.1|  hypothetical protein ARALYDRAFT_491381             217   3e-63   
ref|XP_010432620.1|  PREDICTED: pyruvate decarboxylase 1-like           216   4e-63   Camelina sativa [gold-of-pleasure]
gb|KJB36951.1|  hypothetical protein B456_006G183900                    216   4e-63   Gossypium raimondii
gb|KFK27091.1|  hypothetical protein AALP_AA8G333000                    216   4e-63   Arabis alpina [alpine rockcress]
ref|XP_010033739.1|  PREDICTED: pyruvate decarboxylase 1                216   5e-63   Eucalyptus grandis [rose gum]
ref|XP_010264586.1|  PREDICTED: pyruvate decarboxylase 2                216   5e-63   Nelumbo nucifera [Indian lotus]
emb|CDY17293.1|  BnaA10g09270D                                          216   5e-63   Brassica napus [oilseed rape]
gb|AAL99745.1|  pyruvate decarboxylase                                  216   6e-63   Zea mays [maize]
ref|XP_009120024.1|  PREDICTED: pyruvate decarboxylase 2                216   6e-63   Brassica rapa
ref|XP_002866069.1|  pyruvate decarboxylase-2                           216   6e-63   Arabidopsis lyrata subsp. lyrata
ref|NP_001105052.1|  pyruvate decarboxylase 3                           216   6e-63   Zea mays [maize]
ref|XP_010451999.1|  PREDICTED: pyruvate decarboxylase 4-like           216   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007026634.1|  Thiamine pyrophosphate dependent pyruvate de...    216   7e-63   
ref|NP_195752.1|  pyruvate decarboxylase 4                              215   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|ACL52480.1|  unknown                                                 212   1e-62   Zea mays [maize]
ref|XP_010676788.1|  PREDICTED: pyruvate decarboxylase 2                215   1e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|AAP96920.1|  pyruvate decarboxylase                                  215   1e-62   Dianthus caryophyllus [carnation]
ref|XP_010922580.1|  PREDICTED: pyruvate decarboxylase 2-like           215   1e-62   Elaeis guineensis
dbj|BAJ94428.1|  predicted protein                                      215   2e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006398630.1|  hypothetical protein EUTSA_v10013008mg             215   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010558370.1|  PREDICTED: pyruvate decarboxylase 1-like           215   2e-62   Tarenaya hassleriana [spider flower]
tpg|DAA44862.1|  TPA: pyruvate decarboxylase3                           212   2e-62   
ref|NP_200307.1|  pyruvate decarboxylase-2                              215   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58298.1|  pyruvate decarboxylase                                  214   2e-62   Genlisea aurea
ref|XP_010482907.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     214   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_008805101.1|  PREDICTED: pyruvate decarboxylase 1-like           214   2e-62   Phoenix dactylifera
gb|AAB16855.1|  pyruvate decarboxylase                                  214   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AIL23783.1|  pyruvate decarboxylase                                  214   2e-62   Prunus serrulata
ref|XP_010437810.1|  PREDICTED: pyruvate decarboxylase 1                214   2e-62   Camelina sativa [gold-of-pleasure]
gb|EMT10366.1|  Pyruvate decarboxylase isozyme 2                        210   2e-62   
ref|XP_004246778.1|  PREDICTED: pyruvate decarboxylase 1                214   3e-62   Solanum lycopersicum
emb|CDY19880.1|  BnaC09g31460D                                          214   3e-62   Brassica napus [oilseed rape]
ref|XP_004984863.1|  PREDICTED: pyruvate decarboxylase 2-like           214   4e-62   Setaria italica
ref|XP_008775408.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     214   4e-62   Phoenix dactylifera
gb|AAG22488.1|AF195868_1  pyruvate decarboxylase 1                      213   5e-62   Vitis vinifera
ref|XP_002465414.1|  hypothetical protein SORBIDRAFT_01g038360          213   7e-62   Sorghum bicolor [broomcorn]
ref|XP_008775409.1|  PREDICTED: pyruvate decarboxylase 1 isoform X2     213   7e-62   
ref|XP_009789106.1|  PREDICTED: pyruvate decarboxylase 1                213   7e-62   Nicotiana sylvestris
dbj|BAK04101.1|  predicted protein                                      213   7e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIE47264.1|  pyruvate decarboxylase                                  213   8e-62   Hevea brasiliensis [jebe]
ref|XP_006401505.1|  hypothetical protein EUTSA_v10013010mg             213   8e-62   Eutrema salsugineum [saltwater cress]
gb|KJB36952.1|  hypothetical protein B456_006G183900                    210   9e-62   Gossypium raimondii
ref|XP_008779570.1|  PREDICTED: pyruvate decarboxylase 2-like           202   1e-61   
gb|KDP22863.1|  hypothetical protein JCGZ_00450                         213   1e-61   Jatropha curcas
ref|XP_010443084.1|  PREDICTED: pyruvate decarboxylase 2-like           213   1e-61   Camelina sativa [gold-of-pleasure]
emb|CDY69899.1|  BnaA01g37380D                                          204   1e-61   Brassica napus [oilseed rape]
ref|XP_011046856.1|  PREDICTED: pyruvate decarboxylase 2                212   1e-61   Populus euphratica
ref|XP_007208309.1|  hypothetical protein PRUPE_ppa003086mg             212   1e-61   Prunus persica
ref|NP_001055803.1|  Os05g0469600                                       212   1e-61   
ref|XP_010543216.1|  PREDICTED: pyruvate decarboxylase 1                212   2e-61   Tarenaya hassleriana [spider flower]
gb|EAY98380.1|  hypothetical protein OsI_20291                          212   2e-61   Oryza sativa Indica Group [Indian rice]
dbj|BAC20138.1|  pyruvate decarboxylase                                 212   2e-61   Oryza sativa [red rice]
gb|AAG13131.1|AF193791_1  pyruvate decarboxylase                        211   3e-61   Fragaria x ananassa
sp|A2Y5L9.1|PDC1_ORYSI  RecName: Full=Pyruvate decarboxylase 1; S...    211   3e-61   Oryza sativa Indica Group [Indian rice]
gb|AAB16854.1|  pyruvate decarboxylase                                  211   3e-61   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ79223.1|  pyruvate decarboxylase                                  211   4e-61   Prunus armeniaca
ref|XP_006350849.1|  PREDICTED: pyruvate decarboxylase 2-like           211   5e-61   Solanum tuberosum [potatoes]
ref|XP_009391704.1|  PREDICTED: pyruvate decarboxylase 1                211   5e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_195033.1|  pyruvate decarboxylase 1                              211   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958794.1|  PREDICTED: pyruvate decarboxylase 2-like           211   5e-61   Setaria italica
ref|XP_003558149.1|  PREDICTED: pyruvate decarboxylase 2                211   6e-61   Brachypodium distachyon [annual false brome]
ref|XP_010529008.1|  PREDICTED: pyruvate decarboxylase 2                211   6e-61   Tarenaya hassleriana [spider flower]
gb|KCW88160.1|  hypothetical protein EUGRSUZ_A00549                     211   7e-61   Eucalyptus grandis [rose gum]
gb|KHN22554.1|  Pyruvate decarboxylase isozyme 2                        210   8e-61   Glycine soja [wild soybean]
ref|XP_010033533.1|  PREDICTED: pyruvate decarboxylase 2                210   9e-61   Eucalyptus grandis [rose gum]
ref|XP_008388854.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    207   1e-60   
ref|XP_004492473.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    210   1e-60   
ref|XP_004492472.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    210   1e-60   Cicer arietinum [garbanzo]
ref|XP_009123548.1|  PREDICTED: pyruvate decarboxylase 1-like           210   1e-60   Brassica rapa
ref|XP_009402387.1|  PREDICTED: pyruvate decarboxylase 1-like           210   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243339.1|  PREDICTED: pyruvate decarboxylase 2                210   1e-60   Prunus mume [ume]
sp|A2YQ76.2|PDC3_ORYSI  RecName: Full=Pyruvate decarboxylase 3; S...    209   1e-60   Oryza sativa Indica Group [Indian rice]
gb|AAO72533.1|  pyruvate decarboxylase 1                                209   2e-60   Lotus corniculatus
ref|XP_002322997.1|  pyruvate decarboxylase family protein              209   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009628441.1|  PREDICTED: pyruvate decarboxylase 1                209   2e-60   Nicotiana tomentosiformis
ref|XP_010040425.1|  PREDICTED: pyruvate decarboxylase 1-like           200   2e-60   Eucalyptus grandis [rose gum]
ref|XP_008362250.1|  PREDICTED: pyruvate decarboxylase 2-like           209   2e-60   
ref|XP_009399900.1|  PREDICTED: pyruvate decarboxylase 2                209   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGA15797.1|  pyruvate decarboxylase 2                                209   3e-60   Diospyros kaki [Japanese persimmon]
ref|XP_011096418.1|  PREDICTED: pyruvate decarboxylase 1                208   4e-60   Sesamum indicum [beniseed]
gb|AIE47265.1|  pyruvate decarboxylase                                  208   4e-60   Hevea brasiliensis [jebe]
ref|XP_004145248.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    208   4e-60   Cucumis sativus [cucumbers]
ref|XP_010253808.1|  PREDICTED: pyruvate decarboxylase 1                209   4e-60   Nelumbo nucifera [Indian lotus]
gb|AIE47263.1|  pyruvate decarboxylase                                  208   4e-60   Hevea brasiliensis [jebe]
emb|CDY22174.1|  BnaC01g39270D                                          200   4e-60   Brassica napus [oilseed rape]
ref|XP_004165846.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    208   5e-60   
gb|AEF33613.1|  pyruvate decarboxylase                                  208   5e-60   Salvia miltiorrhiza f. alba
ref|XP_010052217.1|  PREDICTED: pyruvate decarboxylase 1                207   6e-60   Eucalyptus grandis [rose gum]
ref|XP_002272615.1|  PREDICTED: pyruvate decarboxylase 2                208   7e-60   Vitis vinifera
gb|KJB57438.1|  hypothetical protein B456_009G164100                    203   1e-59   Gossypium raimondii
ref|XP_004302532.1|  PREDICTED: pyruvate decarboxylase 2                207   1e-59   Fragaria vesca subsp. vesca
gb|AAL37492.1|  pyruvate decarboxylase                                  207   1e-59   Fragaria x ananassa
gb|KDP21067.1|  hypothetical protein JCGZ_21538                         207   1e-59   Jatropha curcas
ref|XP_008344771.1|  PREDICTED: pyruvate decarboxylase 1-like           207   2e-59   
gb|EMT15339.1|  hypothetical protein F775_43983                         207   2e-59   
ref|NP_001284421.1|  pyruvate decarboxylase 1                           206   2e-59   Cucumis melo [Oriental melon]
gb|AIE47262.1|  pyruvate decarboxylase                                  206   2e-59   Hevea brasiliensis [jebe]
ref|XP_011019081.1|  PREDICTED: pyruvate decarboxylase 2-like           206   2e-59   Populus euphratica
gb|KCW52500.1|  hypothetical protein EUGRSUZ_J01896                     206   2e-59   Eucalyptus grandis [rose gum]
ref|XP_010323135.1|  PREDICTED: pyruvate decarboxylase 2                206   3e-59   Solanum lycopersicum
ref|XP_010034573.1|  PREDICTED: pyruvate decarboxylase 1-like           206   3e-59   Eucalyptus grandis [rose gum]
ref|XP_004134669.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    206   3e-59   Cucumis sativus [cucumbers]
ref|XP_007207128.1|  hypothetical protein PRUPE_ppa003096mg             206   3e-59   Prunus persica
ref|XP_003520410.1|  PREDICTED: pyruvate decarboxylase 1-like           206   3e-59   
ref|XP_008221277.1|  PREDICTED: pyruvate decarboxylase 1-like           206   3e-59   Prunus mume [ume]
ref|XP_008362261.1|  PREDICTED: pyruvate decarboxylase 2-like           206   3e-59   
ref|XP_010448857.1|  PREDICTED: pyruvate decarboxylase 2-like           206   4e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001060727.1|  Os07g0693100                                       206   4e-59   
sp|P51846.1|PDC2_TOBAC  RecName: Full=Pyruvate decarboxylase 2; S...    206   4e-59   Nicotiana tabacum [American tobacco]
ref|XP_009594221.1|  PREDICTED: pyruvate decarboxylase 2 isoform X2     206   4e-59   Nicotiana tomentosiformis
ref|XP_011071825.1|  PREDICTED: pyruvate decarboxylase 1-like           206   4e-59   Sesamum indicum [beniseed]
emb|CDY10495.1|  BnaCnng03960D                                          206   4e-59   Brassica napus [oilseed rape]
ref|XP_004232952.1|  PREDICTED: pyruvate decarboxylase 1                205   4e-59   Solanum lycopersicum
ref|XP_009773011.1|  PREDICTED: pyruvate decarboxylase 2 isoform X2     205   4e-59   Nicotiana sylvestris
gb|KDO77807.1|  hypothetical protein CISIN_1g007800mg                   202   5e-59   Citrus sinensis [apfelsine]
ref|XP_009773010.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     206   5e-59   Nicotiana sylvestris
ref|XP_009594220.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     206   5e-59   Nicotiana tomentosiformis
ref|XP_008654188.1|  PREDICTED: pyruvate decarboxylase 3-like           206   5e-59   Zea mays [maize]
gb|EYU42548.1|  hypothetical protein MIMGU_mgv1a003111mg                205   6e-59   Erythranthe guttata [common monkey flower]
ref|XP_007025439.1|  Thiamine pyrophosphate dependent pyruvate de...    201   7e-59   
ref|XP_009369597.1|  PREDICTED: pyruvate decarboxylase 2-like           205   7e-59   Pyrus x bretschneideri [bai li]
ref|XP_008384777.1|  PREDICTED: pyruvate decarboxylase 1-like iso...    205   7e-59   
ref|XP_009338952.1|  PREDICTED: pyruvate decarboxylase 2-like           205   7e-59   Pyrus x bretschneideri [bai li]
ref|NP_001284406.1|  pyruvate decarboxylase                             205   8e-59   Cucumis melo [Oriental melon]
ref|XP_009607456.1|  PREDICTED: pyruvate decarboxylase 1                204   9e-59   Nicotiana tomentosiformis
ref|XP_008384776.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    205   9e-59   
ref|XP_003623316.1|  Pyruvate decarboxylase isozyme                     204   1e-58   
gb|KJB57436.1|  hypothetical protein B456_009G164100                    203   1e-58   Gossypium raimondii
ref|XP_009801931.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     204   1e-58   Nicotiana sylvestris
gb|KJB57437.1|  hypothetical protein B456_009G164100                    203   1e-58   Gossypium raimondii
ref|XP_007025440.1|  Thiamine pyrophosphate dependent pyruvate de...    201   1e-58   
ref|XP_002530500.1|  pyruvate decarboxylase, putative                   204   1e-58   Ricinus communis
ref|XP_002275486.1|  PREDICTED: pyruvate decarboxylase 1                204   1e-58   Vitis vinifera
ref|XP_008775407.1|  PREDICTED: pyruvate decarboxylase 2-like           204   1e-58   Phoenix dactylifera
ref|XP_007026638.1|  Thiamine pyrophosphate dependent pyruvate de...    199   2e-58   
gb|KJB57434.1|  hypothetical protein B456_009G164100                    204   2e-58   Gossypium raimondii
ref|XP_007026635.1|  Thiamine pyrophosphate dependent pyruvate de...    204   2e-58   
ref|XP_010033427.1|  PREDICTED: pyruvate decarboxylase 1-like           204   2e-58   Eucalyptus grandis [rose gum]
emb|CAG30578.1|  pyruvate decarboxylase isozyme 1                       203   2e-58   Lotus japonicus
ref|XP_010279076.1|  PREDICTED: pyruvate decarboxylase 1-like           204   2e-58   Nelumbo nucifera [Indian lotus]
sp|P51850.1|PDC1_PEA  RecName: Full=Pyruvate decarboxylase 1; Sho...    204   2e-58   Pisum sativum [garden pea]
ref|XP_004137700.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    204   3e-58   Cucumis sativus [cucumbers]
ref|XP_004156618.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    203   3e-58   
gb|KCW49436.1|  hypothetical protein EUGRSUZ_K02968                     204   3e-58   Eucalyptus grandis [rose gum]
gb|KDO77806.1|  hypothetical protein CISIN_1g007800mg                   202   3e-58   Citrus sinensis [apfelsine]
gb|KDO77804.1|  hypothetical protein CISIN_1g007800mg                   203   3e-58   Citrus sinensis [apfelsine]
gb|KDO77805.1|  hypothetical protein CISIN_1g007800mg                   203   3e-58   Citrus sinensis [apfelsine]
ref|XP_006843656.1|  hypothetical protein AMTR_s00007p00179930          203   3e-58   Amborella trichopoda
ref|NP_001275795.1|  pyruvate decarboxylase                             203   3e-58   Citrus sinensis [apfelsine]
ref|XP_010039167.1|  PREDICTED: pyruvate decarboxylase 1-like           204   4e-58   Eucalyptus grandis [rose gum]
gb|KHG03537.1|  Pyruvate decarboxylase isozyme 1                        203   5e-58   Gossypium arboreum [tree cotton]
ref|XP_010277737.1|  PREDICTED: pyruvate decarboxylase 1                202   5e-58   Nelumbo nucifera [Indian lotus]
gb|KCW44287.1|  hypothetical protein EUGRSUZ_L02272                     200   6e-58   Eucalyptus grandis [rose gum]
ref|XP_010686333.1|  PREDICTED: pyruvate decarboxylase 1                202   7e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004294304.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    202   7e-58   Fragaria vesca subsp. vesca
ref|XP_003604737.1|  Pyruvate decarboxylase isozyme                     202   7e-58   Medicago truncatula
ref|XP_007148065.1|  hypothetical protein PHAVU_006G177600g             202   7e-58   Phaseolus vulgaris [French bean]
ref|XP_011460964.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    202   8e-58   Fragaria vesca subsp. vesca
ref|XP_007134808.1|  hypothetical protein PHAVU_010G078000g             202   8e-58   Phaseolus vulgaris [French bean]
gb|AAX33299.1|  pyruvate decarboxylase 2                                202   9e-58   Petunia x hybrida [garden petunia]
gb|KJB21559.1|  hypothetical protein B456_004G001200                    202   9e-58   Gossypium raimondii
gb|AAA68290.1|  pyruvate decarboxylase 1                                202   9e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_007025438.1|  Pyruvate decarboxylase-2 isoform 2                 202   9e-58   
ref|XP_007025437.1|  Pyruvate decarboxylase-2 isoform 1                 202   1e-57   
ref|XP_011046076.1|  PREDICTED: pyruvate decarboxylase 1-like           201   1e-57   Populus euphratica
ref|XP_010279075.1|  PREDICTED: pyruvate decarboxylase 1-like           201   1e-57   Nelumbo nucifera [Indian lotus]
gb|AAA68289.1|  pyruvate decarboxylase                                  201   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_009384923.1|  PREDICTED: pyruvate decarboxylase 1-like           201   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002308230.1|  pyruvate decarboxylase family protein              201   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_003623318.1|  Pyruvate decarboxylase isozyme                     201   2e-57   Medicago truncatula
ref|XP_003614223.1|  Pyruvate decarboxylase isozyme                     201   2e-57   Medicago truncatula
ref|XP_008457351.1|  PREDICTED: pyruvate decarboxylase 2-like           201   2e-57   Cucumis melo [Oriental melon]
ref|XP_003542972.1|  PREDICTED: pyruvate decarboxylase 1-like           201   2e-57   Glycine max [soybeans]
gb|KHN18047.1|  Pyruvate decarboxylase isozyme 2                        201   2e-57   Glycine soja [wild soybean]
ref|XP_007016910.1|  Thiamine pyrophosphate dependent pyruvate de...    201   2e-57   
ref|XP_003516954.1|  PREDICTED: pyruvate decarboxylase 4                201   2e-57   Glycine max [soybeans]
ref|XP_006449473.1|  hypothetical protein CICLE_v10014703mg             199   3e-57   
gb|ACG29583.1|  pyruvate decarboxylase isozyme 1                        201   4e-57   Zea mays [maize]
ref|NP_001105422.1|  pyruvate decarboxylase 1                           201   4e-57   
gb|ACR35995.1|  unknown                                                 201   4e-57   Zea mays [maize]
ref|XP_003529168.1|  PREDICTED: pyruvate decarboxylase 1                200   4e-57   Glycine max [soybeans]
sp|P28516.1|PDC1_MAIZE  RecName: Full=Pyruvate decarboxylase 1; S...    201   4e-57   Zea mays [maize]
gb|AAO42252.1|  putative pyruvate decarboxylase                         199   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225205.1|  PREDICTED: pyruvate decarboxylase 1                199   5e-57   Prunus mume [ume]
emb|CDO96745.1|  unnamed protein product                                200   5e-57   Coffea canephora [robusta coffee]
ref|XP_006449474.1|  hypothetical protein CICLE_v10014703mg             200   5e-57   Citrus clementina [clementine]
ref|XP_010924891.1|  PREDICTED: pyruvate decarboxylase 1-like           199   5e-57   Elaeis guineensis
ref|XP_002870930.1|  pyruvate decarboxylase-3                           200   6e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_003552267.1|  PREDICTED: pyruvate decarboxylase 2                200   6e-57   Glycine max [soybeans]
ref|XP_004961783.1|  PREDICTED: pyruvate decarboxylase 1-like           199   8e-57   Setaria italica
emb|CDO99368.1|  unnamed protein product                                199   8e-57   Coffea canephora [robusta coffee]
ref|XP_010912563.1|  PREDICTED: pyruvate decarboxylase 1                199   1e-56   Elaeis guineensis
ref|XP_007140235.1|  hypothetical protein PHAVU_008G095400g             199   1e-56   Phaseolus vulgaris [French bean]
gb|AAX33300.1|  pyruvate decarboxylase 1                                197   1e-56   Petunia x hybrida [garden petunia]
gb|ABJ99596.1|  pyruvate decarboxylase                                  199   1e-56   Lycoris aurea [golden hurricane-lily]
ref|XP_009376417.1|  PREDICTED: pyruvate decarboxylase 2                199   1e-56   
ref|XP_007213938.1|  hypothetical protein PRUPE_ppa003458mg             198   1e-56   Prunus persica
ref|XP_002305755.2|  pyruvate decarboxylase family protein              198   2e-56   
ref|XP_009386639.1|  PREDICTED: pyruvate decarboxylase 1-like           198   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522062.1|  PREDICTED: pyruvate decarboxylase 1-like           198   2e-56   
ref|NP_195753.1|  pyruvate decarboxylase-3                              199   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011045902.1|  PREDICTED: pyruvate decarboxylase 1                198   2e-56   Populus euphratica
ref|XP_004485877.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    198   2e-56   Cicer arietinum [garbanzo]
ref|XP_011027712.1|  PREDICTED: pyruvate decarboxylase 1-like           198   2e-56   Populus euphratica
ref|XP_010108431.1|  Pyruvate decarboxylase isozyme 1                   198   3e-56   Morus notabilis
ref|XP_010257091.1|  PREDICTED: pyruvate decarboxylase 1-like           197   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010037690.1|  PREDICTED: pyruvate decarboxylase 1-like           198   3e-56   Eucalyptus grandis [rose gum]
ref|XP_002522545.1|  pyruvate decarboxylase, putative                   197   5e-56   Ricinus communis
ref|XP_003593734.1|  Pyruvate decarboxylase                             197   5e-56   Medicago truncatula
ref|XP_002439941.1|  hypothetical protein SORBIDRAFT_09g023060          197   5e-56   Sorghum bicolor [broomcorn]
ref|XP_010040424.1|  PREDICTED: pyruvate decarboxylase 1-like           198   6e-56   Eucalyptus grandis [rose gum]
gb|KCW45220.1|  hypothetical protein EUGRSUZ_L01136                     197   7e-56   Eucalyptus grandis [rose gum]
gb|KCW45222.1|  hypothetical protein EUGRSUZ_L01136                     197   9e-56   Eucalyptus grandis [rose gum]
gb|ABJ99597.1|  pyruvate decarboxylase                                  197   9e-56   Lycoris aurea [golden hurricane-lily]
ref|XP_008805886.1|  PREDICTED: pyruvate decarboxylase 1                196   9e-56   Phoenix dactylifera
ref|XP_002276535.1|  PREDICTED: pyruvate decarboxylase 1 isoform X2     196   1e-55   Vitis vinifera
ref|XP_010650884.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     196   1e-55   Vitis vinifera
ref|XP_009352809.1|  PREDICTED: pyruvate decarboxylase 1                196   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_008779842.1|  PREDICTED: pyruvate decarboxylase 2-like           186   4e-55   
gb|EYU28059.1|  hypothetical protein MIMGU_mgv1a003736mg                194   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_006372352.1|  hypothetical protein POPTR_0017s00800g             194   7e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002989648.1|  hypothetical protein SELMODRAFT_160305             194   7e-55   Selaginella moellendorffii
ref|XP_002317431.1|  pyruvate decarboxylase family protein              194   8e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002986100.1|  hypothetical protein SELMODRAFT_157772             194   8e-55   Selaginella moellendorffii
ref|XP_004293926.1|  PREDICTED: pyruvate decarboxylase 1                194   9e-55   Fragaria vesca subsp. vesca
ref|XP_008370941.1|  PREDICTED: pyruvate decarboxylase 2-like           183   1e-54   
ref|XP_006658999.1|  PREDICTED: pyruvate decarboxylase 3-like           192   1e-54   
ref|XP_004506726.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    192   3e-54   Cicer arietinum [garbanzo]
ref|XP_001763233.1|  predicted protein                                  191   7e-54   
ref|XP_002514646.1|  pyruvate decarboxylase, putative                   191   9e-54   Ricinus communis
ref|XP_002963708.1|  hypothetical protein SELMODRAFT_80644              191   1e-53   
ref|XP_002974798.1|  hypothetical protein SELMODRAFT_101858             190   1e-53   
ref|XP_001756932.1|  predicted protein                                  188   9e-53   
ref|XP_010040428.1|  PREDICTED: pyruvate decarboxylase 1-like           188   1e-52   Eucalyptus grandis [rose gum]
ref|NP_001105645.1|  pyruvate decarboxylase                             188   1e-52   Zea mays [maize]
gb|ACL54539.1|  unknown                                                 188   1e-52   Zea mays [maize]
gb|ACG41852.1|  pyruvate decarboxylase isozyme 1                        188   1e-52   Zea mays [maize]
ref|XP_003532957.2|  PREDICTED: pyruvate decarboxylase 2-like           188   2e-52   Glycine max [soybeans]
ref|XP_010089789.1|  Pyruvate decarboxylase isozyme 2                   187   2e-52   Morus notabilis
ref|XP_008244071.1|  PREDICTED: pyruvate decarboxylase 2-like           187   2e-52   Prunus mume [ume]
gb|KHN26768.1|  Pyruvate decarboxylase isozyme 2                        187   2e-52   Glycine soja [wild soybean]
gb|AFW80093.1|  pyruvate decarboxylase2                                 187   3e-52   
ref|XP_007214497.1|  hypothetical protein PRUPE_ppa019548mg             186   7e-52   
ref|XP_004486250.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    184   4e-51   
ref|XP_002455158.1|  hypothetical protein SORBIDRAFT_03g005240          184   5e-51   Sorghum bicolor [broomcorn]
ref|XP_007208149.1|  hypothetical protein PRUPE_ppa023325mg             181   9e-51   
gb|AES63495.2|  pyruvate decarboxylase                                  182   2e-50   
ref|XP_003593244.1|  Pyruvate decarboxylase isozyme                     182   2e-50   
ref|XP_004968281.1|  PREDICTED: pyruvate decarboxylase 2-like           182   3e-50   
ref|XP_004485602.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    181   8e-50   
ref|XP_007213456.1|  hypothetical protein PRUPE_ppa024595mg             169   8e-50   
ref|NP_001042088.1|  Os01g0160100                                       180   8e-50   
ref|XP_001782896.1|  predicted protein                                  179   1e-49   
ref|XP_001773989.1|  predicted protein                                  179   1e-49   
dbj|BAK02798.1|  predicted protein                                      178   5e-49   
emb|CDM81546.1|  unnamed protein product                                177   1e-48   
ref|XP_002514645.1|  pyruvate decarboxylase, putative                   177   1e-48   
ref|XP_004167935.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    177   2e-48   
ref|XP_004148631.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    177   2e-48   
gb|AAL33553.1|AF436852_1  pyruvate decarboxylase                        167   2e-48   
gb|KGN54392.1|  hypothetical protein Csa_4G312250                       177   2e-48   
gb|KCW88159.1|  hypothetical protein EUGRSUZ_A00548                     175   3e-48   
gb|KCW44313.1|  hypothetical protein EUGRSUZ_L02239                     175   4e-48   
gb|EAY72634.1|  hypothetical protein OsI_00500                          176   5e-48   
gb|KGN54393.1|  hypothetical protein Csa_4G312260                       168   5e-48   
ref|XP_010054593.1|  PREDICTED: pyruvate decarboxylase 1-like           175   9e-48   
ref|XP_008464214.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    174   2e-47   
ref|XP_008464213.1|  PREDICTED: pyruvate decarboxylase 1-like           174   3e-47   
gb|KCW76960.1|  hypothetical protein EUGRSUZ_D01319                     172   4e-47   
ref|XP_003569007.1|  PREDICTED: pyruvate decarboxylase 1-like           172   1e-46   
gb|KGN54391.1|  hypothetical protein Csa_4G312240                       171   3e-46   
ref|XP_004148630.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    171   3e-46   
ref|XP_008464266.1|  PREDICTED: pyruvate decarboxylase 1-like           171   4e-46   
ref|XP_004148632.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    170   7e-46   
gb|AAA90948.1|  pyruvate decarboxylase 2                                164   6e-44   
gb|EEE58866.1|  hypothetical protein OsJ_10464                          157   1e-41   
ref|XP_005643654.1|  pyruvate decarboxylase                             157   1e-41   
ref|XP_002461271.1|  hypothetical protein SORBIDRAFT_02g043900          155   6e-41   
ref|XP_009358206.1|  PREDICTED: pyruvate decarboxylase 1-like           153   4e-40   
gb|EMS61276.1|  Pyruvate decarboxylase isozyme 2                        143   1e-37   
ref|XP_002977201.1|  hypothetical protein SELMODRAFT_417071             140   2e-35   
ref|XP_005847311.1|  hypothetical protein CHLNCDRAFT_52583              138   1e-34   
ref|WP_014105323.1|  pyruvate decarboxylase                             135   1e-33   
ref|WP_010515737.1|  pyruvate decarboxylase                             134   2e-33   
ref|WP_003622049.1|  pyruvate decarboxylase                             134   2e-33   
ref|WP_039736366.1|  pyruvate decarboxylase                             134   3e-33   
ref|WP_007397706.1|  MULTISPECIES: pyruvate decarboxylase               134   3e-33   
ref|WP_019090978.1|  pyruvate decarboxylase                             134   4e-33   
ref|WP_010509054.1|  pyruvate decarboxylase                             134   4e-33   
ref|WP_019085054.1|  pyruvate decarboxylase                             133   6e-33   
ref|WP_020944449.1|  pyruvate decarboxylase                             132   2e-32   
ref|WP_019088123.1|  pyruvate decarboxylase                             132   2e-32   
ref|WP_006115789.1|  pyruvate decarboxylase                             131   2e-32   
ref|WP_035366029.1|  pyruvate decarboxylase                             131   2e-32   
ref|WP_042788399.1|  pyruvate decarboxylase                             130   5e-32   
ref|WP_025439431.1|  pyruvate decarboxylase                             130   5e-32   
ref|WP_014457473.1|  pyruvate decarboxylase                             130   9e-32   
ref|XP_002951658.1|  hypothetical protein VOLCADRAFT_105183             130   1e-31   
ref|WP_040916638.1|  hypothetical protein                               124   2e-31   
ref|WP_034959544.1|  pyruvate decarboxylase                             123   2e-31   
emb|CBI15925.3|  unnamed protein product                                128   3e-31   
gb|EWM28627.1|  pyruvate decarboxylase                                  127   4e-31   
gb|EUA30271.1|  thiamine pyrophosphate enzyme, N-terminal TPP bin...    122   4e-31   
dbj|GAB28165.1|  pyruvate decarboxylase                                 128   5e-31   
dbj|GAB31399.1|  pyruvate decarboxylase                                 127   5e-31   
ref|XP_001703530.1|  mitochondrial pyruvate dehydrogenase complex...    127   6e-31   
ref|WP_019235242.1|  pyruvate decarboxylase                             127   9e-31   
ref|XP_011397126.1|  Pyruvate decarboxylase 2                           127   1e-30   
ref|XP_005854872.1|  pyruvate decarboxylase                             127   1e-30   
ref|WP_002764831.1|  pyruvate decarboxylase                             127   1e-30   
ref|WP_010505240.1|  pyruvate decarboxylase                             126   2e-30   
ref|XP_010040426.1|  PREDICTED: pyruvate decarboxylase 1-like           126   2e-30   
ref|XP_003351329.1|  hypothetical protein SMAC_03633                    125   2e-30   
ref|WP_023941876.1|  pyruvate decarboxylase                             126   2e-30   
ref|WP_002787689.1|  pyruvate decarboxylase                             126   2e-30   
ref|XP_011395110.1|  pyruvate decarboxylase, variant                    126   2e-30   
ref|WP_029606093.1|  pyruvate decarboxylase                             126   2e-30   
ref|XP_011395109.1|  pyruvate decarboxylase                             126   2e-30   
ref|XP_006488692.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    125   2e-30   
ref|XP_009853563.1|  Pyruvate decarboxylase                             125   3e-30   
ref|WP_028382550.1|  pyruvate decarboxylase                             125   3e-30   
ref|WP_031564015.1|  pyruvate decarboxylase                             125   4e-30   
ref|WP_008853550.1|  pyruvate decarboxylase                             125   4e-30   
dbj|BAA13925.1|  unnamed protein product                                125   8e-30   
ref|WP_010654974.1|  pyruvate decarboxylase                             124   9e-30   
ref|WP_043549626.1|  pyruvate decarboxylase                             124   1e-29   
ref|WP_026707173.1|  pyruvate decarboxylase                             124   1e-29   
ref|XP_007918504.1|  putative pyruvate decarboxylase protein            123   3e-29   
ref|WP_034336516.1|  pyruvate decarboxylase                             123   3e-29   
sp|Q92345.3|PDC2_SCHPO  RecName: Full=Probable pyruvate decarboxy...    122   5e-29   
ref|NP_592796.3|  pyruvate decarboxylase (predicted)                    122   5e-29   
ref|WP_038612918.1|  pyruvate decarboxylase                             122   7e-29   
gb|EPX73372.1|  pyruvate decarboxylase                                  122   7e-29   
gb|EPY50138.1|  pyruvate decarboxylase                                  122   7e-29   
ref|WP_008852112.1|  pyruvate decarboxylase                             122   7e-29   
ref|WP_025828656.1|  pyruvate decarboxylase                             121   1e-28   
ref|WP_002648470.1|  pyruvate decarboxylase                             121   1e-28   
ref|XP_009159300.1|  pyruvate decarboxylase                             122   1e-28   
ref|WP_012386294.1|  pyruvate decarboxylase                             121   1e-28   
ref|WP_042060334.1|  pyruvate decarboxylase                             121   1e-28   
ref|WP_003922707.1|  alpha-keto acid decarboxylase                      121   1e-28   
gb|ABR14731.1|  pyruvate decarboxylase                                  116   2e-28   
gb|KIW34410.1|  hypothetical protein PV07_01188                         120   2e-28   
ref|WP_014841393.1|  pyruvate decarboxylase                             120   2e-28   
ref|WP_027226213.1|  pyruvate decarboxylase                             120   2e-28   
ref|WP_027265760.1|  pyruvate decarboxylase                             120   2e-28   
ref|WP_031743820.1|  indolepyruvate decarboxylase                       117   3e-28   
ref|WP_027220769.1|  pyruvate decarboxylase                             120   3e-28   
ref|WP_011215259.1|  pyruvate decarboxylase                             120   3e-28   
ref|WP_024457955.1|  indolepyruvate decarboxylase                       118   4e-28   
ref|WP_028378501.1|  pyruvate decarboxylase                             119   5e-28   
ref|WP_024456954.1|  indolepyruvate decarboxylase                       117   5e-28   
ref|XP_001904289.1|  hypothetical protein                               119   5e-28   
ref|WP_024458406.1|  indolepyruvate decarboxylase                       118   5e-28   
ref|WP_011252642.1|  pyruvate decarboxylase                             119   5e-28   
ref|WP_041111546.1|  pyruvate decarboxylase                             119   5e-28   
ref|WP_027268181.1|  pyruvate decarboxylase                             119   5e-28   
ref|WP_027221397.1|  pyruvate decarboxylase                             119   5e-28   
ref|WP_016720255.1|  alpha-keto acid decarboxylase                      118   5e-28   
gb|AHB37780.1|  pyruvate decarboxylase                                  119   6e-28   
ref|WP_027224144.1|  pyruvate decarboxylase                             119   6e-28   
ref|WP_010946889.1|  pyruvate decarboxylase                             119   6e-28   
gb|KEZ43627.1|  hypothetical protein SAPIO_CDS4223                      121   6e-28   
emb|CDM34749.1|  Probable pyruvate decarboxylase C186.09                119   7e-28   
ref|WP_007283613.1|  pyruvate decarboxylase                             119   7e-28   
ref|WP_015073497.1|  pyruvate decarboxylase                             119   7e-28   
ref|WP_031716905.1|  indolepyruvate decarboxylase                       117   9e-28   
ref|WP_011213511.1|  pyruvate decarboxylase                             119   1e-27   
ref|WP_023883487.1|  alpha-keto acid decarboxylase                      117   1e-27   
gb|ETB43480.1|  alpha-keto acid decarboxylase                           117   1e-27   
gb|ETB50743.1|  alpha-keto acid decarboxylase                           116   1e-27   
ref|XP_753176.1|  pyruvate decarboxylase                                118   1e-27   
gb|EUA37067.1|  thiamine pyrophosphate enzyme, N-terminal TPP bin...    116   2e-27   
gb|ETB49168.1|  alpha-keto acid decarboxylase                           116   2e-27   
gb|KBZ57184.1|  pyruvate or indole-3-pyruvate decarboxylase Pdc         117   2e-27   
gb|KEY84000.1|  pyruvate decarboxylase                                  118   2e-27   
ref|WP_020414286.1|  hypothetical protein                               118   2e-27   
ref|WP_006559524.1|  pyruvate decarboxylase                             118   2e-27   
ref|XP_002552742.1|  KLTH0D00418p                                       118   2e-27   
ref|WP_036454662.1|  MULTISPECIES: indolepyruvate decarboxylase         117   2e-27   
ref|WP_026071395.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_034167542.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_031708769.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_029383840.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_044096050.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_014379216.1|  alpha-keto acid decarboxylase                      117   2e-27   
ref|WP_042914660.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_038538416.1|  MULTISPECIES: indolepyruvate decarboxylase         117   2e-27   
ref|WP_031660802.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_031658842.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_031695085.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_031741435.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_003404411.1|  pyruvate or indole-3-pyruvate decarboxylase pdc    117   2e-27   
ref|WP_015302683.1|  Putative pyruvate or indole-3-pyruvate decar...    117   2e-27   
ref|WP_042911065.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_031731750.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_031729844.1|  indolepyruvate decarboxylase                       117   2e-27   
ref|WP_014000464.1|  alpha-keto acid decarboxylase                      117   2e-27   
ref|WP_013988779.1|  alpha-keto acid decarboxylase                      117   2e-27   
ref|WP_036429135.1|  indolepyruvate decarboxylase                       117   3e-27   
gb|EFG75569.1|  alpha-keto-acid decarboxylase                           117   3e-27   
ref|WP_031712998.1|  indolepyruvate decarboxylase                       117   3e-27   
ref|WP_003900222.1|  MULTISPECIES: alpha-keto acid decarboxylase        117   3e-27   
ref|WP_041298159.1|  indolepyruvate decarboxylase                       117   3e-27   
ref|WP_031738643.1|  indolepyruvate decarboxylase                       117   3e-27   
ref|WP_031677215.1|  indolepyruvate decarboxylase                       117   3e-27   
ref|WP_023641674.1|  alpha-keto acid decarboxylase                      117   3e-27   
ref|WP_003898617.1|  alpha-keto acid decarboxylase                      117   3e-27   
gb|AIH99848.1|  indolepyruvate decarboxylase                            117   3e-27   
ref|WP_023644611.1|  alpha-keto acid decarboxylase                      117   3e-27   
ref|WP_016719318.1|  alpha-keto acid decarboxylase                      117   3e-27   
ref|WP_014941316.1|  alpha-keto acid decarboxylase                      117   3e-27   
gb|AFC52368.1|  pdc                                                     117   3e-27   
ref|WP_015292487.1|  Putative pyruvate or indole-3-pyruvate decar...    117   3e-27   
ref|WP_031746921.1|  indolepyruvate decarboxylase                       117   3e-27   
ref|WP_031702981.1|  indolepyruvate decarboxylase                       117   3e-27   
gb|AFJ33812.1|  pdc                                                     117   3e-27   
gb|ETZ33788.1|  thiamine pyrophosphate enzyme, C-terminal TPP bin...    117   3e-27   
gb|ELR83736.1|  pdc                                                     117   3e-27   
ref|WP_015289336.1|  Putative pyruvate or indole-3-pyruvate decar...    117   3e-27   
ref|XP_001270421.1|  pyruvate decarboxylase                             119   3e-27   
ref|WP_029400992.1|  indolepyruvate decarboxylase                       117   4e-27   
ref|WP_044508339.1|  indolepyruvate decarboxylase                       117   4e-27   
ref|WP_031581818.1|  indolepyruvate decarboxylase                       117   5e-27   
gb|KFZ19401.1|  hypothetical protein V501_00673                         117   5e-27   
gb|EXL39445.1|  pyruvate decarboxylase                                  116   6e-27   
ref|WP_031737997.1|  indolepyruvate decarboxylase                       116   7e-27   
ref|WP_026398917.1|  pyruvate decarboxylase                             116   7e-27   
ref|WP_031351756.1|  indolepyruvate decarboxylase                       116   7e-27   
gb|EUA07723.1|  thiamine pyrophosphate enzyme, N-terminal TPP bin...    112   7e-27   
ref|WP_033719009.1|  indolepyruvate decarboxylase                       116   7e-27   
ref|WP_023864093.1|  alpha-keto acid decarboxylase                      116   7e-27   
ref|WP_031724547.1|  indolepyruvate decarboxylase                       116   7e-27   
ref|WP_007777235.1|  alpha-keto acid decarboxylase                      116   7e-27   
ref|WP_044487275.1|  indolepyruvate decarboxylase                       116   8e-27   
gb|ETB14609.1|  alpha-keto acid decarboxylase                           116   8e-27   
ref|WP_036412252.1|  indolepyruvate decarboxylase                       116   8e-27   
gb|KBZ59417.1|  pyruvate or indole-3-pyruvate decarboxylase Pdc         116   8e-27   
ref|WP_036448841.1|  indolepyruvate decarboxylase                       116   8e-27   
ref|WP_019732169.1|  MULTISPECIES: alpha-keto acid decarboxylase        116   8e-27   
sp|A0QBE6.2|KDC_MYCA1  RecName: Full=Alpha-keto-acid decarboxylas...    116   8e-27   
ref|WP_011723869.1|  alpha-keto acid decarboxylase                      116   8e-27   
ref|WP_031717975.1|  indolepyruvate decarboxylase                       116   9e-27   
sp|Q742Q2.1|KDC_MYCPA  RecName: Full=Alpha-keto-acid decarboxylas...    116   9e-27   
gb|ETB07495.1|  alpha-keto acid decarboxylase                           116   9e-27   
gb|ETW24796.1|  alpha-keto acid decarboxylase                           116   9e-27   
ref|WP_003877322.1|  Pdc                                                116   9e-27   
ref|WP_036445652.1|  indolepyruvate decarboxylase                       116   9e-27   
ref|WP_009975093.1|  alpha-keto acid decarboxylase                      116   9e-27   
ref|WP_031354234.1|  indolepyruvate decarboxylase                       116   9e-27   
gb|ETA95730.1|  alpha-keto acid decarboxylase                           116   9e-27   
ref|WP_023367550.1|  alpha-keto acid decarboxylase                      116   1e-26   
ref|WP_031349027.1|  indolepyruvate decarboxylase                       116   1e-26   
gb|ETB27338.1|  alpha-keto acid decarboxylase                           116   1e-26   
ref|WP_036447590.1|  indolepyruvate decarboxylase                       115   2e-26   
ref|WP_036471459.1|  indolepyruvate decarboxylase                       115   2e-26   
ref|WP_036365050.1|  indolepyruvate decarboxylase                       115   2e-26   
ref|WP_018389274.1|  hypothetical protein                               115   3e-26   
ref|WP_029110438.1|  indolepyruvate decarboxylase                       114   3e-26   
ref|WP_036393932.1|  indolepyruvate decarboxylase                       114   3e-26   
ref|WP_010667855.1|  pyruvate decarboxylase                             114   4e-26   
gb|EHK26559.1|  hypothetical protein TRIVIDRAFT_52525                   114   4e-26   
dbj|GAA90238.1|  pyruvate decarboxylase                                 116   4e-26   
gb|EUA18037.1|  thiamine pyrophosphate enzyme, C-terminal TPP bin...    114   4e-26   
ref|WP_026398870.1|  pyruvate decarboxylase                             114   4e-26   
emb|CDH18115.1|  uncharacterized protein ZBAI_09903                     108   4e-26   



>emb|CDP06456.1| unnamed protein product [Coffea canephora]
Length=603

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            S DV + PT G  T+H +P++F+SA++TLGRHLARRLVQ+GV DVFSVPGDFNLTLLDHL
Sbjct  15   SNDVGSLPTNGAVTIHQSPISFNSADSTLGRHLARRLVQVGVNDVFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            +AEPGL L+GCCNELNAGYAADGYAR RGVGACVVTFTVGGLS+LNAIAGAYSENLP+IC
Sbjct  75   LAEPGLNLVGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSILNAIAGAYSENLPVIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  IVGGPNSNDYGTNRILHHTIGLPDFSQ  161



>ref|XP_006363624.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum tuberosum]
Length=603

 Score =   227 bits (579),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF VPGDFNLTLLDHLI 
Sbjct  17   DVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVFGVPGDFNLTLLDHLID  76

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL  IGCCNELNAGYAADGYARA GVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  77   EPGLNFIGCCNELNAGYAADGYARAHGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  136

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  137  GGPNSNDYGTNRILHHTIGLPDFTQ  161



>ref|XP_011095042.1| PREDICTED: pyruvate decarboxylase 1 [Sesamum indicum]
Length=605

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            DV + P+ GV +T+ S+ VAF+SAEATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHLI
Sbjct  18   DVGSLPSNGVVSTIQSSVVAFNSAEATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHLI  77

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L LIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  78   AEPSLNLIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  137

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  138  VGGPNSNDYGTNRVLHHTIGLPDFSQ  163



>ref|XP_004249069.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum lycopersicum]
Length=603

 Score =   223 bits (569),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF VPGDFNLTLLDHLI 
Sbjct  17   DVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVFGVPGDFNLTLLDHLID  76

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EP L  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  77   EPALNFVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  136

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  GGPNSNDYGTNRILHHTIGLPDFSQ  161



>ref|XP_006286440.1| hypothetical protein CARUB_v10003893mg [Capsella rubella]
 gb|EOA19338.1| hypothetical protein CARUB_v10003893mg [Capsella rubella]
Length=604

 Score =   223 bits (567),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH-STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            +GD+ + P+  V T+  S+P   +S+EATLGRHLARRLVQ GVTD+FSVPGDFNLTLLDH
Sbjct  15   TGDIGSPPSNAVATIQDSSPSTVTSSEATLGRHLARRLVQAGVTDIFSVPGDFNLTLLDH  74

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLI
Sbjct  75   LIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLI  134

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  CIVGGPNSNDFGTNRILHHTIGLPDFSQ  162



>ref|XP_009769363.1| PREDICTED: pyruvate decarboxylase 1-like [Nicotiana sylvestris]
Length=603

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV + PT    T+H+  V F+S ++TLGRHLARRLVQ+GVTDVF VPGDFNLTLLDHLIA
Sbjct  17   DVGSLPTTNTVTIHTPTVPFNSPDSTLGRHLARRLVQVGVTDVFGVPGDFNLTLLDHLIA  76

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  77   EPGLKFIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  136

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  GGPNSNDYGTNRILHHTIGLPDFSQ  161



>ref|XP_009622836.1| PREDICTED: pyruvate decarboxylase 1-like [Nicotiana tomentosiformis]
Length=603

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV + PT    T+H+  V F+S ++TLGRHLARRLVQ+GVTDVF VPGDFNLTLLDHLIA
Sbjct  17   DVGSLPTTNSVTIHTPTVPFNSPDSTLGRHLARRLVQVGVTDVFGVPGDFNLTLLDHLIA  76

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  77   EPGLKFIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  136

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  GGPNSNDYGTNRILHHTIGLPDFSQ  161



>ref|XP_010447294.1| PREDICTED: pyruvate decarboxylase 1-like [Camelina sativa]
Length=605

 Score =   222 bits (565),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 122/149 (82%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            +GDV + P   V T+H +  P + +S +ATLGRHLARRLVQ GVTD+FSVPGDFNLTLLD
Sbjct  15   NGDVGSPPNTTVKTIHDSVIPSSVNSCDATLGRHLARRLVQSGVTDIFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  75   HLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>gb|KFK24633.1| hypothetical protein AALP_AA8G005000 [Arabis alpina]
Length=607

 Score =   222 bits (565),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GDV + P   V T+H    +T ++ SS+EATLGRHLARRLVQ GVTD+FSVPGDFNLTL
Sbjct  15   NGDVGSPPNSTVATIHDSVPATAISISSSEATLGRHLARRLVQAGVTDIFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  PVICIVGGPNSNDFGTNRILHHTIGLPDFSQ  165



>ref|XP_006363625.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum tuberosum]
Length=603

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF VPGDFNLTLLDHLI 
Sbjct  17   DVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVFGVPGDFNLTLLDHLID  76

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  77   EPGLNFVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  136

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  137  GGPNSNDYGTNRILHHTIGLPDFTQ  161



>dbj|BAC23043.1| pyruvate decarboxylase [Solanum tuberosum]
Length=592

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF VPGDFNLTLLDHLI 
Sbjct  6    DVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVFGVPGDFNLTLLDHLID  65

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  66   EPGLNFVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  125

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  126  GGPNSNDYGTNRILHHTIGLPDFTQ  150



>ref|XP_010553236.1| PREDICTED: pyruvate decarboxylase 2-like [Tarenaya hassleriana]
Length=610

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 137/153 (90%), Gaps = 5/153 (3%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTVHSTPVAFSSA-----EATLGRHLARRLVQIGVTDVFSVPGDFNL  292
             S D+  +P  GV+T+ S+P + S A     +ATLGRHLARRLV+IGVTDVFSVPGDFNL
Sbjct  14   ASNDIGGSPNCGVSTIESSPTSHSPAVVSPSDATLGRHLARRLVEIGVTDVFSVPGDFNL  73

Query  293  TLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSE  472
            TLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSE
Sbjct  74   TLLDHLIAEPRLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSE  133

Query  473  NLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            NLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  NLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  166



>ref|XP_010253807.1| PREDICTED: pyruvate decarboxylase 2-like [Nelumbo nucifera]
Length=605

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV + P  GV+ V ++  P    S+EATLGRH+ARRLVQIGVTDVFSVPGDFNLTLLDHL
Sbjct  17   DVGSLPNGGVSIVQNSVSPAVMGSSEATLGRHIARRLVQIGVTDVFSVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  77   IAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPIIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  IVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>gb|KDO56720.1| hypothetical protein CISIN_1g044559mg [Citrus sinensis]
Length=585

 Score =   220 bits (561),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 5/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVHS----TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+A+ P   V+T+ S    TP+  + +E+TLGRHLARRLVQIG TDVFSVPGDFNLTLLD
Sbjct  17   DLASPPNGAVSTIQSSVPATPLV-NPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLD  75

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  76   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  135

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  136  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_006429440.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
 ref|XP_006481076.1| PREDICTED: pyruvate decarboxylase 1-like [Citrus sinensis]
 gb|ESR42680.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
Length=606

 Score =   220 bits (561),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 5/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVHS----TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+A+ P   V+T+ S    TP+  + +E+TLGRHLARRLVQIG TDVFSVPGDFNLTLLD
Sbjct  17   DLASPPNGAVSTIQSSVPATPLV-NPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLD  75

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  76   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  135

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  136  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  164



>gb|EYU41928.1| hypothetical protein MIMGU_mgv1a003147mg [Erythranthe guttata]
Length=605

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANAPTIG-VNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            +V + P+ G V+T+  + VA +SAEATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHLI
Sbjct  18   EVGSLPSNGAVSTIQCSAVAINSAEATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHLI  77

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICI
Sbjct  78   AEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICI  137

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  138  VGGPNSNDYGTNRILHHTIGLPDFSQ  163



>emb|CDY66930.1| BnaCnng52860D [Brassica napus]
Length=607

 Score =   220 bits (560),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GDV + P+  V T+H    S+ ++  S+EATLGRHLARRLVQ GVTD+FSVPGDFNLTL
Sbjct  15   NGDVGSPPSGAVATIHDSAPSSALSVGSSEATLGRHLARRLVQAGVTDIFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  PVICIVGGPNSNDFGTNRILHHTIGLPDFSQ  165



>gb|AGA15799.1| pyruvate decarboxylase 5 [Diospyros kaki]
Length=193

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLGRHLARRLVQIG TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYA
Sbjct  39   ALVPSEATLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYA  98

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADG+AR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTI
Sbjct  99   ADGFARCRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTI  158

Query  551  GLPDFTQ  571
            GLPDF+Q
Sbjct  159  GLPDFSQ  165



>ref|XP_009125425.1| PREDICTED: pyruvate decarboxylase 4 [Brassica rapa]
 emb|CDY55899.1| BnaAnng13920D [Brassica napus]
Length=607

 Score =   219 bits (559),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GDV + P+  V T+H    S+ ++  S+EATLGRHLARRLVQ GVTD+FSVPGDFNLTL
Sbjct  15   NGDVGSPPSGAVATIHDSAPSSALSVGSSEATLGRHLARRLVQAGVTDIFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  PVICIVGGPNSNDFGTNRILHHTIGLPDFSQ  165



>ref|XP_007026637.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07139.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=447

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S D+ + P   V T+  +  P   +S+EATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLD
Sbjct  15   SNDIGSPPNGIVATIQGSVSPTVINSSEATLGRHLARRLVQVGVTDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  75   HLIAEPELKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDFGTNRILHHTIGLPDFSQ  163



>ref|XP_010920798.1| PREDICTED: pyruvate decarboxylase 1 [Elaeis guineensis]
Length=605

 Score =   219 bits (557),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 123/150 (82%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  122  SQGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  301
            +  +G V   P I  + +     A   AEATLGRHLARRLVQ+GV DVFSVPGDFNLTLL
Sbjct  14   ATANGVVGLPPAIPCHPIIPVAPASGPAEATLGRHLARRLVQVGVHDVFSVPGDFNLTLL  73

Query  302  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  481
            DHL+AEPGLRL+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP
Sbjct  74   DHLLAEPGLRLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP  133

Query  482  LICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  LICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_010092799.1| Pyruvate decarboxylase isozyme 2 [Morus notabilis]
 gb|EXB52385.1| Pyruvate decarboxylase isozyme 2 [Morus notabilis]
Length=606

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTVHSTPV---AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
             S DV   P   V T+ S+ V   AFSS+EATLGRHLARRLVQ+GVTDVF+VPGDFNLTL
Sbjct  14   ASNDVGGPPIGAVCTIQSSSVPSIAFSSSEATLGRHLARRLVQVGVTDVFTVPGDFNLTL  73

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  74   LDHLIAEPGLNNVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENL  133

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLIC+VGGPNSNDYGTNR+LHHTIG+PDF+Q
Sbjct  134  PLICVVGGPNSNDYGTNRVLHHTIGVPDFSQ  164



>ref|XP_006429441.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
 gb|ESR42681.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
Length=488

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 5/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVHS----TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+A+ P   V+T+ S    TP+  + +E+TLGRHLARRLVQIG TDVFSVPGDFNLTLLD
Sbjct  17   DLASPPNGAVSTIQSSVPATPLV-NPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLD  75

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  76   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  135

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  136  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_002870931.1| hypothetical protein ARALYDRAFT_486945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47190.1| hypothetical protein ARALYDRAFT_486945 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   218 bits (556),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GDV + P+  V T+  +    +++EATLGRHLARRLVQ GVTD+FSVPGDFNLTLLDHL
Sbjct  15   TGDVGSPPSNAVATIQDSAPTTATSEATLGRHLARRLVQAGVTDIFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  75   IAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  IVGGPNSNDFGTNRILHHTIGLPDFSQ  161



>gb|KJB36955.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
Length=555

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S DV     + V+T+  +  P    S+EATLGRHLARRLVQIG++DVFSVPGDFNLTLLD
Sbjct  15   SNDVCCPANVTVSTIQGSVSPTIIKSSEATLGRHLARRLVQIGISDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  75   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_009385546.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=603

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            S DV   P+   +T+  + VA SS +ATLGRHLARRLVQ+GVTDVF+VPGDFNLTLLDHL
Sbjct  16   SNDVGGLPSATCHTLSPSAVACSS-DATLGRHLARRLVQLGVTDVFAVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGLRLIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLIC
Sbjct  75   IAEPGLRLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  135  IVGGPNTNDYGTNRILHHTIGLPDFSQ  161



>ref|XP_006362373.1| PREDICTED: pyruvate decarboxylase 2-like [Solanum tuberosum]
Length=603

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GD+AN PT    T+ ++ + F+S ++TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL
Sbjct  15   NGDIANVPTNKAVTIQNSTIPFNSPDSTLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L LIGCCNELNAGYAADGYARARG+GACVVTFTVGGLS++NAIAGAYSENLPLIC
Sbjct  75   IAEPELNLIGCCNELNAGYAADGYARARGIGACVVTFTVGGLSIVNAIAGAYSENLPLIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIGL DF+Q
Sbjct  135  IVGGPNSNDYGTNRILHHTIGLHDFSQ  161



>ref|XP_011094440.1| PREDICTED: pyruvate decarboxylase 1-like [Sesamum indicum]
Length=609

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIG-VNTVH--STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            DV   P+ G V+T+   S+ V F+SAE TLGRHLARRLVQIGV+DVFSVPGDFNLTLLDH
Sbjct  20   DVGALPSNGIVSTIQFQSSAVPFNSAEPTLGRHLARRLVQIGVSDVFSVPGDFNLTLLDH  79

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEPGL LIGCCNELNAGYAADGYARARGVGACVVTFTVGGLS+LNAIAGAYSENLP+I
Sbjct  80   LIAEPGLNLIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSILNAIAGAYSENLPVI  139

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  140  CIVGGPNSNDYGTNRILHHTIGLPDFSQ  167



>sp|A2XFI3.2|PDC2_ORYSI RecName: Full=Pyruvate decarboxylase 2; Short=PDC [Oryza sativa 
Indica Group]
 gb|EEC75031.1| hypothetical protein OsI_11123 [Oryza sativa Indica Group]
Length=606

 Score =   217 bits (553),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  APTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGL  328
            A  +G     + P   S+ EA+LGRHLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGL
Sbjct  24   ASAVGCPMTSARPAPVSAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGL  83

Query  329  RLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPN  508
            RL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI GGPN
Sbjct  84   RLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAGGPN  143

Query  509  SNDYGTNRILHHTIGLPDFTQ  571
            SNDYGTNRILHHTIGLPDF+Q
Sbjct  144  SNDYGTNRILHHTIGLPDFSQ  164



>ref|NP_001049811.1| Os03g0293500 [Oryza sativa Japonica Group]
 sp|Q10MW3.1|PDC2_ORYSJ RecName: Full=Pyruvate decarboxylase 2; Short=PDC [Oryza sativa 
Japonica Group]
 gb|ABF95411.1| Pyruvate decarboxylase isozyme 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11725.1| Os03g0293500 [Oryza sativa Japonica Group]
 gb|ACA50507.1| pyruvate decarboxylase isozyme 2 [Oryza sativa Japonica Group]
 dbj|BAG95142.1| unnamed protein product [Oryza sativa Japonica Group]
Length=605

 Score =   217 bits (553),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  APTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGL  328
            A  +G     + P   S+ EA+LGRHLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGL
Sbjct  24   ASAVGCPMTSARPAPVSAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGL  83

Query  329  RLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPN  508
            RL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI GGPN
Sbjct  84   RLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAGGPN  143

Query  509  SNDYGTNRILHHTIGLPDFTQ  571
            SNDYGTNRILHHTIGLPDF+Q
Sbjct  144  SNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_010423945.1| PREDICTED: pyruvate decarboxylase 4 [Camelina sativa]
Length=603

 Score =   217 bits (552),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 118/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GDV + P+  + T+       +++EATLGRHLARRLVQ GVTD+FSVPGDFNLTLLDHL
Sbjct  15   TGDVGSPPSNAIATIQDCAPTTATSEATLGRHLARRLVQAGVTDIFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  75   IAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  IVGGPNSNDFGTNRILHHTIGLPDFSQ  161



>ref|XP_006283364.1| hypothetical protein CARUB_v10004406mg [Capsella rubella]
 gb|EOA16262.1| hypothetical protein CARUB_v10004406mg [Capsella rubella]
Length=607

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GDV + P   V T+H S P   ++ SS +ATLGRHLARRLVQ GVTDVFSVPGDFNLTL
Sbjct  15   TGDVGSPPNGAVATIHDSVPPSAISVSSCDATLGRHLARRLVQAGVTDVFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  PLICIVGGPNSNDYGTNRILHHTIGLPDFSQ  165



>gb|KJB36954.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
 gb|KJB36956.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
Length=605

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S DV     + V+T+  +  P    S+EATLGRHLARRLVQIG++DVFSVPGDFNLTLLD
Sbjct  15   SNDVCCPANVTVSTIQGSVSPTIIKSSEATLGRHLARRLVQIGISDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  75   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_006281555.1| hypothetical protein CARUB_v10027657mg [Capsella rubella]
 gb|EOA14453.1| hypothetical protein CARUB_v10027657mg [Capsella rubella]
Length=607

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 136/149 (91%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+   P  GV+TV  S+P+   A +S +ATLGR+LARRLV+IGVTDVFSVPGDFNLTLLD
Sbjct  17   DIGGPPNGGVSTVQNSSPLHSTAITSCDATLGRYLARRLVEIGVTDVFSVPGDFNLTLLD  76

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  77   HLIAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  136

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  137  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>ref|XP_002867205.1| hypothetical protein ARALYDRAFT_491381 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43464.1| hypothetical protein ARALYDRAFT_491381 [Arabidopsis lyrata subsp. 
lyrata]
Length=607

 Score =   217 bits (552),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GDV + P   V+T+H    S+ +  +S ++T+GR++ARRLVQ GVTD+FSVPGDFNLTL
Sbjct  15   NGDVGSPPNGAVSTIHNSVPSSAITVNSCDSTIGRYIARRLVQAGVTDIFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  PLICIVGGPNSNDYGTNRILHHTIGLPDFSQ  165



>ref|XP_010432620.1| PREDICTED: pyruvate decarboxylase 1-like [Camelina sativa]
Length=609

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 5/152 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH-----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
            +GDV + P + V T+H     S+ ++ +S +ATLGRHLARRLVQ GVTD+FSVPGDFNLT
Sbjct  16   NGDVGSPPNVTVKTIHDSVVPSSAISVNSCDATLGRHLARRLVQSGVTDIFSVPGDFNLT  75

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  76   LLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  135

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  136  LPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  167



>gb|KJB36951.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
 gb|KJB36953.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
Length=605

 Score =   216 bits (551),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 122/150 (81%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  301
             S DV +     V+T+  +  P   + +EATLGRHLARRLVQIGV DVFSVPGDFNLTLL
Sbjct  14   ASNDVCSPVNGTVSTIQGSVYPAVVNFSEATLGRHLARRLVQIGVNDVFSVPGDFNLTLL  73

Query  302  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  481
            DHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSE+LP
Sbjct  74   DHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSESLP  133

Query  482  LICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LICIVGGPNSNDYGTNRILHHT+GLPDF+Q
Sbjct  134  LICIVGGPNSNDYGTNRILHHTVGLPDFSQ  163



>gb|KFK27091.1| hypothetical protein AALP_AA8G333000 [Arabis alpina]
Length=607

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            SG +   P  GV+T+  STP    A S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLTL
Sbjct  15   SGVIGGPPNGGVSTIQNSTPSHSTAISPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHL+AEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLVAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  135  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>ref|XP_010033739.1| PREDICTED: pyruvate decarboxylase 1 [Eucalyptus grandis]
 gb|KCW88158.1| hypothetical protein EUGRSUZ_A00547 [Eucalyptus grandis]
Length=606

 Score =   216 bits (550),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 119/148 (80%), Positives = 131/148 (89%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            DV + P    + +  +   P A  S ++T+GRHLARRLVQIGVTDVFSVPGDFNLTLLDH
Sbjct  17   DVGSPPNGAASAIQGSAPGPAAVGSPDSTMGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEPGL L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP++
Sbjct  77   LIAEPGLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVV  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  137  CIVGGPNSNDYGTNRVLHHTIGLPDFSQ  164



>ref|XP_010264586.1| PREDICTED: pyruvate decarboxylase 2 [Nelumbo nucifera]
Length=606

 Score =   216 bits (550),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 121/148 (82%), Positives = 132/148 (89%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            DV + P  G  +V    +TP   SS++ATLGRHLARRL QIGVTDVFSVPGDFNLTLLDH
Sbjct  17   DVGSIPQNGAVSVVQNSATPAVVSSSDATLGRHLARRLAQIGVTDVFSVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEP L++IGCCNELNAGYAADGYAR+RGVGACVVTF+VGGLSVLNAIAGA SENLP+I
Sbjct  77   LIAEPALKVIGCCNELNAGYAADGYARSRGVGACVVTFSVGGLSVLNAIAGACSENLPII  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  CIVGGPNSNDYGTNRILHHTIGLPDFSQ  164



>emb|CDY17293.1| BnaA10g09270D [Brassica napus]
Length=607

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 136/152 (89%), Gaps = 4/152 (3%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTVHSTPVAFSSA----EATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
             +GD+   P   V+TV ++P A S+     +ATLGR+LARRLV+IGVTDVFSVPGDFNLT
Sbjct  14   ATGDICRPPNGTVSTVQTSPPAHSTTISPCDATLGRYLARRLVEIGVTDVFSVPGDFNLT  73

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  74   LLDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  133

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LPLICIVGGPNSNDYGT+RILHHTIGLPDFTQ
Sbjct  134  LPLICIVGGPNSNDYGTSRILHHTIGLPDFTQ  165



>gb|AAL99745.1| pyruvate decarboxylase [Zea mays]
 tpg|DAA44860.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=605

 Score =   216 bits (550),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  SQGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +Q  G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV DVF+VPGDFNLTL
Sbjct  14   NQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVNDVFAVPGDFNLTL  73

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  74   LDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  133

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  PVICIAGGPNSNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_009120024.1| PREDICTED: pyruvate decarboxylase 2 [Brassica rapa]
Length=607

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSA----EATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GD+   P   V+TV ++P A S+     +ATLGR+LARRLV+IGVTDVFSVPGDFNLTL
Sbjct  15   TGDICRPPNGTVSTVQTSPPAHSTTISPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGT+RILHHTIGLPDFTQ
Sbjct  135  PLICIVGGPNSNDYGTSRILHHTIGLPDFTQ  165



>ref|XP_002866069.1| pyruvate decarboxylase-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42328.1| pyruvate decarboxylase-2 [Arabidopsis lyrata subsp. lyrata]
Length=607

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 134/149 (90%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+   P  GV+TV  S+P   +  S  EATLGR+LARRLV+IGVTDVFSVPGDFNLTLLD
Sbjct  17   DIGGPPNGGVSTVQNSSPLHSITVSPCEATLGRYLARRLVEIGVTDVFSVPGDFNLTLLD  76

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  77   HLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  136

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  137  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>ref|NP_001105052.1| pyruvate decarboxylase 3 [Zea mays]
 gb|AAL99744.1| pyruvate decarboxylase [Zea mays]
 gb|ACG43025.1| pyruvate decarboxylase isozyme 2 [Zea mays]
 gb|ACL54676.1| unknown [Zea mays]
 tpg|DAA44863.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=606

 Score =   216 bits (550),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  SQGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +Q  G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV DVF+VPGDFNLTL
Sbjct  14   NQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVNDVFAVPGDFNLTL  73

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  74   LDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  133

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  PVICIAGGPNSNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_010451999.1| PREDICTED: pyruvate decarboxylase 4-like [Camelina sativa]
Length=603

 Score =   216 bits (549),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GDV + P+  V T+  +    +++EATLGRHLARRLVQ  VTD+FSVPGDFNLTLLDHL
Sbjct  15   TGDVGSPPSNAVATIQDSVPTTATSEATLGRHLARRLVQAEVTDIFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  75   IAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  IVGGPNSNDFGTNRILHHTIGLPDFSQ  161



>ref|XP_007026634.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07136.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=605

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S DV + P   V T+  +  P   +S EATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLD
Sbjct  15   STDVGSPPNGTVATIQGSVSPTVINSCEATLGRHLARRLVQVGVTDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  75   HLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRVLHHTIGLPDFSQ  163



>ref|NP_195752.1| pyruvate decarboxylase 4 [Arabidopsis thaliana]
 sp|Q9M040.1|PDC4_ARATH RecName: Full=Pyruvate decarboxylase 4; Short=AtPDC4 [Arabidopsis 
thaliana]
 emb|CAB81915.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED90327.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=603

 Score =   215 bits (548),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GD+ + P+  V T+  +    +++E+TLGRHL+RRLVQ GVTDVFSVPGDFNLTLLDHL
Sbjct  15   TGDIGSPPSNAVATIQDSAPITTTSESTLGRHLSRRLVQAGVTDVFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  75   IAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  IVGGPNSNDFGTNRILHHTIGLPDFSQ  161



>gb|ACL52480.1| unknown [Zea mays]
 tpg|DAA44861.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=448

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  SQGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +Q  G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV DVF+VPGDFNLTL
Sbjct  14   NQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVNDVFAVPGDFNLTL  73

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  74   LDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  133

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  PVICIAGGPNSNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_010676788.1| PREDICTED: pyruvate decarboxylase 2 [Beta vulgaris subsp. vulgaris]
Length=607

 Score =   215 bits (548),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 5/147 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GDV+   T+  +  H  P+A    E+TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHL
Sbjct  24   NGDVS---TLQSSAPHGAPIA--PPESTLGRHLARRLVQIGVNDVFSVPGDFNLTLLDHL  78

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            +AEPGL L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  79   LAEPGLNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  138

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  139  IVGGPNSNDYGTNRVLHHTIGLPDFSQ  165



>gb|AAP96920.1| pyruvate decarboxylase [Dianthus caryophyllus]
Length=605

 Score =   215 bits (548),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  VHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNE  352
            +H+ P   +  E+TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHL+AEPGL L+GCCNE
Sbjct  31   LHAPPTTHAPPESTLGRHLARRLVQIGVNDVFSVPGDFNLTLLDHLLAEPGLNLVGCCNE  90

Query  353  LNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNR  532
            LNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNR
Sbjct  91   LNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNR  150

Query  533  ILHHTIGLPDFTQ  571
            +LHHTIGLPDF+Q
Sbjct  151  VLHHTIGLPDFSQ  163



>ref|XP_010922580.1| PREDICTED: pyruvate decarboxylase 2-like [Elaeis guineensis]
Length=604

 Score =   215 bits (548),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV + P I  + +     +   A ATLGRHLARRLVQ+G  DVFSVPGDFNLTLLDHLIA
Sbjct  18   DVGSLPAIACHPISPAAASICEAGATLGRHLARRLVQVGANDVFSVPGDFNLTLLDHLIA  77

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL +IGCCNELNAGYAADGYAR+RGVGACVVTF+VGGLSVLNAIAGAYSENLP+ICIV
Sbjct  78   EPGLNIIGCCNELNAGYAADGYARSRGVGACVVTFSVGGLSVLNAIAGAYSENLPVICIV  137

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  138  GGPNSNDYGTNRILHHTIGLPDFSQ  162



>dbj|BAJ94428.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=606

 Score =   215 bits (547),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 133/151 (88%), Gaps = 2/151 (1%)
 Frame = +2

Query  119  VSQGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            V+   G  A+AP   + + H  P A  + EA+LGRHLARRLVQ+GV+DVF+VPGDFNLTL
Sbjct  16   VNGAVGCPASAPGCPIMSSHPAPSA--AGEASLGRHLARRLVQVGVSDVFAVPGDFNLTL  73

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHL+AEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  74   LDHLVAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  133

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIG+PDF+Q
Sbjct  134  PVICIAGGPNSNDYGTNRILHHTIGVPDFSQ  164



>ref|XP_006398630.1| hypothetical protein EUTSA_v10013008mg [Eutrema salsugineum]
 gb|ESQ40083.1| hypothetical protein EUTSA_v10013008mg [Eutrema salsugineum]
Length=607

 Score =   215 bits (547),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 123/151 (81%), Positives = 134/151 (89%), Gaps = 4/151 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +GDV +     V T++ S P   +AF S+EATLGRHLARRLVQ GVTD+FSVPGDFNLTL
Sbjct  15   NGDVCSPSNGAVATINDSAPAPSIAFGSSEATLGRHLARRLVQAGVTDIFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  PVICIVGGPNSNDFGTNRILHHTIGLPDFSQ  165



>ref|XP_010558370.1| PREDICTED: pyruvate decarboxylase 1-like [Tarenaya hassleriana]
 ref|XP_010558371.1| PREDICTED: pyruvate decarboxylase 1-like [Tarenaya hassleriana]
Length=603

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            G+V + P   V+T+ +   AF  ++ATLGRH+ARRLVQ+GVTDVFSVPGDFNLTLLDHLI
Sbjct  16   GEVGSPPNGAVSTIQNYVSAFGPSDATLGRHVARRLVQVGVTDVFSVPGDFNLTLLDHLI  75

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L LIGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  76   AEPELNLIGCCNELNAGYAADGYARNRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  135

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLP+F+Q
Sbjct  136  VGGPNSNDYGTNRILHHTIGLPNFSQ  161



>tpg|DAA44862.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=470

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  SQGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            +Q  G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV DVF+VPGDFNLTL
Sbjct  14   NQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVNDVFAVPGDFNLTL  73

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  74   LDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  133

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  PVICIAGGPNSNDYGTNRILHHTIGLPDFSQ  164



>ref|NP_200307.1| pyruvate decarboxylase-2 [Arabidopsis thaliana]
 sp|Q9FFT4.1|PDC2_ARATH RecName: Full=Pyruvate decarboxylase 2; Short=AtPDC2 [Arabidopsis 
thaliana]
 dbj|BAB08775.1| pyruvate decarboxylase [Arabidopsis thaliana]
 gb|AED96563.1| pyruvate decarboxylase-2 [Arabidopsis thaliana]
Length=607

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 8/151 (5%)
 Frame = +2

Query  137  DVANAPTIGVNTV------HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            D+   P  GV+TV      HST V  S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLTL
Sbjct  17   DIGGPPNGGVSTVQNTSPLHSTTV--SPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  135  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>gb|EPS58298.1| pyruvate decarboxylase, partial [Genlisea aurea]
Length=589

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  161  GVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIG  340
            GV TV S+ V FSS+EATLGRH+ARRLVQIG+ DVFSVPGDFNLTLLDHL+AEPGL L+G
Sbjct  11   GVCTVQSSAVPFSSSEATLGRHIARRLVQIGIRDVFSVPGDFNLTLLDHLLAEPGLNLVG  70

Query  341  CCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDY  520
            CCNE+NAGYAADGYARARGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPN+NDY
Sbjct  71   CCNEINAGYAADGYARARGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNTNDY  130

Query  521  GTNRILHHTIGLPDFTQ  571
            GTNRILHHTIG PDF+Q
Sbjct  131  GTNRILHHTIGSPDFSQ  147



>ref|XP_010482907.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Camelina sativa]
 ref|XP_010482908.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Camelina sativa]
Length=607

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+   P  GV+TV  S+P+   + S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLTLLD
Sbjct  17   DIGGPPNGGVSTVQNSSPLHSTSISPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTLLD  76

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPL
Sbjct  77   HLIAEPDLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPL  136

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  137  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>ref|XP_008805101.1| PREDICTED: pyruvate decarboxylase 1-like [Phoenix dactylifera]
Length=604

 Score =   214 bits (546),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV + P I  + +     +   + ATLGRHLARRLVQ+G +DVFSVPGDFNLTLLDHLIA
Sbjct  18   DVGSLPAIACHPISPAVASICESGATLGRHLARRLVQVGASDVFSVPGDFNLTLLDHLIA  77

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL L+GCCNELNAGYAADGYAR+RGVGACVVTF+VGGLSVLNAIAGAYSENLP+ICIV
Sbjct  78   EPGLTLVGCCNELNAGYAADGYARSRGVGACVVTFSVGGLSVLNAIAGAYSENLPVICIV  137

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  138  GGPNSNDYGTNRILHHTIGLPDFSQ  162



>gb|AAB16855.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=607

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 8/151 (5%)
 Frame = +2

Query  137  DVANAPTIGVNTV------HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            D+   P  GV+TV      HST V  S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLTL
Sbjct  17   DIGGPPNGGVSTVQNTSPLHSTTV--SPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  135  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>gb|AIL23783.1| pyruvate decarboxylase [Prunus serrulata]
Length=605

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  104  DQSKLVSQGSGDVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPG  280
            D  K  S   G + N   + + N+V ST +  +S+EATLGRHLARRLVQIGVTDVF+VPG
Sbjct  9    DVCKPASNEVGSLPNGTAMAIQNSVPSTVI--NSSEATLGRHLARRLVQIGVTDVFTVPG  66

Query  281  DFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAG  460
            DFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAG
Sbjct  67   DFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAG  126

Query  461  AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  127  AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  163



>ref|XP_010437810.1| PREDICTED: pyruvate decarboxylase 1 [Camelina sativa]
Length=608

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 5/152 (3%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVH-----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
            +GDV + P   V T+H     S+ ++ +S +ATLGRHLARRLVQ GVTD+FSVPGDFNLT
Sbjct  15   NGDVGSPPNSTVKTIHDSVVPSSAISVNSCDATLGRHLARRLVQSGVTDIFSVPGDFNLT  74

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  75   LLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  134

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  LPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  166



>gb|EMT10366.1| Pyruvate decarboxylase isozyme 2 [Aegilops tauschii]
Length=406

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            S P    S EATLGRHLARRLVQ+GV DVF+VPGDFNLTLLD+L+AEPGLRL+GCCNELN
Sbjct  28   SAPTFVGSPEATLGRHLARRLVQVGVGDVFAVPGDFNLTLLDYLVAEPGLRLVGCCNELN  87

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARA+GVGAC VTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL
Sbjct  88   AGYAADGYARAKGVGACAVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  147

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  148  HHTIGLPDFSQ  158



>ref|XP_004246778.1| PREDICTED: pyruvate decarboxylase 1 [Solanum lycopersicum]
Length=600

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +GD+AN PT    T+ ++ + F+S ++TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL
Sbjct  12   NGDIANVPTNKAVTIQNSTIPFNSPDSTLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  71

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L LIGCCNELNAGYAADGYARARG+GACVVTFTVGGLS++NAIAGAYSENLPLIC
Sbjct  72   IAEPELNLIGCCNELNAGYAADGYARARGIGACVVTFTVGGLSIVNAIAGAYSENLPLIC  131

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            +VGGPNSNDYGTN ILHHTIGL DF+Q
Sbjct  132  MVGGPNSNDYGTNTILHHTIGLHDFSQ  158



>emb|CDY19880.1| BnaC09g31460D [Brassica napus]
Length=607

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 134/152 (88%), Gaps = 4/152 (3%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
             +GD+   P   V+TV  STP      S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLT
Sbjct  14   ATGDICRPPNGAVSTVQNSTPAHSTTISPCDATLGRYLARRLVEIGVTDVFSVPGDFNLT  73

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  74   LLDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  133

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LPLICIVGGPNSNDYGT+RILHHTIGLPDFTQ
Sbjct  134  LPLICIVGGPNSNDYGTSRILHHTIGLPDFTQ  165



>ref|XP_004984863.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=610

 Score =   214 bits (544),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 121/153 (79%), Positives = 134/153 (88%), Gaps = 5/153 (3%)
 Frame = +2

Query  128  GSGDV----ANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNL  292
            G+G V    A+AP   + +  + P A   + EA+LGRHLARRLVQ+GV+DVF+VPGDFNL
Sbjct  16   GNGTVVGCPASAPGCPMASTPAQPAATLPAGEASLGRHLARRLVQVGVSDVFAVPGDFNL  75

Query  293  TLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSE  472
            TLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSE
Sbjct  76   TLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSE  135

Query  473  NLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            NLP+ICI GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  136  NLPVICIAGGPNSNDYGTNRILHHTIGLPDFSQ  168



>ref|XP_008775408.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Phoenix dactylifera]
Length=605

 Score =   214 bits (544),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = +2

Query  185  PVAFSSA--EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            PVA +S   EATLGRHLARRLVQ+GV DVFSVPGDFNLTLLDHL+AEPGLRL+GCCNELN
Sbjct  33   PVAPASGLGEATLGRHLARRLVQVGVNDVFSVPGDFNLTLLDHLLAEPGLRLVGCCNELN  92

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  93   AGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  152

Query  539  HHTIGLPDFTQ  571
            HHTIGL DFTQ
Sbjct  153  HHTIGLSDFTQ  163



>gb|AAG22488.1|AF195868_1 pyruvate decarboxylase 1 [Vitis vinifera]
Length=575

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  182  TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNa  361
             P   SS+EATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNA
Sbjct  4    APSVISSSEATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNA  63

Query  362  gyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILH  541
            GYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILH
Sbjct  64   GYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILH  123

Query  542  HTIGLPDFTQ  571
            HTIGLPDF+Q
Sbjct  124  HTIGLPDFSQ  133



>ref|XP_002465414.1| hypothetical protein SORBIDRAFT_01g038360 [Sorghum bicolor]
 gb|EER92412.1| hypothetical protein SORBIDRAFT_01g038360 [Sorghum bicolor]
Length=610

 Score =   213 bits (543),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 117/144 (81%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  143  ANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAE  319
            A+AP   + +  + P +  S+ EA+LGRHLARRLVQ+GV DVF+VPGDFNLTLLDHLIAE
Sbjct  25   ASAPGCPMASTPAQPASTLSAGEASLGRHLARRLVQVGVNDVFAVPGDFNLTLLDHLIAE  84

Query  320  PGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVG  499
            PGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI G
Sbjct  85   PGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAG  144

Query  500  GPNSNDYGTNRILHHTIGLPDFTQ  571
            GPNSNDYGTNRILHHTIG+PDF+Q
Sbjct  145  GPNSNDYGTNRILHHTIGIPDFSQ  168



>ref|XP_008775409.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   213 bits (542),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = +2

Query  185  PVAFSSA--EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            PVA +S   EATLGRHLARRLVQ+GV DVFSVPGDFNLTLLDHL+AEPGLRL+GCCNELN
Sbjct  33   PVAPASGLGEATLGRHLARRLVQVGVNDVFSVPGDFNLTLLDHLLAEPGLRLVGCCNELN  92

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  93   AGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  152

Query  539  HHTIGLPDFTQ  571
            HHTIGL DFTQ
Sbjct  153  HHTIGLSDFTQ  163



>ref|XP_009789106.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana sylvestris]
Length=625

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  140  VANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAE  319
            VAN P     T+ ++ V F+S ++TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL++E
Sbjct  40   VANLPAQNAVTIQTSTVPFNSPDSTLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLVSE  99

Query  320  PGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVG  499
            P L L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVG
Sbjct  100  PELNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVG  159

Query  500  GPNSNDYGTNRILHHTIGLPDFTQ  571
            GPNSNDYGTNRILHHTIGL DF+Q
Sbjct  160  GPNSNDYGTNRILHHTIGLQDFSQ  183



>dbj|BAK04101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score =   213 bits (542),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 117/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            S+P    S EATLGRHLARRLVQIGV DVF+VPGDFNLTLLDHLIAEP LRL+GCCNELN
Sbjct  28   SSPTFIGSPEATLGRHLARRLVQIGVGDVFAVPGDFNLTLLDHLIAEPRLRLVGCCNELN  87

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNR+ 
Sbjct  88   AGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRVP  147

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  148  HHTIGLPDFSQ  158



>gb|AIE47264.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=588

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  182  TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNa  361
            +P   +S E+TLGRHLARRLVQIG+TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNA
Sbjct  17   SPAVINSTESTLGRHLARRLVQIGITDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNA  76

Query  362  gyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILH  541
            GYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILH
Sbjct  77   GYAADGYARCRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILH  136

Query  542  HTIGLPDFTQ  571
            HTIGLPDF+Q
Sbjct  137  HTIGLPDFSQ  146



>ref|XP_006401505.1| hypothetical protein EUTSA_v10013010mg [Eutrema salsugineum]
 gb|ESQ42958.1| hypothetical protein EUTSA_v10013010mg [Eutrema salsugineum]
Length=607

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSA----EATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  301
            GD+   P  GV+T+ ++  A S+     +ATLGR+LARRLV+IGV DVFSVPGDFNLTLL
Sbjct  16   GDIGGPPNGGVSTIQNSSPAHSTTVSPCDATLGRYLARRLVEIGVNDVFSVPGDFNLTLL  75

Query  302  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  481
            DHL+AEP L+L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP
Sbjct  76   DHLLAEPNLKLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLP  135

Query  482  LICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  136  LICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>gb|KJB36952.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
Length=480

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S DV +     V+T+  +  P   + +EATLGRHLARRLVQIGV DVFSVPGDFNLTLLD
Sbjct  15   SNDVCSPVNGTVSTIQGSVYPAVVNFSEATLGRHLARRLVQIGVNDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSE+LPL
Sbjct  75   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSESLPL  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHT+GLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTVGLPDFSQ  163



>ref|XP_008779570.1| PREDICTED: pyruvate decarboxylase 2-like, partial [Phoenix dactylifera]
Length=200

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            DV + P    +          +AEATLGRHLARRLVQ+GV DVFSVPGDFNLTLLDHL+A
Sbjct  18   DVGSLPAAACHPTSPAAAPMCAAEATLGRHLARRLVQVGVNDVFSVPGDFNLTLLDHLLA  77

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIV
Sbjct  78   EPGLNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIV  137

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  138  GGPNSNDYGTNRILHHTIGLPDFSQ  162



>gb|KDP22863.1| hypothetical protein JCGZ_00450 [Jatropha curcas]
Length=605

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            +GD+ + P   V+T+  +  P   +  ++TLGRHLARRLVQIGV+DVFSVPGDFNLTLLD
Sbjct  15   NGDLCSPPNSTVSTIQGSVSPTFHTPPDSTLGRHLARRLVQIGVSDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  75   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_010443084.1| PREDICTED: pyruvate decarboxylase 2-like [Camelina sativa]
Length=607

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 135/149 (91%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+   P  GV+TV  S+P+   + S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLTLLD
Sbjct  17   DIGGPPNGGVSTVQNSSPLHSTSISPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTLLD  76

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HL+AEPGL+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGA SENLPL
Sbjct  77   HLMAEPGLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGANSENLPL  136

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  137  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  165



>emb|CDY69899.1| BnaA01g37380D, partial [Brassica napus]
Length=279

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 129/151 (85%), Gaps = 10/151 (7%)
 Frame = +2

Query  131  SGDVA--NAPTIGVNTVHSTP--VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            SGDV   N P      V STP  V   S+ ATLGRHLA RLV+IGV DVFSVPGDFNLTL
Sbjct  15   SGDVVRPNGP------VQSTPRTVFTDSSNATLGRHLAHRLVEIGVNDVFSVPGDFNLTL  68

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENL
Sbjct  69   LDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENL  128

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGL DF Q
Sbjct  129  PLICIVGGPNSNDYGTNRILHHTIGLSDFRQ  159



>ref|XP_011046856.1| PREDICTED: pyruvate decarboxylase 2 [Populus euphratica]
Length=605

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S D+ N     V  + S+  P   +S+EATLGRHLARRLVQIGV DVFSVPGDFNLTLLD
Sbjct  15   SNDMINPTNGAVAAIQSSVSPTVINSSEATLGRHLARRLVQIGVNDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  75   HLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_007208309.1| hypothetical protein PRUPE_ppa003086mg [Prunus persica]
 gb|AEA06512.1| pyruvate decarboxylase [Prunus dulcis x Prunus persica]
 gb|AEA06513.1| pyruvate decarboxylase [Prunus cerasifera]
 gb|EMJ09508.1| hypothetical protein PRUPE_ppa003086mg [Prunus persica]
Length=605

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 137/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  104  DQSKLVSQGSGDVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPG  280
            D  K  S   G + N   + + N+V ST +  +S+EATLGRHLARRLVQIGVTDVF+VPG
Sbjct  9    DVCKPASNEVGSLPNGTAMAIQNSVPSTVI--NSSEATLGRHLARRLVQIGVTDVFTVPG  66

Query  281  DFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAG  460
            DFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAG
Sbjct  67   DFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAG  126

Query  461  AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            AYSENLPLICIVGGPNSNDYGT+RILHHTIGLPDFTQ
Sbjct  127  AYSENLPLICIVGGPNSNDYGTSRILHHTIGLPDFTQ  163



>ref|NP_001055803.1| Os05g0469600 [Oryza sativa Japonica Group]
 sp|Q0DHF6.1|PDC1_ORYSJ RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Oryza sativa 
Japonica Group]
 gb|AAT93945.1| putative pyruvate decarboxylase [Oryza sativa Japonica Group]
 dbj|BAF17717.1| Os05g0469600 [Oryza sativa Japonica Group]
 dbj|BAG94713.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94986.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64045.1| hypothetical protein OsJ_18874 [Oryza sativa Japonica Group]
Length=605

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  140  VANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAE  319
            V + P +  N V + PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLLD+LIAE
Sbjct  21   VGSLPVVSSNAVINPPVT-SAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAE  79

Query  320  PGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVG  499
            PGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVG
Sbjct  80   PGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVG  139

Query  500  GPNSNDYGTNRILHHTIGLPDFTQ  571
            GPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  140  GPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_010543216.1| PREDICTED: pyruvate decarboxylase 1 [Tarenaya hassleriana]
Length=604

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHST-PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            GDV       V+T+ S+ P + ++++ATLGRH+ARRLVQ+GVTDVFSVPGDFNLTLLDHL
Sbjct  16   GDVICPQNGAVSTIQSSFPASDAASDATLGRHVARRLVQVGVTDVFSVPGDFNLTLLDHL  75

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  76   IAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  135

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  136  IVGGPNSNDYGTNRILHHTIGLPDFSQ  162



>gb|EAY98380.1| hypothetical protein OsI_20291 [Oryza sativa Indica Group]
Length=605

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +2

Query  95   LRSDQSKLVSQGSGD-VANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFS  271
            L  D S  V++ S D V + P +    V   PV  S+A ATLGRHLARRLVQIG TDVF+
Sbjct  5    LVGDPSNGVAKPSCDSVGSLPAVSSKAVIHPPVT-SAAGATLGRHLARRLVQIGATDVFA  63

Query  272  VPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNA  451
            VPGDFNLTLLD+LIAEPGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNA
Sbjct  64   VPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNA  123

Query  452  IAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  124  IAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>dbj|BAC20138.1| pyruvate decarboxylase [Oryza sativa]
 gb|AAT93946.1| putative pyruvate decarboxylase [Oryza sativa Japonica Group]
 gb|EEE64046.1| hypothetical protein OsJ_18875 [Oryza sativa Japonica Group]
Length=605

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +2

Query  95   LRSDQSKLVSQGSGD-VANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFS  271
            L  D S  V++ S D V + P +    V   PV  S+A ATLGRHLARRLVQIG TDVF+
Sbjct  5    LVGDPSNGVAKPSCDSVGSLPAVSSKAVIHPPVT-SAAGATLGRHLARRLVQIGATDVFA  63

Query  272  VPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNA  451
            VPGDFNLTLLD+LIAEPGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNA
Sbjct  64   VPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNA  123

Query  452  IAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  124  IAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>gb|AAG13131.1|AF193791_1 pyruvate decarboxylase [Fragaria x ananassa]
Length=605

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 132/147 (90%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STP-VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV   P    +TV  S P  + SSA+ATLGRHLARRLVQIGVTDVF+VPGDFNLTLLDHL
Sbjct  17   DVGCLPNSATSTVQNSVPSTSLSSADATLGRHLARRLVQIGVTDVFTVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  77   IAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  IVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>sp|A2Y5L9.1|PDC1_ORYSI RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Oryza sativa 
Indica Group]
 gb|EAY98379.1| hypothetical protein OsI_20290 [Oryza sativa Indica Group]
Length=605

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  140  VANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAE  319
            V + P +  N V   PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLLD+LIAE
Sbjct  21   VGSLPVVSSNAVIHPPVT-SAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAE  79

Query  320  PGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVG  499
            PGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVG
Sbjct  80   PGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVG  139

Query  500  GPNSNDYGTNRILHHTIGLPDFTQ  571
            GPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  140  GPNSNDYGTNRILHHTIGLPDFSQ  163



>gb|AAB16854.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=606

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 6/152 (4%)
 Frame = +2

Query  131  SGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
            +GDV  +PT G      N+V S+ +  +  +ATLGRHLARRLVQ GVTDVFSVPGDFNLT
Sbjct  15   NGDVC-SPTNGTVATIHNSVPSSAITINYCDATLGRHLARRLVQAGVTDVFSVPGDFNLT  73

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  74   LLDHLMAEPDLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  133

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LPLICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  LPLICIVGGPNSNDYGTNRILHHTIGLPDFSQ  165



>gb|ABZ79223.1| pyruvate decarboxylase [Prunus armeniaca]
Length=605

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  104  DQSKLVSQGSGDVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPG  280
            D  K  S   G + N   + + N+V ST +  +S+EATLGRHLARRLVQIGVTDVF+VPG
Sbjct  9    DVCKPASNEVGSLPNGTAMAIQNSVPSTVI--NSSEATLGRHLARRLVQIGVTDVFTVPG  66

Query  281  DFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAG  460
            DFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAG
Sbjct  67   DFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAG  126

Query  461  AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            AYSENLPLICIVGGPNSNDYGT+RILHHTIGLPDF+Q
Sbjct  127  AYSENLPLICIVGGPNSNDYGTSRILHHTIGLPDFSQ  163



>ref|XP_006350849.1| PREDICTED: pyruvate decarboxylase 2-like [Solanum tuberosum]
Length=613

 Score =   211 bits (537),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            D AN  T  +   HS+ V  +S +ATLGRHLARRL++IGV DVFSVPGDFNLTLLDHLIA
Sbjct  2    DNANGTTSCIQNSHSSSV-IASPDATLGRHLARRLLEIGVEDVFSVPGDFNLTLLDHLIA  60

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EP L+ +GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIV
Sbjct  61   EPRLKNVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPIICIV  120

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  121  GGPNTNDYGTNRILHHTIGLPDFSQ  145



>ref|XP_009391704.1| PREDICTED: pyruvate decarboxylase 1 [Musa acuminata subsp. malaccensis]
Length=606

 Score =   211 bits (537),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + P     A+ATLGRH+ARRLVQ+G  DVFSVPGDFNLTLLDHLIAEPGLRL+GCCNELN
Sbjct  34   AAPTTAGPADATLGRHIARRLVQVGALDVFSVPGDFNLTLLDHLIAEPGLRLVGCCNELN  93

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  94   AGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  153

Query  539  HHTIGLPDFTQ  571
            HHTIGL DF+Q
Sbjct  154  HHTIGLSDFSQ  164



>ref|NP_195033.1| pyruvate decarboxylase 1 [Arabidopsis thaliana]
 sp|O82647.1|PDC1_ARATH RecName: Full=Pyruvate decarboxylase 1; Short=AtPDC1 [Arabidopsis 
thaliana]
 emb|CAA21216.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana]
 emb|CAB80024.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana]
 gb|AAL49793.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana]
 gb|AAM67459.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana]
 gb|AEE86169.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=607

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 6/152 (4%)
 Frame = +2

Query  131  SGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
            +GDV  +PT G      N+V S+ +  +  +ATLGRHLARRLVQ GVTDVFSVPGDFNLT
Sbjct  15   NGDVC-SPTNGTVATIHNSVPSSAITINYCDATLGRHLARRLVQAGVTDVFSVPGDFNLT  73

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  74   LLDHLMAEPDLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  133

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LPLICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  134  LPLICIVGGPNSNDYGTNRILHHTIGLPDFSQ  165



>ref|XP_004958794.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=605

 Score =   211 bits (537),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 120/143 (84%), Positives = 131/143 (92%), Gaps = 3/143 (2%)
 Frame = +2

Query  143  ANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEP  322
            A+AP  G   + S PV+ +  +ATLGRHLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEP
Sbjct  24   ASAP--GCPYLTSAPVS-TPGDATLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEP  80

Query  323  GLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGG  502
            GLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGG
Sbjct  81   GLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGG  140

Query  503  PNSNDYGTNRILHHTIGLPDFTQ  571
            PNSNDYGTNRILHHTIGL DF+Q
Sbjct  141  PNSNDYGTNRILHHTIGLADFSQ  163



>ref|XP_003558149.1| PREDICTED: pyruvate decarboxylase 2 [Brachypodium distachyon]
Length=608

 Score =   211 bits (536),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  119  VSQGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            V+   G  A+AP   + +    P A S+ +A+LGRHLARRLVQ+GV+DVF+VPGDFNLTL
Sbjct  16   VNGAVGCPASAPGCPIMSSQPAPAAGSAKDASLGRHLARRLVQVGVSDVFAVPGDFNLTL  75

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LD L+AEPGL L+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  76   LDDLVAEPGLNLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  135

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIG+PDF+Q
Sbjct  136  PVICIAGGPNSNDYGTNRILHHTIGIPDFSQ  166



>ref|XP_010529008.1| PREDICTED: pyruvate decarboxylase 2 [Tarenaya hassleriana]
Length=608

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 8/151 (5%)
 Frame = +2

Query  137  DVANAPTIGVNTV------HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            D+  +P  GV+ +      HS PV  S  +ATLGRHLARRLV+IGVTDVFSVPGDFNLTL
Sbjct  17   DIGGSPNGGVSVIQNSGPPHSVPV--SPCDATLGRHLARRLVEIGVTDVFSVPGDFNLTL  74

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEP L+L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  75   LDHLIAEPRLKLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  134

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICIVGGPNSNDYGT+RILHHTIGLPDF+Q
Sbjct  135  PVICIVGGPNSNDYGTSRILHHTIGLPDFSQ  165



>gb|KCW88160.1| hypothetical protein EUGRSUZ_A00549 [Eucalyptus grandis]
Length=614

 Score =   211 bits (536),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            DV + P      +  +   P   +S ++T+GRH+A RLVQIGVTDVF+VPGDFNLTLLDH
Sbjct  17   DVGSPPNGAAAAIQGSGPAPAVVASPDSTMGRHIAHRLVQIGVTDVFAVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEPGL L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP++
Sbjct  77   LIAEPGLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVV  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  137  CIVGGPNSNDYGTNRVLHHTIGLPDFSQ  164



>gb|KHN22554.1| Pyruvate decarboxylase isozyme 2 [Glycine soja]
Length=603

 Score =   210 bits (535),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTV-HSTP-VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  301
            G+ DV   P   V+ + +S P  A +S++ATLGRHLARRLVQ+GV DVFSVPGDFNLTLL
Sbjct  12   GNSDVGCPPNGTVSVIKNSVPATAITSSDATLGRHLARRLVQVGVKDVFSVPGDFNLTLL  71

Query  302  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  481
            DHLIAEP L+ +GCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV+NAIAGAYSENLP
Sbjct  72   DHLIAEPQLKNVGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVINAIAGAYSENLP  131

Query  482  LICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LICIVGGPN+ND+GTNRILHHTIGLPDF+Q
Sbjct  132  LICIVGGPNTNDFGTNRILHHTIGLPDFSQ  161



>ref|XP_010033533.1| PREDICTED: pyruvate decarboxylase 2 [Eucalyptus grandis]
 gb|KCW88161.1| hypothetical protein EUGRSUZ_A00549 [Eucalyptus grandis]
Length=606

 Score =   210 bits (535),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            DV + P      +  +   P   +S ++T+GRH+A RLVQIGVTDVF+VPGDFNLTLLDH
Sbjct  17   DVGSPPNGAAAAIQGSGPAPAVVASPDSTMGRHIAHRLVQIGVTDVFAVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEPGL L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP++
Sbjct  77   LIAEPGLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVV  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  137  CIVGGPNSNDYGTNRVLHHTIGLPDFSQ  164



>ref|XP_008388854.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate decarboxylase 1 [Malus 
domestica]
Length=474

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPV--AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV + P   V+ + S  +     S +ATLGRHLARRLVQIGVTDVF+VPGDFNLTLLDHL
Sbjct  17   DVGSFPNGVVSVIQSFALFTVIYSCDATLGRHLARRLVQIGVTDVFTVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLIC
Sbjct  77   IAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  137  IVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_004492473.1| PREDICTED: pyruvate decarboxylase isozyme 2-like isoform X2 [Cicer 
arietinum]
Length=603

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            S D+ + P              SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL
Sbjct  15   SNDIVSCPKANSTAAIQPCTIVSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLIC
Sbjct  75   IAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNR+LHHTIGL DF+Q
Sbjct  135  IVGGPNSNDYGTNRVLHHTIGLSDFSQ  161



>ref|XP_004492472.1| PREDICTED: pyruvate decarboxylase isozyme 2-like isoform X1 [Cicer 
arietinum]
Length=603

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            S D+ + P              SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL
Sbjct  15   SNDIVSCPKANSTAAIQPCTIVSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  74

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLIC
Sbjct  75   IAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLIC  134

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNR+LHHTIGL DF+Q
Sbjct  135  IVGGPNSNDYGTNRVLHHTIGLSDFSQ  161



>ref|XP_009123548.1| PREDICTED: pyruvate decarboxylase 1-like [Brassica rapa]
Length=600

 Score =   210 bits (534),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 125/151 (83%), Positives = 129/151 (85%), Gaps = 10/151 (7%)
 Frame = +2

Query  131  SGDVA--NAPTIGVNTVHSTP--VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            SGDV   N P      V STP  V   S+ ATLGRHLA RLV+IGV DVFSVPGDFNLTL
Sbjct  15   SGDVVRPNGP------VQSTPRTVFTDSSNATLGRHLAHRLVEIGVNDVFSVPGDFNLTL  68

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENL
Sbjct  69   LDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENL  128

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            PLICIVGGPNSNDYGTNRILHHTIGL DF Q
Sbjct  129  PLICIVGGPNSNDYGTNRILHHTIGLSDFRQ  159



>ref|XP_009402387.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   210 bits (534),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 120/148 (81%), Positives = 128/148 (86%), Gaps = 8/148 (5%)
 Frame = +2

Query  140  VANAPTIGVNTVHSTPVA----FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            V  +P  G    H  P+A     S+ E TLG HLARRLVQ+G  DVFS+PGDFNLTLLDH
Sbjct  19   VVGSPPAG----HCYPIAPAVQASAPEKTLGSHLARRLVQVGAHDVFSIPGDFNLTLLDH  74

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEPGLRLIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+I
Sbjct  75   LIAEPGLRLIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVI  134

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  135  CIVGGPNSNDFGTNRILHHTIGLPDFSQ  162



>ref|XP_008243339.1| PREDICTED: pyruvate decarboxylase 2 [Prunus mume]
Length=605

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  104  DQSKLVSQGSGDVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPG  280
            D  K  S   G + N   + + N+V ST +  +S+EATLGRHLARRLVQIGVTDVF+VPG
Sbjct  9    DVCKPASNEVGCLPNGTAMAIQNSVPSTVI--NSSEATLGRHLARRLVQIGVTDVFTVPG  66

Query  281  DFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAG  460
            DFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAG
Sbjct  67   DFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAG  126

Query  461  AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            AYSENLPLICIVGGPNSNDYGT+RILHHTIGLPDF+Q
Sbjct  127  AYSENLPLICIVGGPNSNDYGTSRILHHTIGLPDFSQ  163



>sp|A2YQ76.2|PDC3_ORYSI RecName: Full=Pyruvate decarboxylase 3; Short=PDC [Oryza sativa 
Indica Group]
Length=587

 Score =   209 bits (533),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            SS +ATLG HLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGLR++GCCNELNAGYAAD
Sbjct  20   SSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAAD  79

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARARGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYGTNRILHHTIGL
Sbjct  80   GYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  139

Query  557  PDFTQ  571
            PDF+Q
Sbjct  140  PDFSQ  144



>gb|AAO72533.1| pyruvate decarboxylase 1 [Lotus corniculatus]
Length=606

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A SS +ATLGRHLARRL QIGVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYA
Sbjct  38   AVSSCDATLGRHLARRLAQIGVTDVFSVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYA  97

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT+RILHHTI
Sbjct  98   ADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTSRILHHTI  157

Query  551  GLPDFTQ  571
            GLPDFTQ
Sbjct  158  GLPDFTQ  164



>ref|XP_002322997.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEF04758.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=605

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S D+ N     V  + S+  P   +++E+TLGRHLARRLVQIGV DVFSVPGDFNLTLLD
Sbjct  15   SNDMINPTNGAVAAIQSSVSPTIINASESTLGRHLARRLVQIGVNDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  75   HLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_009628441.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana tomentosiformis]
Length=603

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            +++N P     T+ +  V F+S  +TLGRHLARRL+QIGVTDVFSVPGDFNLTLLDHL++
Sbjct  17   EISNLPAQNAVTIQTPTVPFNSPYSTLGRHLARRLLQIGVTDVFSVPGDFNLTLLDHLVS  76

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EP L L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV
Sbjct  77   EPELNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIV  136

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPNSNDYGTNRILHHTIGL DF+Q
Sbjct  137  GGPNSNDYGTNRILHHTIGLQDFSQ  161



>ref|XP_010040425.1| PREDICTED: pyruvate decarboxylase 1-like, partial [Eucalyptus 
grandis]
Length=240

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDHL+ EPGL LIGCCNELNAGYA
Sbjct  75   ALGPSEATLGYHLARRLVEIGVGDVFSVPGDFNLSLLDHLVTEPGLNLIGCCNELNAGYA  134

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG N++LHHTI
Sbjct  135  ADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGRNQVLHHTI  194

Query  551  GLPDFTQ  571
            GLPDFTQ
Sbjct  195  GLPDFTQ  201



>ref|XP_008362250.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=604

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST-PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            +V + P    + + ST P   +S++ATLGRH+ARRLVQIGVTDVF+VPGDFNLTLLDHLI
Sbjct  17   NVGSLPNGAASAIQSTAPSTVNSSDATLGRHIARRLVQIGVTDVFTVPGDFNLTLLDHLI  76

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICI
Sbjct  77   AEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICI  136

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGT+RILHHTIGLPDF+Q
Sbjct  137  VGGPNSNDYGTHRILHHTIGLPDFSQ  162



>ref|XP_009399900.1| PREDICTED: pyruvate decarboxylase 2 [Musa acuminata subsp. malaccensis]
Length=607

 Score =   209 bits (531),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 114/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            EATLGRHLARRLVQ+G  DVF+VPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYA
Sbjct  44   EATLGRHLARRLVQVGAHDVFAVPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYA  103

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            R+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNR+LHHTIGL DF
Sbjct  104  RSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRVLHHTIGLSDF  163

Query  566  TQ  571
            +Q
Sbjct  164  SQ  165



>gb|AGA15797.1| pyruvate decarboxylase 2 [Diospyros kaki]
Length=607

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLGRHLARRLVQIG TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYA
Sbjct  39   ALVPSEATLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYA  98

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADG+AR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTI
Sbjct  99   ADGFARCRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTI  158

Query  551  GLPDFTQ  571
            GLPDF+Q
Sbjct  159  GLPDFSQ  165



>ref|XP_011096418.1| PREDICTED: pyruvate decarboxylase 1 [Sesamum indicum]
Length=585

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   S+  TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLI EPGL L+GCCNELNAG
Sbjct  15   PVPAISSSGTLGRHLARRLVQIGVRDVFSVPGDFNLTLLDHLIEEPGLNLVGCCNELNAG  74

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  75   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHH  134

Query  545  TIGLPDFTQ  571
            TIGLPDFTQ
Sbjct  135  TIGLPDFTQ  143



>gb|AIE47265.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=588

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  182  TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNa  361
            +P  F+S ++TLGRHLARRLVQIG+ DVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNA
Sbjct  17   SPTVFNSPDSTLGRHLARRLVQIGINDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNA  76

Query  362  gyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILH  541
            GYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSND GTNRILH
Sbjct  77   GYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDNGTNRILH  136

Query  542  HTIGLPDFTQ  571
            HTIGLPDF+Q
Sbjct  137  HTIGLPDFSQ  146



>ref|XP_004145248.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 ref|XP_004153721.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 gb|KGN65827.1| hypothetical protein Csa_1G532350 [Cucumis sativus]
Length=600

 Score =   208 bits (530),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            + D+A+ P  G  T  S  V   S++ATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHL
Sbjct  15   NNDIASLPQNGSLTPPSVTV---SSDATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHL  71

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  72   IAEPGLTNIGCCNELNAGYAADGYARRRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  131

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+NDYGT+RILHHTIGL DF+Q
Sbjct  132  IVGGPNTNDYGTSRILHHTIGLSDFSQ  158



>ref|XP_010253808.1| PREDICTED: pyruvate decarboxylase 1 [Nelumbo nucifera]
Length=647

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = +2

Query  167  NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCC  346
            N+V S   A  S+E+TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGL LIGCC
Sbjct  73   NSVSSA--AIGSSESTLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLNLIGCC  130

Query  347  NELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT  526
            NELNAGYAADGYAR RGVGACVVTFTVGGLS+LNAIAGAYSENLPLICIVGGPNSNDYGT
Sbjct  131  NELNAGYAADGYARCRGVGACVVTFTVGGLSILNAIAGAYSENLPLICIVGGPNSNDYGT  190

Query  527  NRILHHTIGLPDFTQ  571
            NR+LHHTIGLPD+ Q
Sbjct  191  NRVLHHTIGLPDWCQ  205



>gb|AIE47263.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=589

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV  S+   TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL +IGCCNELNAG
Sbjct  19   PVPGSACTGTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNVIGCCNELNAG  78

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYGTNRILHH
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  138

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  139  TIGLPDFSQ  147



>emb|CDY22174.1| BnaC01g39270D [Brassica napus]
Length=287

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  VHSTP--VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCC  346
            V S P  V   S+ ATLGRHLA RLV+IGV DVFSVPGDFNLTLLDHLIAEPGL LIGCC
Sbjct  25   VQSAPRSVISDSSSATLGRHLAHRLVEIGVNDVFSVPGDFNLTLLDHLIAEPGLNLIGCC  84

Query  347  NELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT  526
            NELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAY ENLPLICI+GGPNSNDYGT
Sbjct  85   NELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYGENLPLICIIGGPNSNDYGT  144

Query  527  NRILHHTIGLPDFTQ  571
            NRILHHTIGL DF Q
Sbjct  145  NRILHHTIGLSDFRQ  159



>ref|XP_004165846.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate decarboxylase isozyme 
2-like [Cucumis sativus]
Length=600

 Score =   208 bits (529),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            + D+A+ P  G  T  S  V   S++ATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHL
Sbjct  15   NNDIASLPQNGSLTPPSVTV---SSDATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHL  71

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  72   IAEPGLTNIGCCNELNAGYAADGYARRRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  131

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+NDYGT+RILHHTIGL DF+Q
Sbjct  132  IVGGPNTNDYGTSRILHHTIGLSDFSQ  158



>gb|AEF33613.1| pyruvate decarboxylase [Salvia miltiorrhiza f. alba]
Length=605

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +2

Query  164  VNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGC  343
            V+++  + VAF+SAEATLGRH+ARRLVQI V+DVFSVPGDFNLTLLD LIAEPGL ++GC
Sbjct  28   VSSIKPSAVAFNSAEATLGRHIARRLVQIDVSDVFSVPGDFNLTLLDDLIAEPGLNVVGC  87

Query  344  CNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  523
            CNELNAGYAADGYARARGVGAC VTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  88   CNELNAGYAADGYARARGVGACAVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYG  147

Query  524  TNRILHHTIGLPDFTQ  571
            T+RILHHTIGLPDF+Q
Sbjct  148  THRILHHTIGLPDFSQ  163



>ref|XP_010052217.1| PREDICTED: pyruvate decarboxylase 1 [Eucalyptus grandis]
 gb|KCW76156.1| hypothetical protein EUGRSUZ_D00535 [Eucalyptus grandis]
Length=582

 Score =   207 bits (528),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 117/137 (85%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +2

Query  164  VNTVHSTPVAFSS-AEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIG  340
            V+ V S  +  S+    TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL L+G
Sbjct  4    VSNVGSAALPISAPGSGTLGSHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNLVG  63

Query  341  CCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDY  520
            CCNELNAGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDY
Sbjct  64   CCNELNAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDY  123

Query  521  GTNRILHHTIGLPDFTQ  571
            GTNRILHHTIGLPDFTQ
Sbjct  124  GTNRILHHTIGLPDFTQ  140



>ref|XP_002272615.1| PREDICTED: pyruvate decarboxylase 2 [Vitis vinifera]
 emb|CBI18254.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            EATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADGYA
Sbjct  42   EATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAGYAADGYA  101

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            R+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF
Sbjct  102  RSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDF  161

Query  566  TQ  571
            +Q
Sbjct  162  SQ  163



>gb|KJB57438.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=408

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHH  138

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  139  TIGLPDFSQ  147



>ref|XP_004302532.1| PREDICTED: pyruvate decarboxylase 2 [Fragaria vesca subsp. vesca]
Length=605

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  104  DQSKLVSQGSGDVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPG  280
            D  K  S   G + N  T  V N+V ST    SSA+ATLGRHLARRLVQIGVTDVF+VPG
Sbjct  9    DVCKAESHDVGCLPNGATSTVQNSVPST--TLSSADATLGRHLARRLVQIGVTDVFTVPG  66

Query  281  DFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAG  460
            DFNLTLLDHL+AEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAG
Sbjct  67   DFNLTLLDHLVAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAG  126

Query  461  AYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            A SENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  127  ACSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>gb|AAL37492.1| pyruvate decarboxylase [Fragaria x ananassa]
Length=605

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STP-VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV   P    +TV  S P    SSA+ATLGRHLARRLVQIG+TDVF+VPGDFNLTLLDHL
Sbjct  17   DVGCLPNSTTSTVQDSVPSTCLSSADATLGRHLARRLVQIGITDVFTVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  77   IAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPNSNDYGTNRILHHTIG PDF+Q
Sbjct  137  IVGGPNSNDYGTNRILHHTIGSPDFSQ  163



>gb|KDP21067.1| hypothetical protein JCGZ_21538 [Jatropha curcas]
Length=589

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  188  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  367
            VA  +   TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGY
Sbjct  20   VAGKTCSGTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGY  79

Query  368  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHT  547
            AADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHT
Sbjct  80   AADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHT  139

Query  548  IGLPDFTQ  571
            IGLPDF+Q
Sbjct  140  IGLPDFSQ  147



>ref|XP_008344771.1| PREDICTED: pyruvate decarboxylase 1-like [Malus domestica]
Length=606

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            P A +SA++TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEPGL  IGCCNELNAG
Sbjct  36   PSAIASADSTLGRHLARRLVEIGVGDVFSVPGDFNLTLLDHLIAEPGLTNIGCCNELNAG  95

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC+VGGPN+NDYGTNRILHH
Sbjct  96   YAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICVVGGPNTNDYGTNRILHH  155

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  156  TIGLPDFSQ  164



>gb|EMT15339.1| hypothetical protein F775_43983 [Aegilops tauschii]
Length=605

 Score =   207 bits (526),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 3/151 (2%)
 Frame = +2

Query  119  VSQGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  298
            V+   G  A+AP  G   + S PV  S+ EA+LGRHLARRLVQ+GV+DVF+VPGDFNLTL
Sbjct  16   VNGAVGCPASAP--GCPIMSSHPVV-SAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTL  72

Query  299  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  478
            LDHL+ EPGLRLIGCCN  NAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENL
Sbjct  73   LDHLVDEPGLRLIGCCNAPNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENL  132

Query  479  PLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            P+ICI GGPNSNDYGTNRILHHTIG+PDF+Q
Sbjct  133  PVICIAGGPNSNDYGTNRILHHTIGIPDFSQ  163



>ref|NP_001284421.1| pyruvate decarboxylase 1 [Cucumis melo]
 gb|AIC36754.1| pyruvate/alpha-keto acid decarboxylase [Cucumis melo]
Length=606

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 2/139 (1%)
 Frame = +2

Query  155  TIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRL  334
            TI  + V ST V  +S++ATLGRHLARRLVQIGVTDVF+VPGDFNLTLLDHLIAEP L  
Sbjct  28   TIQNSVVPSTVV--NSSDATLGRHLARRLVQIGVTDVFTVPGDFNLTLLDHLIAEPALNN  85

Query  335  IGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSN  514
            IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSN
Sbjct  86   IGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSN  145

Query  515  DYGTNRILHHTIGLPDFTQ  571
            DYGTNRILHHTIGLPDF+Q
Sbjct  146  DYGTNRILHHTIGLPDFSQ  164



>gb|AIE47262.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=589

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 2/133 (2%)
 Frame = +2

Query  179  STP--VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNE  352
            STP  V  S++  TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL LIGCCNE
Sbjct  15   STPARVPGSASTGTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNE  74

Query  353  LNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNR  532
            LNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYGTNR
Sbjct  75   LNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYGTNR  134

Query  533  ILHHTIGLPDFTQ  571
            ILHHTIGLPDF+Q
Sbjct  135  ILHHTIGLPDFSQ  147



>ref|XP_011019081.1| PREDICTED: pyruvate decarboxylase 2-like [Populus euphratica]
Length=605

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S D+ N     V+T+ ++      + +++TLGRHLARRLVQIGVTDVFSVPGDFNLTLLD
Sbjct  15   SDDMINPTNATVSTIQNSLSSTIINPSQSTLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGA SENLP+
Sbjct  75   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGANSENLPV  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>gb|KCW52500.1| hypothetical protein EUGRSUZ_J01896 [Eucalyptus grandis]
Length=601

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  ANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEP  322
            AN     + + H+     SS+EATLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP
Sbjct  17   ANGKCSPIQSSHAPSAPASSSEATLGRHLARRLVEIGVADVFSVPGDFNLTLLDHLIAEP  76

Query  323  GLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGG  502
            GL  +GCCNELNAGYAADGYARARGV ACVVTFTVGGLS++NAIAGAYSENLP+ICIVGG
Sbjct  77   GLNNVGCCNELNAGYAADGYARARGVSACVVTFTVGGLSIINAIAGAYSENLPIICIVGG  136

Query  503  PNSNDYGTNRILHHTIGLPDFTQ  571
            PN+NDYGT+RILHHTIGLPDF+Q
Sbjct  137  PNTNDYGTSRILHHTIGLPDFSQ  159



>ref|XP_010323135.1| PREDICTED: pyruvate decarboxylase 2 [Solanum lycopersicum]
Length=586

 Score =   206 bits (524),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            D AN  T  +   HS+ V  +S +A LGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIA
Sbjct  2    DNANG-TSCIQNSHSSSV-IASPDANLGRHLARRLVEIGVEDVFSVPGDFNLTLLDHLIA  59

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EP L+ +GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIV
Sbjct  60   EPRLKNVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPIICIV  119

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  120  GGPNTNDYGTNRILHHTIGLPDFSQ  144



>ref|XP_010034573.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
Length=609

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  ANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEP  322
            AN     + + H+     SS+EATLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP
Sbjct  25   ANGKCSPIQSSHAPSAPASSSEATLGRHLARRLVEIGVADVFSVPGDFNLTLLDHLIAEP  84

Query  323  GLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGG  502
            GL  +GCCNELNAGYAADGYARARGV ACVVTFTVGGLS++NAIAGAYSENLP+ICIVGG
Sbjct  85   GLNNVGCCNELNAGYAADGYARARGVSACVVTFTVGGLSIINAIAGAYSENLPIICIVGG  144

Query  503  PNSNDYGTNRILHHTIGLPDFTQ  571
            PN+NDYGT+RILHHTIGLPDF+Q
Sbjct  145  PNTNDYGTSRILHHTIGLPDFSQ  167



>ref|XP_004134669.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus]
 ref|XP_004155547.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus]
 gb|KGN49289.1| Pyruvate decarboxylase [Cucumis sativus]
Length=589

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            S PVA +++  TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLI+EP L LIGCCNELN
Sbjct  17   SVPVAPNASSGTLGSHLARRLVEIGVSDVFSVPGDFNLTLLDHLISEPQLNLIGCCNELN  76

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  77   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  136

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDFTQ
Sbjct  137  HHTIGLPDFTQ  147



>ref|XP_007207128.1| hypothetical protein PRUPE_ppa003096mg [Prunus persica]
 gb|EMJ08327.1| hypothetical protein PRUPE_ppa003096mg [Prunus persica]
Length=605

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +V   P  G  +VH +  P   +S++ATLGRHLARRLV+IGV DVFSVPGDFNLTLLDHL
Sbjct  17   NVVCPPQNGTASVHDSHPPSTIASSDATLGRHLARRLVEIGVQDVFSVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  77   IAEPGLTNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+NDYGTNRILHHTIGL DF+Q
Sbjct  137  IVGGPNTNDYGTNRILHHTIGLADFSQ  163



>ref|XP_003520410.1| PREDICTED: pyruvate decarboxylase 1-like [Glycine max]
Length=603

 Score =   206 bits (524),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 117/150 (78%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +2

Query  128  GSGDVANAPTIGVNTV-HSTP-VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  301
            G+ DV   P   V+ + +S P  A +S++ATLGRHLARRLVQ+GV DVFSVPGDFNLTLL
Sbjct  12   GNSDVGCPPNGTVSVIKNSVPATAITSSDATLGRHLARRLVQVGVKDVFSVPGDFNLTLL  71

Query  302  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  481
            DHLIAEP L+ +GCCNELNAGYAADGYAR RGVGAC VTFTVGGLSV+NAIAGAYSENLP
Sbjct  72   DHLIAEPQLKNVGCCNELNAGYAADGYARCRGVGACAVTFTVGGLSVINAIAGAYSENLP  131

Query  482  LICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LICIVGGPN+ND+GTNRILHHTIG PDF+Q
Sbjct  132  LICIVGGPNTNDFGTNRILHHTIGSPDFSQ  161



>ref|XP_008221277.1| PREDICTED: pyruvate decarboxylase 1-like [Prunus mume]
Length=605

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            +V   P  G  +VH +  P   +S++ATLGRHLARRLV+IGV DVFSVPGDFNLTLLDHL
Sbjct  17   NVGCPPQNGTASVHGSHPPSTIASSDATLGRHLARRLVEIGVQDVFSVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC
Sbjct  77   IAEPGLTNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+NDYGTNRILHHTIGL DF+Q
Sbjct  137  IVGGPNTNDYGTNRILHHTIGLADFSQ  163



>ref|XP_008362261.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=604

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  104  DQSKLVSQGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGD  283
            D  K    G G + N   + + +  S P   +S++ATLG H+ARRLVQIGVTDVF+VPGD
Sbjct  9    DVCKPTCTGVGSLPNGAALAIQS--SAPSLINSSDATLGGHIARRLVQIGVTDVFTVPGD  66

Query  284  FNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGA  463
            FNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGA
Sbjct  67   FNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGA  126

Query  464  YSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            YSE+LPLICIVGGPNSNDYGT+RILHHTIGLPDF+Q
Sbjct  127  YSESLPLICIVGGPNSNDYGTHRILHHTIGLPDFSQ  162



>ref|XP_010448857.1| PREDICTED: pyruvate decarboxylase 2-like, partial [Camelina sativa]
Length=644

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 134/161 (83%), Gaps = 20/161 (12%)
 Frame = +2

Query  89   WILRSDQSKLVSQGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  268
            W L+SD               P+I    +HST +  S  +ATLGR+LARRLV+IGVTDVF
Sbjct  62   WTLKSD---------------PSI---PLHSTTI--SPCDATLGRYLARRLVEIGVTDVF  101

Query  269  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  448
            SVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLN
Sbjct  102  SVPGDFNLTLLDHLIAEPDLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLN  161

Query  449  AIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            AIAGA SENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  162  AIAGANSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  202



>ref|NP_001060727.1| Os07g0693100 [Oryza sativa Japonica Group]
 sp|Q0D3D2.1|PDC3_ORYSJ RecName: Full=Pyruvate decarboxylase 3; Short=PDC [Oryza sativa 
Japonica Group]
 dbj|BAC75566.1| pyruvate decarboxylase isozyme 3 [Oryza sativa Japonica Group]
 dbj|BAC77042.1| pyruvate decarboxylase 3 [Oryza sativa Japonica Group]
 dbj|BAF22641.1| Os07g0693100 [Oryza sativa Japonica Group]
 dbj|BAG94604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=587

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            SS +ATLG HLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGLR++GCCNELNAGYAAD
Sbjct  20   SSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAAD  79

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARARGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYGTNRILHHTIGL
Sbjct  80   GYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  139

Query  557  PDFTQ  571
            PDF+Q
Sbjct  140  PDFSQ  144



>sp|P51846.1|PDC2_TOBAC RecName: Full=Pyruvate decarboxylase 2; Short=NtPDC2 [Nicotiana 
tabacum]
 emb|CAA57448.1| pyruvate decarboxylase [Nicotiana tabacum]
Length=614

 Score =   206 bits (524),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  121  VGGPNTNDYGTNRILHHTIGLPDFSQ  146



>ref|XP_009594221.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Nicotiana tomentosiformis]
Length=588

 Score =   206 bits (523),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  121  VGGPNTNDYGTNRILHHTIGLPDFSQ  146



>ref|XP_011071825.1| PREDICTED: pyruvate decarboxylase 1-like [Sesamum indicum]
Length=605

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = +2

Query  164  VNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGC  343
            V   H +P A  + +ATLGRH+ARRLVQIGV DVFSVPGDFNLTLLDHLIAEPGL  IGC
Sbjct  30   VQGSHQSPAA--NPDATLGRHVARRLVQIGVEDVFSVPGDFNLTLLDHLIAEPGLNNIGC  87

Query  344  CNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  523
            CNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPN+NDYG
Sbjct  88   CNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNTNDYG  147

Query  524  TNRILHHTIGLPDFTQ  571
            TNRILHHTIGLPDF+Q
Sbjct  148  TNRILHHTIGLPDFSQ  163



>emb|CDY10495.1| BnaCnng03960D [Brassica napus]
Length=608

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 6/152 (4%)
 Frame = +2

Query  131  SGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  295
            +GDV  +PT G      +TV ++ ++  S+EATLGRHL RRLVQ GV D+F+VPGDFNLT
Sbjct  16   NGDVC-SPTNGTVASIEDTVPASGISVGSSEATLGRHLGRRLVQAGVRDIFTVPGDFNLT  74

Query  296  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  475
            LLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSEN
Sbjct  75   LLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN  134

Query  476  LPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            LP+ICIVGGPNSND+GTNRILHHTIGLPDFTQ
Sbjct  135  LPVICIVGGPNSNDFGTNRILHHTIGLPDFTQ  166



>ref|XP_004232952.1| PREDICTED: pyruvate decarboxylase 1 [Solanum lycopersicum]
Length=587

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            S P +      TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELN
Sbjct  15   SVPASSPCGAGTLGRHLARRLVQIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELN  74

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  75   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  134

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  135  HHTIGLPDFSQ  145



>ref|XP_009773011.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Nicotiana sylvestris]
Length=588

 Score =   205 bits (522),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  121  VGGPNTNDYGTNRILHHTIGLPDFSQ  146



>gb|KDO77807.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=431

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G       PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDYGTNRILHHTIGLPDFTQ  147



>ref|XP_009773010.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Nicotiana sylvestris]
Length=614

 Score =   206 bits (523),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  121  VGGPNTNDYGTNRILHHTIGLPDFSQ  146



>ref|XP_009594220.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Nicotiana tomentosiformis]
Length=614

 Score =   206 bits (523),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  121  VGGPNTNDYGTNRILHHTIGLPDFSQ  146



>ref|XP_008654188.1| PREDICTED: pyruvate decarboxylase 3-like [Zea mays]
 tpg|DAA64245.1| TPA: hypothetical protein ZEAMMB73_651726 [Zea mays]
Length=609

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            +ATLGRHLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGLR++GCCNELNAGYAADGYA
Sbjct  45   DATLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAADGYA  104

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            RARGVGACVVTFTVGGLSVLNAIAGAYSENLP++C+VGGPNSNDYGTNR+LHHTIGLPDF
Sbjct  105  RARGVGACVVTFTVGGLSVLNAIAGAYSENLPVVCVVGGPNSNDYGTNRVLHHTIGLPDF  164

Query  566  TQ  571
            +Q
Sbjct  165  SQ  166



>gb|EYU42548.1| hypothetical protein MIMGU_mgv1a003111mg [Erythranthe guttata]
Length=607

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = +2

Query  164  VNTVHSTPVAFSSA--EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLI  337
            V+TVH +    SSA  EATLGRH+ARRLVQIGV+DVF+VPGDFNLTLLDHLIAEPGL  +
Sbjct  28   VSTVHDSSHVPSSAAPEATLGRHVARRLVQIGVSDVFTVPGDFNLTLLDHLIAEPGLNNV  87

Query  338  GCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSND  517
            GCCNELNAGYAADGYARARGVGACVVTFTVGGLS+LNA+AGAYSENLP+ICIVGGPN+ND
Sbjct  88   GCCNELNAGYAADGYARARGVGACVVTFTVGGLSLLNAVAGAYSENLPVICIVGGPNTND  147

Query  518  YGTNRILHHTIGLPDFTQ  571
            YGTNRILHHTIGLPDF+Q
Sbjct  148  YGTNRILHHTIGLPDFSQ  165



>ref|XP_007025439.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 3 [Theobroma cacao]
 gb|EOY28061.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 3 [Theobroma cacao]
Length=406

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELN
Sbjct  17   APPVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELN  76

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  77   AGYAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  136

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  137  HHTIGLPDFSQ  147



>ref|XP_009369597.1| PREDICTED: pyruvate decarboxylase 2-like [Pyrus x bretschneideri]
Length=606

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV DVF+VPGDFNLTLLDH
Sbjct  17   NVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVGDVFTVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+I
Sbjct  77   LIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLSVLNAIAGAYSENLPVI  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            C+VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  137  CVVGGPNTNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_008384777.1| PREDICTED: pyruvate decarboxylase 1-like isoform X2 [Malus domestica]
Length=606

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV DVF+VPGDFNLTLLDH
Sbjct  17   NVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVGDVFTVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+I
Sbjct  77   LIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLSVLNAIAGAYSENLPVI  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            C+VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  137  CVVGGPNTNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_009338952.1| PREDICTED: pyruvate decarboxylase 2-like [Pyrus x bretschneideri]
Length=606

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV DVF+VPGDFNLTLLDH
Sbjct  17   NVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVGDVFTVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+I
Sbjct  77   LIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLSVLNAIAGAYSENLPVI  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            C+VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  137  CVVGGPNTNDYGTNRILHHTIGLPDFSQ  164



>ref|NP_001284406.1| pyruvate decarboxylase [Cucumis melo]
 gb|AIC36755.1| pyruvate decarboxylase [Cucumis melo]
Length=590

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            S PVA +++  TLG HLARRLV+IG +DVFSVPGDFNLTLLDHLI+EP L LIGCCNELN
Sbjct  17   SVPVAPNASSGTLGSHLARRLVEIGASDVFSVPGDFNLTLLDHLISEPQLNLIGCCNELN  76

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  77   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  136

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDFTQ
Sbjct  137  HHTIGLPDFTQ  147



>ref|XP_009607456.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana tomentosiformis]
Length=578

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  176  HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNEL  355
            +S P +      TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNEL
Sbjct  5    NSVPASSPCGIGTLGRHLARRLVQIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNEL  64

Query  356  NagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRI  535
            NAGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRI
Sbjct  65   NAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRI  124

Query  536  LHHTIGLPDFTQ  571
            LHHTIG+PDF+Q
Sbjct  125  LHHTIGVPDFSQ  136



>ref|XP_008384776.1| PREDICTED: pyruvate decarboxylase 2-like isoform X1 [Malus domestica]
Length=610

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV DVF+VPGDFNLTLLDH
Sbjct  17   NVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVGDVFTVPGDFNLTLLDH  76

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            LIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+I
Sbjct  77   LIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLSVLNAIAGAYSENLPVI  136

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            C+VGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  137  CVVGGPNTNDYGTNRILHHTIGLPDFSQ  164



>ref|XP_003623316.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES79534.1| pyruvate decarboxylase [Medicago truncatula]
Length=575

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A ++++ATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLDHLI EP L LIGCCNELNAGYA
Sbjct  35   AIATSDATLGRHLARRLVQVGVTDVFSVPGDFNLTLLDHLINEPELNLIGCCNELNAGYA  94

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT+RILHHTI
Sbjct  95   ADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTSRILHHTI  154

Query  551  GLPDFTQ  571
            G+PDF+Q
Sbjct  155  GVPDFSQ  161



>gb|KJB57436.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=539

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHH  138

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  139  TIGLPDFSQ  147



>ref|XP_009801931.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801932.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Nicotiana sylvestris]
Length=578

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  176  HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNEL  355
            +S P +      TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNEL
Sbjct  5    NSVPASSPCGIGTLGRHLARRLVQIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNEL  64

Query  356  NagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRI  535
            NAGY+ADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRI
Sbjct  65   NAGYSADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRI  124

Query  536  LHHTIGLPDFTQ  571
            LHHTIG+PDF+Q
Sbjct  125  LHHTIGVPDFSQ  136



>gb|KJB57437.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=537

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHH  138

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  139  TIGLPDFSQ  147



>ref|XP_007025440.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 4 [Theobroma cacao]
 gb|EOY28062.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 4 [Theobroma cacao]
Length=455

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELN
Sbjct  17   APPVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELN  76

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  77   AGYAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  136

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  137  HHTIGLPDFSQ  147



>ref|XP_002530500.1| pyruvate decarboxylase, putative [Ricinus communis]
 gb|EEF31884.1| pyruvate decarboxylase, putative [Ricinus communis]
Length=607

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLGRHLARRLVQ+GVTDVFSVPGDFNLTLLDHLIAEPGL +IGCCNELNAGYAADGYAR+
Sbjct  46   TLGRHLARRLVQVGVTDVFSVPGDFNLTLLDHLIAEPGLNVIGCCNELNAGYAADGYARS  105

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            RGVGACVVTFTVGGLSVLNAIAGAYSENLP++CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  106  RGVGACVVTFTVGGLSVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQ  165



>ref|XP_002275486.1| PREDICTED: pyruvate decarboxylase 1 [Vitis vinifera]
 emb|CBI30661.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  379
            S   TLG HLARRLVQIGV DVFSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADG
Sbjct  12   SCSGTLGGHLARRLVQIGVRDVFSVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGYAADG  71

Query  380  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLP  559
            YARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLP
Sbjct  72   YARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLP  131

Query  560  DFTQ  571
            DFTQ
Sbjct  132  DFTQ  135



>ref|XP_008775407.1| PREDICTED: pyruvate decarboxylase 2-like [Phoenix dactylifera]
Length=606

 Score =   204 bits (519),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  VHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNE  352
            V +TP +  +   TLGRHLARRLV++GV+D F+VPGDFNLTLLDHLI EPGLR IGCCNE
Sbjct  32   VPATPASGVATMGTLGRHLARRLVEVGVSDFFAVPGDFNLTLLDHLIEEPGLRFIGCCNE  91

Query  353  LNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNR  532
            LNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSND+GTNR
Sbjct  92   LNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDFGTNR  151

Query  533  ILHHTIGLPDFTQ  571
            ILHHTIG+ DFTQ
Sbjct  152  ILHHTIGISDFTQ  164



>ref|XP_007026638.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07140.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=362

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  182  TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNa  361
            +P   +S+EATLGRHLARRLV +GVTDVFSVPGDFNLTLLDHLIAE  L LIGCCNEL A
Sbjct  24   SPTVINSSEATLGRHLARRLVHVGVTDVFSVPGDFNLTLLDHLIAELELNLIGCCNELKA  83

Query  362  gyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILH  541
            GYAADGYA +RGVGACVVTFTVGGLSVLN IAGAYSE+LPLICIVGGPNSND+GTNRILH
Sbjct  84   GYAADGYAWSRGVGACVVTFTVGGLSVLNGIAGAYSESLPLICIVGGPNSNDFGTNRILH  143

Query  542  HTIGLPDFTQ  571
            HTIGLPDF+Q
Sbjct  144  HTIGLPDFSQ  153



>gb|KJB57434.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=589

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHH  138

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  139  TIGLPDFSQ  147



>ref|XP_007026635.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07137.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=614

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S DV + P   V T+  +  P   +S+EATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLD
Sbjct  15   SNDVGSPPNGIVATIQGSVSPTVINSSEATLGRHLARRLVQVGVTDVFSVPGDFNLTLLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVT TVGGLSVLNAIAGAYSE+LPL
Sbjct  75   HLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTCTVGGLSVLNAIAGAYSESLPL  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSND+GT+ ILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDFGTHWILHHTIGLPDFSQ  163



>ref|XP_010033427.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW88157.1| hypothetical protein EUGRSUZ_A00546 [Eucalyptus grandis]
Length=607

 Score =   204 bits (519),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  188  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  367
            +A  S +AT+GRH+ARRLVQIGVTDVFSVPGDFNL LLDHLIAEPGL LIGCCNELNAGY
Sbjct  38   LAAGSPDATMGRHIARRLVQIGVTDVFSVPGDFNLVLLDHLIAEPGLNLIGCCNELNAGY  97

Query  368  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHT  547
            AADGYAR RGVGACVVTFTVGGLS+LNAIAGAYSENLP++CIVGGPNSNDYGTNR+LHHT
Sbjct  98   AADGYARTRGVGACVVTFTVGGLSMLNAIAGAYSENLPVVCIVGGPNSNDYGTNRVLHHT  157

Query  548  IGLPDFTQ  571
             GL DF+Q
Sbjct  158  TGLSDFSQ  165



>emb|CAG30578.1| pyruvate decarboxylase isozyme 1 [Lotus japonicus]
Length=580

 Score =   203 bits (517),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            ++P   S+ + TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLI EP L +IGCCNELN
Sbjct  8    TSPPPPSAFDGTLGHHLARRLVEIGVRDVFSVPGDFNLTLLDHLIGEPQLNVIGCCNELN  67

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  68   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  127

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  128  HHTIGLPDFSQ  138



>ref|XP_010279076.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=589

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            SS+  TLGRHLARRLVQIG+ DVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAAD
Sbjct  23   SSSSGTLGRHLARRLVQIGIHDVFSVPGDFNLTLLDHLVAEPELSLIGCCNELNAGYAAD  82

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARA+GVGACVVTFTVGGLSVLNA+AGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGL
Sbjct  83   GYARAKGVGACVVTFTVGGLSVLNAVAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGL  142

Query  557  PDFTQ  571
            PDF+Q
Sbjct  143  PDFSQ  147



>sp|P51850.1|PDC1_PEA RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Pisum sativum]
 emb|CAA91444.1| pyruvate decarboxylase [Pisum sativum]
Length=593

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + P+  SS + T+GRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELN
Sbjct  21   AIPLRPSSCDGTMGRHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELN  80

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGY RA+GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  81   AGYAADGYGRAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  140

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  141  HHTIGLPDFSQ  151



>ref|XP_004137700.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 gb|KGN58736.1| hypothetical protein Csa_3G730980 [Cucumis sativus]
Length=605

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            +ATLGRHLARRLVQIGVTDVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYA
Sbjct  42   DATLGRHLARRLVQIGVTDVFTVPGDFNLTLLDHLIAEPALNNIGCCNELNAGYAADGYA  101

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            R RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF
Sbjct  102  RCRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  161

Query  566  TQ  571
            +Q
Sbjct  162  SQ  163



>ref|XP_004156618.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
Length=605

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            +ATLGRHLARRLVQIGVTDVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYA
Sbjct  42   DATLGRHLARRLVQIGVTDVFTVPGDFNLTLLDHLIAEPALNNIGCCNELNAGYAADGYA  101

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            R RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF
Sbjct  102  RCRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  161

Query  566  TQ  571
            +Q
Sbjct  162  SQ  163



>gb|KCW49436.1| hypothetical protein EUGRSUZ_K02968 [Eucalyptus grandis]
Length=616

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  188  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  367
            VA   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDHL+AEPGL LIGCCNELNAGY
Sbjct  74   VALGPSEATLGSHLARRLVEIGVGDVFSVPGDFNLSLLDHLLAEPGLNLIGCCNELNAGY  133

Query  368  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHT  547
            AADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG+NR+LHH+
Sbjct  134  AADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGSNRLLHHS  193

Query  548  IGLPDFTQ  571
            IGLPDFTQ
Sbjct  194  IGLPDFTQ  201



>gb|KDO77806.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=545

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G       PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDYGTNRILHHTIGLPDFTQ  147



>gb|KDO77804.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=589

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G       PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDYGTNRILHHTIGLPDFTQ  147



>gb|KDO77805.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=585

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G       PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDYGTNRILHHTIGLPDFTQ  147



>ref|XP_006843656.1| hypothetical protein AMTR_s00007p00179930 [Amborella trichopoda]
 gb|ERN05331.1| hypothetical protein AMTR_s00007p00179930 [Amborella trichopoda]
Length=606

 Score =   203 bits (517),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  394
            LGRH+ARRLVQ+GVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG+ARA+
Sbjct  45   LGRHVARRLVQVGVTDVFSVPGDFNLTLLDHLIAEPCLNLVGCCNELNAGYAADGFARAK  104

Query  395  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            GVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  105  GVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|NP_001275795.1| pyruvate decarboxylase [Citrus sinensis]
 gb|AAZ05069.1| pyruvate decarboxylase [Citrus sinensis]
Length=589

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G       PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDYGTNRILHHTIGLPDFTQ  147



>ref|XP_010039167.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW49437.1| hypothetical protein EUGRSUZ_K02968 [Eucalyptus grandis]
Length=644

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  188  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  367
            VA   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDHL+AEPGL LIGCCNELNAGY
Sbjct  74   VALGPSEATLGSHLARRLVEIGVGDVFSVPGDFNLSLLDHLLAEPGLNLIGCCNELNAGY  133

Query  368  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHT  547
            AADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG+NR+LHH+
Sbjct  134  AADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGSNRLLHHS  193

Query  548  IGLPDFTQ  571
            IGLPDFTQ
Sbjct  194  IGLPDFTQ  201



>gb|KHG03537.1| Pyruvate decarboxylase isozyme 1 [Gossypium arboreum]
Length=601

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGHASTGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHH  138

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  139  TIGLPDFSQ  147



>ref|XP_010277737.1| PREDICTED: pyruvate decarboxylase 1 [Nelumbo nucifera]
Length=589

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            S++  TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L +IGCCNELNAGYAAD
Sbjct  23   SASSGTLGRHLARRLVQIGVRDVFSVPGDFNLTLLDHLIAEPDLNVIGCCNELNAGYAAD  82

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYAR +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGL
Sbjct  83   GYARFKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGL  142

Query  557  PDFTQ  571
            PDF+Q
Sbjct  143  PDFSQ  147



>gb|KCW44287.1| hypothetical protein EUGRSUZ_L02272 [Eucalyptus grandis]
Length=468

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDHL+ EPGL LIGCCNELNAGYA
Sbjct  75   ALGPSEATLGYHLARRLVEIGVGDVFSVPGDFNLSLLDHLVTEPGLNLIGCCNELNAGYA  134

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG N++LHHTI
Sbjct  135  ADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGRNQVLHHTI  194

Query  551  GLPDFTQ  571
            GLPDFTQ
Sbjct  195  GLPDFTQ  201



>ref|XP_010686333.1| PREDICTED: pyruvate decarboxylase 1 [Beta vulgaris subsp. vulgaris]
Length=581

 Score =   202 bits (514),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 111/121 (92%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  209  ATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyar  388
            +TLG HL RRL QIGVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYAR
Sbjct  19   STLGHHLGRRLAQIGVTDVFSVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADGYAR  78

Query  389  argvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFT  568
            A+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGT+RILHHTIGLPDFT
Sbjct  79   AKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTSRILHHTIGLPDFT  138

Query  569  Q  571
            Q
Sbjct  139  Q  139



>ref|XP_004294304.1| PREDICTED: pyruvate decarboxylase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=604

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            +V   P  G + +   P++  S  ++TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLI
Sbjct  17   NVGCPPQNGASALQDQPLSTISCPDSTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLI  76

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC+
Sbjct  77   AEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICV  136

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+ND+GTNRILHHTIGLPDF+Q
Sbjct  137  VGGPNTNDFGTNRILHHTIGLPDFSQ  162



>ref|XP_003604737.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES86934.1| pyruvate decarboxylase [Medicago truncatula]
Length=607

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIG--VNTVHSTPV--AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            D+   PT    V+T+  +P   + +S+E+TLG HLARRLV++G+TD+F+VPGDFNLTLLD
Sbjct  17   DIITTPTSNGTVSTIQKSPSTQSLASSESTLGSHLARRLVEVGITDIFTVPGDFNLTLLD  76

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+
Sbjct  77   HLIAEPKLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPV  136

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  137  ICIVGGPNSNDFGTNRILHHTIGLPDFSQ  165



>ref|XP_007148065.1| hypothetical protein PHAVU_006G177600g [Phaseolus vulgaris]
 gb|ESW20059.1| hypothetical protein PHAVU_006G177600g [Phaseolus vulgaris]
Length=584

 Score =   202 bits (514),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  379
            S + TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG
Sbjct  19   SFDGTLGCHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPRLNLVGCCNELNAGYAADG  78

Query  380  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLP  559
            YARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC+VGGPNSNDYGTNRILHHTIGLP
Sbjct  79   YARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICVVGGPNSNDYGTNRILHHTIGLP  138

Query  560  DFTQ  571
            DF+Q
Sbjct  139  DFSQ  142



>ref|XP_011460964.1| PREDICTED: pyruvate decarboxylase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=608

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            +V   P  G + +   P++  S  ++TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLI
Sbjct  17   NVGCPPQNGASALQDQPLSTISCPDSTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLI  76

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC+
Sbjct  77   AEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICV  136

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPN+ND+GTNRILHHTIGLPDF+Q
Sbjct  137  VGGPNTNDFGTNRILHHTIGLPDFSQ  162



>ref|XP_007134808.1| hypothetical protein PHAVU_010G078000g [Phaseolus vulgaris]
 gb|ESW06802.1| hypothetical protein PHAVU_010G078000g [Phaseolus vulgaris]
Length=605

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTV-HSTPV-AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV   P   V+ + +S P  A SS+EATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLDHL
Sbjct  17   DVGCPPNGTVSAIKNSVPASAISSSEATLGRHLARRLVQVGVTDVFSVPGDFNLTLLDHL  76

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L  +GCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV+NAIAGAYSENLPLIC
Sbjct  77   IAEPQLTNVGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVINAIAGAYSENLPLIC  136

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+ND+GTNRILHHTIGL DF+Q
Sbjct  137  IVGGPNTNDFGTNRILHHTIGLSDFSQ  163



>gb|AAX33299.1| pyruvate decarboxylase 2 [Petunia x hybrida]
Length=588

 Score =   202 bits (513),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR 
Sbjct  27   TLGRHLARRLVEIGIEDVFSVPGDFNLTLLDHLIAEPKLKNIGCCNELNAGYAADGYARE  86

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            RG+GACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  87   RGIGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNTNDYGTNRILHHTIGLPDFSQ  146



>gb|KJB21559.1| hypothetical protein B456_004G001200 [Gossypium raimondii]
Length=605

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + P +  +A+ATLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELN
Sbjct  33   NAPPSVVAADATLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELN  92

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYAR+RGVGACVVTFTVGGLS++NAIAGAYSENLP+ICIVGGPN+NDYGTNRIL
Sbjct  93   AGYAADGYARSRGVGACVVTFTVGGLSIINAIAGAYSENLPVICIVGGPNTNDYGTNRIL  152

Query  539  HHTIGLPDFTQ  571
            HHTIGL DF+Q
Sbjct  153  HHTIGLSDFSQ  163



>gb|AAA68290.1| pyruvate decarboxylase 1 [Oryza sativa Indica Group]
 gb|AAC49442.1| pyruvate decarboxylase [Oryza sativa Indica Group]
Length=602

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = +2

Query  140  VANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAE  319
            V + P +  N V   PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLLD+LIAE
Sbjct  21   VGSLPVVSSNAVIHPPVT-SAARATLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAE  79

Query  320  PGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVG  499
            PGL+LI CCNELNAGYAADGYARA       VTFTVGGLSVLNAIAGAYSENLP+ICIVG
Sbjct  80   PGLKLIACCNELNAGYAADGYARALVG--AFVTFTVGGLSVLNAIAGAYSENLPVICIVG  137

Query  500  GPNSNDYGTNRILHHTIGLPDFTQ  571
            GPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  138  GPNSNDYGTNRILHHTIGLPDFSQ  161



>ref|XP_007025438.1| Pyruvate decarboxylase-2 isoform 2 [Theobroma cacao]
 gb|EOY28060.1| Pyruvate decarboxylase-2 isoform 2 [Theobroma cacao]
Length=590

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELN
Sbjct  17   APPVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELN  76

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  77   AGYAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  136

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  137  HHTIGLPDFSQ  147



>ref|XP_007025437.1| Pyruvate decarboxylase-2 isoform 1 [Theobroma cacao]
 gb|EOY28059.1| Pyruvate decarboxylase-2 isoform 1 [Theobroma cacao]
Length=589

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  179  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  358
            + PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELN
Sbjct  17   APPVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELN  76

Query  359  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRIL  538
            AGYAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYGTNRIL
Sbjct  77   AGYAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYGTNRIL  136

Query  539  HHTIGLPDFTQ  571
            HHTIGLPDF+Q
Sbjct  137  HHTIGLPDFSQ  147



>ref|XP_011046076.1| PREDICTED: pyruvate decarboxylase 1-like [Populus euphratica]
Length=582

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  182  TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNa  361
             PV   +   TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLI EPGL LIGCCNELNA
Sbjct  11   APVPGHTFSGTLGYHLARRLVEIGVSDVFSVPGDFNLTLLDHLIDEPGLNLIGCCNELNA  70

Query  362  gyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILH  541
            GYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGT+RILH
Sbjct  71   GYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYGTSRILH  130

Query  542  HTIGLPDFTQ  571
            HTIGLPDFTQ
Sbjct  131  HTIGLPDFTQ  140



>ref|XP_010279075.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=589

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            SS+  TLGRHLARRLVQIG+ DVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAAD
Sbjct  23   SSSSGTLGRHLARRLVQIGIRDVFSVPGDFNLTLLDHLVAEPELNLIGCCNELNAGYAAD  82

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GY RA+GVGACVVTFTVGGLSVLNAIAGAYSE+LP+ICIVGGPNSND+GTNRILHHTIGL
Sbjct  83   GYVRAKGVGACVVTFTVGGLSVLNAIAGAYSEDLPVICIVGGPNSNDFGTNRILHHTIGL  142

Query  557  PDFTQ  571
            PDF+Q
Sbjct  143  PDFSQ  147



>gb|AAA68289.1| pyruvate decarboxylase [Oryza sativa Indica Group]
Length=585

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            SS +ATLG HLARRLVQ+GV+DVF+VPGDFNLTLLD+LIAEPGL ++GCCNELNAGYAAD
Sbjct  20   SSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDYLIAEPGLSVVGCCNELNAGYAAD  79

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARARGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYGTNRILHHTIGL
Sbjct  80   GYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  139

Query  557  PDFTQ  571
            PDF+Q
Sbjct  140  PDFSQ  144



>ref|XP_009384923.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLGRHLARRLVQ+GV DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARA
Sbjct  43   TLGRHLARRLVQVGVHDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARA  102

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            RGVGAC VTFTVGGLSVLNAIAG+YSENLP+ICIVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  103  RGVGACAVTFTVGGLSVLNAIAGSYSENLPVICIVGGPNSNDYGTNRVLHHTIGLPDFSQ  162



>ref|XP_002308230.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE91753.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=605

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  131  SGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            S D+ N     V+TV ++      + +++TLGRHLARRLVQIGVTDVFSV GDFNL LLD
Sbjct  15   SNDMINPTNATVSTVQNSVSSTIINPSQSTLGRHLARRLVQIGVTDVFSVAGDFNLILLD  74

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
            HLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGA SENLP+
Sbjct  75   HLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGANSENLPV  134

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  135  ICIVGGPNSNDYGTNRILHHTIGLPDFSQ  163



>ref|XP_003623318.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES79536.1| pyruvate decarboxylase [Medicago truncatula]
Length=605

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  161  GVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIG  340
            G   +  +  A SS  ATLGRHLARRLVQ+GVTD+FSVPGDFNLTLLD+LI EP L +IG
Sbjct  27   GTTVIQPSSTAISSTNATLGRHLARRLVQVGVTDIFSVPGDFNLTLLDYLIDEPKLNVIG  86

Query  341  CCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDY  520
            CCNELNAGYAADGYAR+ GVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDY
Sbjct  87   CCNELNAGYAADGYARSCGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDY  146

Query  521  GTNRILHHTIGLPDFTQ  571
            G+NRILHHTIG+ DF+Q
Sbjct  147  GSNRILHHTIGISDFSQ  163



>ref|XP_003614223.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES97181.1| pyruvate decarboxylase [Medicago truncatula]
Length=607

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = +2

Query  164  VNTVHSTPV--AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLI  337
            V+T+  +P   + +S+E+TLG HLARRLV++G+TD+F+VPGDFNLTLLDHLIAEP L+ I
Sbjct  28   VSTIQKSPSTQSLASSESTLGSHLARRLVEVGITDIFTVPGDFNLTLLDHLIAEPKLKNI  87

Query  338  GCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSND  517
            GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSND
Sbjct  88   GCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSND  147

Query  518  YGTNRILHHTIGLPDFTQ  571
            +GTNRILHHTIGLPDF+Q
Sbjct  148  FGTNRILHHTIGLPDFSQ  165



>ref|XP_008457351.1| PREDICTED: pyruvate decarboxylase 2-like [Cucumis melo]
Length=600

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 129/145 (89%), Gaps = 3/145 (2%)
 Frame = +2

Query  137  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  316
            D+A+ P  G  T  S  V   S+++TLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHLIA
Sbjct  17   DIASLPQNGSLTPPSVTV---SSDSTLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHLIA  73

Query  317  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  496
            EPGL  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIV
Sbjct  74   EPGLNNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIV  133

Query  497  GGPNSNDYGTNRILHHTIGLPDFTQ  571
            GGPN+NDYGT+RILHHTIGL DF+Q
Sbjct  134  GGPNTNDYGTSRILHHTIGLSDFSQ  158



>ref|XP_003542972.1| PREDICTED: pyruvate decarboxylase 1-like [Glycine max]
Length=589

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            S+ + TLGRHLARRL + GV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAAD
Sbjct  23   SAFDGTLGRHLARRLAETGVRDVFSVPGDFNLTLLDHLIAEPSLNLVGCCNELNAGYAAD  82

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGL
Sbjct  83   GYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGL  142

Query  557  PDFTQ  571
            PDFTQ
Sbjct  143  PDFTQ  147



>gb|KHN18047.1| Pyruvate decarboxylase isozyme 2 [Glycine soja]
Length=607

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV   P   V+ ++ S P    +S++ATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLDHL
Sbjct  19   DVGCPPNGAVSAINPSVPATTMTSSDATLGRHLARRLVQVGVTDVFSVPGDFNLTLLDHL  78

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L+ IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV+NAIAGAYSENLPLIC
Sbjct  79   IAEPQLKNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVINAIAGAYSENLPLIC  138

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+ND+GTNRILHHTIGL DF+Q
Sbjct  139  IVGGPNTNDFGTNRILHHTIGLSDFSQ  165



>ref|XP_007016910.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY34529.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=605

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  379
            S++ATLGRHLA RLV+IGV DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADG
Sbjct  40   SSDATLGRHLAHRLVEIGVKDVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAGYAADG  99

Query  380  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLP  559
            YARARGVGACVVTFTVGGLS++NAIAGAYSENLP+ICIVGGPN+NDYGTNRILHHTIGLP
Sbjct  100  YARARGVGACVVTFTVGGLSIINAIAGAYSENLPVICIVGGPNTNDYGTNRILHHTIGLP  159

Query  560  DFTQ  571
            DF+Q
Sbjct  160  DFSQ  163



>ref|XP_003516954.1| PREDICTED: pyruvate decarboxylase 4 [Glycine max]
Length=607

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STPVA-FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHL  310
            DV   P   V+ +  S P    +S++ATLGRHLARRLVQ+GVTDVFSVPGDFNLTLLDHL
Sbjct  19   DVGCPPNGAVSAIKPSVPATTMTSSDATLGRHLARRLVQVGVTDVFSVPGDFNLTLLDHL  78

Query  311  IAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLIC  490
            IAEP L+ IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV+NAIAGAYSENLPLIC
Sbjct  79   IAEPQLKNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVINAIAGAYSENLPLIC  138

Query  491  IVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            IVGGPN+ND+GTNRILHHTIGL DF+Q
Sbjct  139  IVGGPNTNDFGTNRILHHTIGLSDFSQ  165



>ref|XP_006449473.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
 gb|ESR62713.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
Length=545

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G  +    PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPSSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSND GTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDCGTNRILHHTIGLPDFTQ  147



>gb|ACG29583.1| pyruvate decarboxylase isozyme 1 [Zea mays]
Length=610

 Score =   201 bits (510),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  394
            LGRHLARRLVQIG +DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+R
Sbjct  50   LGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLTLVGCCNELNAGYAADGYARSR  109

Query  395  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            GVGAC VTFTVGGLSVLNAIAGAYSENLP++CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  110  GVGACAVTFTVGGLSVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQ  168



>ref|NP_001105422.1| pyruvate decarboxylase 1 [Zea mays]
 emb|CAA35589.1| pyruvate decarboxylase [Zea mays]
Length=610

 Score =   201 bits (510),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  394
            LGRHLARRLVQIG +DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+R
Sbjct  50   LGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLTLVGCCNELNAGYAADGYARSR  109

Query  395  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            GVGAC VTFTVGGLSVLNAIAGAYSENLP++CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  110  GVGACAVTFTVGGLSVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQ  168



>gb|ACR35995.1| unknown [Zea mays]
 gb|AFW82288.1| hypothetical protein ZEAMMB73_515806 [Zea mays]
Length=609

 Score =   201 bits (510),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  394
            LGRHLARRLVQIG +DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+R
Sbjct  49   LGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLTLVGCCNELNAGYAADGYARSR  108

Query  395  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            GVGAC VTFTVGGLSVLNAIAGAYSENLP++CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  109  GVGACAVTFTVGGLSVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQ  167



>ref|XP_003529168.1| PREDICTED: pyruvate decarboxylase 1 [Glycine max]
Length=607

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  VHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNE  352
            V +T +  +  ++TLG HLARRLV+IGVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNE
Sbjct  33   VPATVINGAGGDSTLGGHLARRLVEIGVTDVFSVPGDFNLTLLDHLIAEPALNLVGCCNE  92

Query  353  LNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNR  532
            LNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT+R
Sbjct  93   LNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTSR  152

Query  533  ILHHTIGLPDFTQ  571
            ILHHTIGLPDF+Q
Sbjct  153  ILHHTIGLPDFSQ  165



>sp|P28516.1|PDC1_MAIZE RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Zea mays]
 emb|CAA42120.1| pyruvate decarboxylase [Zea mays]
Length=610

 Score =   201 bits (510),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  394
            LGRHLARRLVQIG +DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+R
Sbjct  50   LGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLTLVGCCNELNAGYAADGYARSR  109

Query  395  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            GVGAC VTFTVGGLSVLNAIAGAYSENLP++CIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  110  GVGACAVTFTVGGLSVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQ  168



>gb|AAO42252.1| putative pyruvate decarboxylase [Arabidopsis thaliana]
Length=564

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            E+TLGRHL+RRLVQ GVTDVFSVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYA
Sbjct  1    ESTLGRHLSRRLVQAGVTDVFSVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYA  60

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            R+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSND+GTNRILHHTIGLPDF
Sbjct  61   RSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDF  120

Query  566  TQ  571
            +Q
Sbjct  121  SQ  122



>ref|XP_008225205.1| PREDICTED: pyruvate decarboxylase 1 [Prunus mume]
Length=573

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            +S+  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHL+AEPGL LIGCCNELNAGYAAD
Sbjct  7    ASSTGTLGRHLARRLVEIGVHDVFSVPGDFNLTLLDHLLAEPGLNLIGCCNELNAGYAAD  66

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARARGVGACVVTFTVGGLSVLNAIAGA SENLP+ICIVGGPNSNDYGTNRILHHTIGL
Sbjct  67   GYARARGVGACVVTFTVGGLSVLNAIAGACSENLPVICIVGGPNSNDYGTNRILHHTIGL  126

Query  557  PDFTQ  571
            PDF+Q
Sbjct  127  PDFSQ  131



>emb|CDO96745.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 4/140 (3%)
 Frame = +2

Query  164  VNTVHSTPVAFSSAEA----TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLR  331
            +  +H + +   SA+A    +LG HLA+RLVQIGV DVFSVPGDFNL LLDHLIAEP L 
Sbjct  3    IQAIHGSGITACSAQAPAGGSLGSHLAKRLVQIGVKDVFSVPGDFNLALLDHLIAEPELN  62

Query  332  LIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNS  511
            LIGCCNELNAGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNS
Sbjct  63   LIGCCNELNAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNS  122

Query  512  NDYGTNRILHHTIGLPDFTQ  571
            NDYGTNRILHHTIGLPDF+Q
Sbjct  123  NDYGTNRILHHTIGLPDFSQ  142



>ref|XP_006449474.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
 gb|ESR62714.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
Length=589

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  137  DVANA-PTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  313
            D ANA  + G  +    PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPSSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  314  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  493
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  494  VGGPNSNDYGTNRILHHTIGLPDFTQ  571
            VGGPNSND GTNRILHHTIGLPDFTQ
Sbjct  122  VGGPNSNDCGTNRILHHTIGLPDFTQ  147



>ref|XP_010924891.1| PREDICTED: pyruvate decarboxylase 1-like [Elaeis guineensis]
Length=577

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARA
Sbjct  16   TLGRHLARRLVQIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARA  75

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            RGVGACVVTFTVGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  76   RGVGACVVTFTVGGLSVINAIAGSYSENLPIICIVGGPNSNDYGTNRILHHTIGLPDFSQ  135



>ref|XP_002870930.1| pyruvate decarboxylase-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47189.1| pyruvate decarboxylase-3 [Arabidopsis lyrata subsp. lyrata]
Length=592

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            DV + P+  V T+     +T     S++ATLGRHLARRLVQ GV+D+FSVPGDFNL+LLD
Sbjct  2    DVGSLPSNSVATIQDSAPTTAAILGSSQATLGRHLARRLVQAGVSDIFSVPGDFNLSLLD  61

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
             LIA+P L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  62   QLIADPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  121

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  122  ICIVGGPNSNDFGTNRILHHTIGLPDFSQ  150



>ref|XP_003552267.1| PREDICTED: pyruvate decarboxylase 2 [Glycine max]
Length=608

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  203  AEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgy  382
            +++TLG HLARRLV+IGVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGY
Sbjct  44   SDSTLGGHLARRLVEIGVTDVFSVPGDFNLTLLDHLIAEPALHLVGCCNELNAGYAADGY  103

Query  383  arargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPD  562
            ARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT+RILHHTIGLPD
Sbjct  104  ARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTSRILHHTIGLPD  163

Query  563  FTQ  571
            F+Q
Sbjct  164  FSQ  166



>ref|XP_004961783.1| PREDICTED: pyruvate decarboxylase 1-like [Setaria italica]
Length=610

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLGRHLARRLVQIG TDVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+
Sbjct  49   TLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAEPGLNLVGCCNELNAGYAADGYARS  108

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            RGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNR+LHHTIGLPDF+Q
Sbjct  109  RGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRVLHHTIGLPDFSQ  168



>emb|CDO99368.1| unnamed protein product [Coffea canephora]
Length=610

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            P      EATLGRH+A RLV+IGV D+FSVPGDFNLTLLDHLIAEPGL  IGCCNELNAG
Sbjct  40   PSMIVGPEATLGRHIAHRLVEIGVNDIFSVPGDFNLTLLDHLIAEPGLNNIGCCNELNAG  99

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPN+NDYGTNRILHH
Sbjct  100  YAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNTNDYGTNRILHH  159

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  160  TIGLPDFSQ  168



>ref|XP_010912563.1| PREDICTED: pyruvate decarboxylase 1 [Elaeis guineensis]
Length=577

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  203  AEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgy  382
            A  TLGRHLA+RLVQIGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGY
Sbjct  13   AAGTLGRHLAQRLVQIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGY  72

Query  383  arargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPD  562
            ARARGVGACVVTF+VGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYGTNRILHHTIGLPD
Sbjct  73   ARARGVGACVVTFSVGGLSVINAIAGSYSENLPIICIVGGPNSNDYGTNRILHHTIGLPD  132

Query  563  FTQ  571
            FTQ
Sbjct  133  FTQ  135



>ref|XP_007140235.1| hypothetical protein PHAVU_008G095400g [Phaseolus vulgaris]
 gb|ESW12229.1| hypothetical protein PHAVU_008G095400g [Phaseolus vulgaris]
Length=606

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 130/159 (82%), Gaps = 11/159 (7%)
 Frame = +2

Query  128  GSGDVANAPT--------IGVNTVH-STPVAF--SSAEATLGRHLARRLVQIGVTDVFSV  274
            GS DVA  PT             +H S P A      ++TLG HLARRLV+IGVTDVFSV
Sbjct  6    GSLDVAKPPTNDLVSCNHANATVIHPSVPSAVINGCGDSTLGGHLARRLVEIGVTDVFSV  65

Query  275  PGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAI  454
            PGDFNLTLLDHLIAEP L +IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAI
Sbjct  66   PGDFNLTLLDHLIAEPALNVIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAI  125

Query  455  AGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            AGA SENLPLICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  126  AGANSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQ  164



>gb|AAX33300.1| pyruvate decarboxylase 1 [Petunia x hybrida]
Length=507

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            S+ ++TLGRHLARRLVQ+G+TDVF VPGDFNLTLLDHLI+EP L  IGCCNELNAGYAAD
Sbjct  43   STTDSTLGRHLARRLVQVGITDVFGVPGDFNLTLLDHLISEPNLEFIGCCNELNAGYAAD  102

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYAR RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGT+ +LHHTIGL
Sbjct  103  GYARPRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTSGVLHHTIGL  162

Query  557  PDFTQ  571
            PDF+Q
Sbjct  163  PDFSQ  167



>gb|ABJ99596.1| pyruvate decarboxylase [Lycoris aurea]
Length=605

 Score =   199 bits (506),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 109/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            P A   +E TLG H+ARRLVQ+GV D F VPGDFNLTLLDHLIAEPGL  +GCCNELNAG
Sbjct  35   PAAAIPSECTLGGHVARRLVQVGVRDFFGVPGDFNLTLLDHLIAEPGLNYVGCCNELNAG  94

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA GVGACVVTFTVGGLSVLNAIAGAYSENLPLICI GGPNSND+GT+RILHH
Sbjct  95   YAADGYARAHGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIAGGPNSNDFGTSRILHH  154

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  155  TIGLPDFSQ  163



>ref|XP_009376417.1| PREDICTED: pyruvate decarboxylase 2 [Pyrus x bretschneideri]
Length=610

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  385
            +ATLGRH+ARRLVQIGVTDVF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYA
Sbjct  47   DATLGRHIARRLVQIGVTDVFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYA  106

Query  386  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDF  565
            R+RGVGAC VTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSND+GT+RILHHTIGLPDF
Sbjct  107  RSRGVGACAVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDHGTHRILHHTIGLPDF  166

Query  566  TQ  571
            +Q
Sbjct  167  SQ  168



>ref|XP_007213938.1| hypothetical protein PRUPE_ppa003458mg [Prunus persica]
 gb|EMJ15137.1| hypothetical protein PRUPE_ppa003458mg [Prunus persica]
Length=573

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            +++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHL+AEPGL LIGCCNELNAGYAAD
Sbjct  7    ANSTGTLGRHLARRLVEIGVHDVFSVPGDFNLTLLDHLLAEPGLNLIGCCNELNAGYAAD  66

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYARARGVGACVVTFTVGGLSVLNAIAGA SENLP+ICIVGGPNSNDYGTNRILHHTIGL
Sbjct  67   GYARARGVGACVVTFTVGGLSVLNAIAGACSENLPVICIVGGPNSNDYGTNRILHHTIGL  126

Query  557  PDFTQ  571
            PDF+Q
Sbjct  127  PDFSQ  131



>ref|XP_002305755.2| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE86266.2| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=582

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            PV   +   TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLI EP L LIGCCNELNAG
Sbjct  12   PVPGHTFSGTLGHHLARRLVEIGVSDVFSVPGDFNLTLLDHLIDEPELNLIGCCNELNAG  71

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHH
Sbjct  72   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYGTNRILHH  131

Query  545  TIGLPDFTQ  571
            T GLPDFTQ
Sbjct  132  TTGLPDFTQ  140



>ref|XP_009386639.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=579

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLGRHLARRLVQ+GV DVF+VPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARA
Sbjct  18   TLGRHLARRLVQVGVRDVFAVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADGYARA  77

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
             GVGACVVTFTVGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  78   SGVGACVVTFTVGGLSVINAIAGSYSENLPIICIVGGPNSNDYGTNRILHHTIGLPDFSQ  137



>ref|XP_003522062.1| PREDICTED: pyruvate decarboxylase 1-like, partial [Glycine max]
Length=583

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            +S++ATLGRHLARRLVQ+GV DVFSVPGDFNLTLLDHLIAEP L+ +GCCNELNAGYAAD
Sbjct  17   TSSDATLGRHLARRLVQVGVKDVFSVPGDFNLTLLDHLIAEPQLKNVGCCNELNAGYAAD  76

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYAR RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPN+ND+GTNRILHHTIG 
Sbjct  77   GYARCRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNTNDFGTNRILHHTIGS  136

Query  557  PDFTQ  571
            PDF+Q
Sbjct  137  PDFSQ  141



>ref|NP_195753.1| pyruvate decarboxylase-3 [Arabidopsis thaliana]
 sp|Q9M039.1|PDC3_ARATH RecName: Full=Pyruvate decarboxylase 3; Short=AtPDC3 [Arabidopsis 
thaliana]
 emb|CAB81916.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AAP21263.1| At5g01330 [Arabidopsis thaliana]
 dbj|BAE99688.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED90328.1| pyruvate decarboxylase-3 [Arabidopsis thaliana]
Length=592

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +2

Query  137  DVANAPTIGVNTVH-STPVA---FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  304
            DV + P+ GV T+  S P A     S+ ATLGRHL+RRLVQ GVTD+F+VPGDFNL+LLD
Sbjct  2    DVRSLPSNGVATIQDSAPTAATILGSSAATLGRHLSRRLVQAGVTDIFTVPGDFNLSLLD  61

Query  305  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  484
             LIA P L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  62   QLIANPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  121

Query  485  ICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            ICIVGGPNSND+GTNRILHHTIGLPDF+Q
Sbjct  122  ICIVGGPNSNDFGTNRILHHTIGLPDFSQ  150



>ref|XP_011045902.1| PREDICTED: pyruvate decarboxylase 1 [Populus euphratica]
Length=593

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARA
Sbjct  32   TLGSHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARA  91

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  92   KGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYGTNRILHHTIGLPDFSQ  151



>ref|XP_004485877.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cicer arietinum]
Length=584

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  379
            S + T+GRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG
Sbjct  19   SCDGTMGRHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADG  78

Query  380  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLP  559
            YARA+GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGL 
Sbjct  79   YARAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLS  138

Query  560  DFTQ  571
            DF+Q
Sbjct  139  DFSQ  142



>ref|XP_011027712.1| PREDICTED: pyruvate decarboxylase 1-like [Populus euphratica]
Length=593

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARA
Sbjct  32   TLGSHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARA  91

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHT GLPDFTQ
Sbjct  92   KGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYGTNRILHHTTGLPDFTQ  151



>ref|XP_010108431.1| Pyruvate decarboxylase isozyme 1 [Morus notabilis]
 gb|EXC19459.1| Pyruvate decarboxylase isozyme 1 [Morus notabilis]
Length=589

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            +S   TLGRHLARRL++IG  DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAAD
Sbjct  23   ASWSGTLGRHLARRLIEIGARDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAAD  82

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSND+GTNRILHHTIGL
Sbjct  83   GYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGL  142

Query  557  PDFTQ  571
            PDF+Q
Sbjct  143  PDFSQ  147



>ref|XP_010257091.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=580

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  376
            +S+  TLGRH+A RLV+IG+TDVFSVPGDFNL LLDHLIA+PGL LIGCCNELNAGYAAD
Sbjct  14   ASSGPTLGRHIAHRLVEIGITDVFSVPGDFNLILLDHLIAQPGLNLIGCCNELNAGYAAD  73

Query  377  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL  556
            GYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYGTNRI+HHTIGL
Sbjct  74   GYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYGTNRIIHHTIGL  133

Query  557  PDFTQ  571
            PDF+Q
Sbjct  134  PDFSQ  138



>ref|XP_010037690.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW49438.1| hypothetical protein EUGRSUZ_K02969 [Eucalyptus grandis]
Length=644

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDHL+ EPGL LIGCCNELNAGYA
Sbjct  75   ALGPSEATLGCHLARRLVEIGVGDVFSVPGDFNLSLLDHLVTEPGLNLIGCCNELNAGYA  134

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG N++LHHTI
Sbjct  135  ADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGRNQVLHHTI  194

Query  551  GLPDFTQ  571
            GLPDFTQ
Sbjct  195  GLPDFTQ  201



>ref|XP_002522545.1| pyruvate decarboxylase, putative [Ricinus communis]
 gb|EEF39845.1| pyruvate decarboxylase, putative [Ricinus communis]
Length=589

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  212  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  391
            TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+
Sbjct  28   TLGGHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARS  87

Query  392  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  88   RGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  147



>ref|XP_003593734.1| Pyruvate decarboxylase [Medicago truncatula]
 gb|AES63985.1| pyruvate decarboxylase [Medicago truncatula]
Length=582

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  379
            + + T+G HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG
Sbjct  17   TCDGTMGGHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADG  76

Query  380  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLP  559
            YARA+GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLP
Sbjct  77   YARAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLP  136

Query  560  DFTQ  571
            DF+Q
Sbjct  137  DFSQ  140



>ref|XP_002439941.1| hypothetical protein SORBIDRAFT_09g023060 [Sorghum bicolor]
 gb|EES18371.1| hypothetical protein SORBIDRAFT_09g023060 [Sorghum bicolor]
Length=609

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  394
            LGRHLARRLVQIG +DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+R
Sbjct  49   LGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLSLVGCCNELNAGYAADGYARSR  108

Query  395  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            GVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDF+Q
Sbjct  109  GVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQ  167



>ref|XP_010040424.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW45221.1| hypothetical protein EUGRSUZ_L01136 [Eucalyptus grandis]
Length=644

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +2

Query  188  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  367
             A   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDH + EPGL LIGCCNELNAGY
Sbjct  74   AALGPSEATLGCHLARRLVEIGVGDVFSVPGDFNLSLLDHFVTEPGLNLIGCCNELNAGY  133

Query  368  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHT  547
            AADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG N++LHHT
Sbjct  134  AADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGRNQVLHHT  193

Query  548  IGLPDFTQ  571
            IGLPDFTQ
Sbjct  194  IGLPDFTQ  201



>gb|KCW45220.1| hypothetical protein EUGRSUZ_L01136 [Eucalyptus grandis]
Length=640

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDH + EPGL LIGCCNELNAGYA
Sbjct  75   ALGPSEATLGCHLARRLVEIGVGDVFSVPGDFNLSLLDHFVTEPGLNLIGCCNELNAGYA  134

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG N++LHHTI
Sbjct  135  ADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGRNQVLHHTI  194

Query  551  GLPDFTQ  571
            GLPDFTQ
Sbjct  195  GLPDFTQ  201



>gb|KCW45222.1| hypothetical protein EUGRSUZ_L01136 [Eucalyptus grandis]
Length=653

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  191  AFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagya  370
            A   +EATLG HLARRLV+IGV DVFSVPGDFNL+LLDH + EPGL LIGCCNELNAGYA
Sbjct  75   ALGPSEATLGCHLARRLVEIGVGDVFSVPGDFNLSLLDHFVTEPGLNLIGCCNELNAGYA  134

Query  371  adgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTI  550
            ADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG N++LHHTI
Sbjct  135  ADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYGRNQVLHHTI  194

Query  551  GLPDFTQ  571
            GLPDFTQ
Sbjct  195  GLPDFTQ  201



>gb|ABJ99597.1| pyruvate decarboxylase [Lycoris aurea]
Length=605

 Score =   197 bits (500),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 108/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  185  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  364
            P A   +E TLG H+ARRLVQ+GV D F VPGDFNLTLLDHLIAEPGL  +GCCNELNAG
Sbjct  35   PAAAIPSECTLGGHVARRLVQVGVRDFFGVPGDFNLTLLDHLIAEPGLNYVGCCNELNAG  94

Query  365  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHH  544
            YAADGYARA GVGACVVTFTVGGLSVLNAIAGAYSENLPLICI GGPNS+D+GT+RILHH
Sbjct  95   YAADGYARAHGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIAGGPNSSDFGTSRILHH  154

Query  545  TIGLPDFTQ  571
            TIGLPDF+Q
Sbjct  155  TIGLPDFSQ  163



>ref|XP_008805886.1| PREDICTED: pyruvate decarboxylase 1 [Phoenix dactylifera]
Length=577

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  203  AEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgy  382
            A  TLGRHLA RLVQIGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGY
Sbjct  13   AAGTLGRHLALRLVQIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGY  72

Query  383  arargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPD  562
            ARARGVGAC VTFTVGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYGTNRILHHTIGLPD
Sbjct  73   ARARGVGACAVTFTVGGLSVINAIAGSYSENLPIICIVGGPNSNDYGTNRILHHTIGLPD  132

Query  563  FTQ  571
            F+Q
Sbjct  133  FSQ  135



>ref|XP_002276535.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Vitis vinifera]
Length=607

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  137  DVANAPTIG-VNTVHSTPVAF--SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDH  307
            DV +AP  G V+T+  +P     + + ATLG H+A RLVQIGV DVFSVPGDFNLTLLD 
Sbjct  18   DVGSAPQNGTVSTIQDSPSPAHPTGSRATLGSHIAHRLVQIGVNDVFSVPGDFNLTLLDC  77

Query  308  LIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLI  487
            +IAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGLS+LNAIAGAYSENLP+I
Sbjct  78   IIAEPGLNNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSILNAIAGAYSENLPVI  137

Query  488  CIVGGPNSNDYGTNRILHHTIGLPDFTQ  571
            CIVGGPN+NDYGTNRILHHTIGLPDF+Q
Sbjct  138  CIVGGPNTNDYGTNRILHHTIGLPDFSQ  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515