BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF016A10

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB65927.1|  cinnamate 4-hydroxylase                                 247   4e-76   Ipomoea batatas [batate]
ref|XP_009766429.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    246   1e-75   Nicotiana sylvestris
gb|ABC69413.1|  CYP73A47v2                                              244   7e-75   Nicotiana tabacum [American tobacco]
ref|XP_009601847.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    244   9e-75   Nicotiana tomentosiformis
emb|CAJ41419.1|  trans-cinnamate 4-monooxygenase                        235   1e-74   Coffea arabica [arabica coffee]
ref|XP_009607087.1|  PREDICTED: trans-cinnamate 4-monooxygenase         242   4e-74   Nicotiana tomentosiformis
gb|ABC69046.1|  cinnamic acid 4-hydroxylase                             241   7e-74   Solanum tuberosum [potatoes]
gb|AFP89891.1|  cinnamate 4-hydroxylase                                 233   8e-74   Neolamarckia cadamba
ref|XP_011089532.1|  PREDICTED: trans-cinnamate 4-monooxygenase         241   8e-74   Sesamum indicum [beniseed]
gb|AFP89895.1|  cinnamate 4-hydroxylase                                 232   8e-74   Neolamarckia cadamba
gb|ACF19421.1|  candidate cinnamic acid 4-hydroxylase                   241   9e-74   Capsicum annuum
ref|XP_009798122.1|  PREDICTED: trans-cinnamate 4-monooxygenase         241   1e-73   Nicotiana sylvestris
ref|XP_006350887.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    241   1e-73   Solanum tuberosum [potatoes]
gb|AFR37513.1|  cinnamate 4-hydroxylase                                 229   2e-73   Populus alba [abele]
gb|AHJ60265.1|  cinnamate 4-monooxygenase                               240   2e-73   Ipomoea purpurea
gb|AFR37514.1|  cinnamate 4-hydroxylase                                 229   2e-73   Populus alba [abele]
gb|ADX33332.1|  cinnamate-4-hydroxylase 1                               240   2e-73   Petunia x hybrida [garden petunia]
gb|AAG43824.1|AF212318_1  cinnamic acid 4-hydroxylase                   240   2e-73   Capsicum annuum
gb|AFP89890.1|  cinnamate 4-hydroxylase                                 231   2e-73   Neolamarckia cadamba
ref|XP_009374388.1|  PREDICTED: trans-cinnamate 4-monooxygenase         241   2e-73   Pyrus x bretschneideri [bai li]
gb|ADY38556.1|  cinnamate 4-hydroxylase                                 229   3e-73   Acacia mangium
gb|ADY38558.1|  cinnamate 4-hydroxylase                                 228   3e-73   Acacia mangium
gb|ADY38559.1|  cinnamate 4-hydroxylase                                 228   4e-73   Acacia mangium
dbj|BAB71716.1|  cinnamic acid 4-hydroxylase                            239   5e-73   Lithospermum erythrorhizon
gb|AFR37525.1|  cinnamate 4-hydroxylase                                 228   6e-73   Populus fremontii
gb|AFR37504.1|  cinnamate 4-hydroxylase                                 228   6e-73   Populus trichocarpa [western balsam poplar]
gb|AFR37498.1|  cinnamate 4-hydroxylase                                 228   7e-73   Populus trichocarpa [western balsam poplar]
gb|AFR37519.1|  cinnamate 4-hydroxylase                                 227   1e-72   Populus fremontii
gb|ADZ54778.1|  trans-cinnamate 4-monooxygenase                         238   1e-72   Prunus avium [gean]
emb|CDP19477.1|  unnamed protein product                                238   1e-72   Coffea canephora [robusta coffee]
ref|XP_010094425.1|  Trans-cinnamate 4-monooxygenase                    238   2e-72   Morus notabilis
gb|AFP49808.1|  cinnamate 4-hydroxylase 4                               238   2e-72   Coffea arabica [arabica coffee]
sp|O24312.1|TCMO_POPTM  RecName: Full=Trans-cinnamate 4-monooxyge...    238   2e-72   Populus tremuloides
gb|AAG10197.1|  cinnamate-4-hydroxylase                                 237   2e-72   Gossypium arboreum [tree cotton]
gb|AAG50231.1|AF302495_1  cinnamate 4-hydroxylase                       237   3e-72   Populus trichocarpa x Populus deltoides
ref|XP_002319974.1|  hypothetical protein POPTR_0013s15380g             237   3e-72   Populus trichocarpa [western balsam poplar]
gb|ACC63873.1|  trans-cinnamate 4-hydroxylase                           237   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010252045.1|  PREDICTED: trans-cinnamate 4-monooxygenase         237   3e-72   Nelumbo nucifera [Indian lotus]
gb|AFR37521.1|  cinnamate 4-hydroxylase                                 226   3e-72   Populus fremontii
gb|AFR37528.1|  cinnamate 4-hydroxylase                                 225   5e-72   Populus nigra [black poplar]
ref|XP_007011365.1|  Cinnamate-4-hydroxylase                            236   6e-72   
pir||PC4236  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) B - ...    233   6e-72
dbj|BAJ17666.1|  cinnamate 4-hydroxylase                                236   6e-72   Gynura bicolor
ref|XP_010253046.1|  PREDICTED: trans-cinnamate 4-monooxygenase         236   7e-72   Nelumbo nucifera [Indian lotus]
gb|EYU46023.1|  hypothetical protein MIMGU_mgv1a004904mg                236   7e-72   Erythranthe guttata [common monkey flower]
gb|ADX33333.1|  cinnamate-4-hydroxylase 2                               236   7e-72   Petunia x hybrida [garden petunia]
sp|P48522.1|TCMO_CATRO  RecName: Full=Trans-cinnamate 4-monooxyge...    236   8e-72   Catharanthus roseus [chatas]
gb|AEA02458.1|  cinnamate 4-hydroxylase                                 236   8e-72   Prunus armeniaca
ref|XP_008240713.1|  PREDICTED: trans-cinnamate 4-monooxygenase         236   8e-72   Prunus mume [ume]
ref|XP_007205045.1|  hypothetical protein PRUPE_ppa004544mg             236   9e-72   Prunus persica
gb|AEA02459.1|  cinnamate 4-hydroxylase                                 236   9e-72   Prunus cerasifera x Prunus munsoniana
gb|ABN48717.1|  cinnamate 4-hydroxylase                                 236   1e-71   Salvia miltiorrhiza [Chinese salvia]
gb|ABC75596.1|  cinnamate 4-hydroxylase                                 236   1e-71   Salvia miltiorrhiza [Chinese salvia]
gb|AJD25173.1|  cytochrome P450 CYP73A120                               236   1e-71   Salvia miltiorrhiza [Chinese salvia]
ref|NP_001281035.1|  trans-cinnamate 4-monooxygenase                    235   1e-71   Malus domestica [apple tree]
gb|AHY94893.1|  cinnamate-4-hydroxylase                                 235   1e-71   Prunella vulgaris
ref|XP_003544934.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    235   2e-71   Glycine max [soybeans]
gb|AIY32618.1|  cinnamate-4-hydroxylase                                 235   2e-71   Perilla frutescens [beefsteak-mint]
emb|CAM84301.1|  putative cinnamate 4-hydroxylase                       226   2e-71   Cynara cardunculus var. scolymus [artichoke]
gb|ABY51678.1|  cinnamic acid 4-hydroxylase                             228   2e-71   Plagiochasma appendiculatum
ref|XP_011080651.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    235   2e-71   Sesamum indicum [beniseed]
gb|AHB52741.1|  cinnamate 4-hydroxylase                                 235   2e-71   Pyrus x bretschneideri [bai li]
gb|KHG02507.1|  Cytochrome P450 protein                                 236   2e-71   Gossypium arboreum [tree cotton]
ref|XP_004294725.1|  PREDICTED: trans-cinnamate 4-monooxygenase         235   2e-71   Fragaria vesca subsp. vesca
gb|KDP45711.1|  hypothetical protein JCGZ_17318                         235   2e-71   Jatropha curcas
ref|XP_008456253.1|  PREDICTED: trans-cinnamate 4-monooxygenase         235   2e-71   Cucumis melo [Oriental melon]
gb|ABF69101.1|  trans-cinnamate 4-hydroxylase                           234   3e-71   Populus tremuloides
gb|KJB72975.1|  hypothetical protein B456_011G207000                    234   3e-71   Gossypium raimondii
gb|AGX85600.1|  coumarate 4-hydroxylase                                 234   3e-71   Scoparia dulcis [escobilla]
gb|AEM63594.1|  cinnamate 4-hydroxylase                                 234   3e-71   Leucaena leucocephala [cassie]
gb|AFN44010.1|  cinnamate 4-hydroxylase                                 234   4e-71   Neolamarckia cadamba
gb|AID16078.1|  cinnamate 4-hydroxylase                                 234   5e-71   Morus alba
ref|XP_004154553.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    234   6e-71   
ref|XP_004139932.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    234   6e-71   
gb|AEN19718.1|  cinnamate 4-hydroxylase                                 234   6e-71   Acacia auriculiformis x Acacia mangium
gb|ACF74449.1|  trans-cinnamate 4-monooxygenase                         234   6e-71   Echinacea angustifolia [black sampson]
gb|ABX75854.1|  cinnamate 4-hydroxylase                                 234   6e-71   Acacia auriculiformis x Acacia mangium
gb|ADO16243.1|  cinnamate 4-hydroxylase                                 234   6e-71   Ocimum tenuiflorum [holy basil]
gb|ABD77493.2|  cinnamic acid 4-hydroxylase                             233   7e-71   Arnebia euchroma
gb|AGJ84133.1|  putative trans-cinnamate 4-hydroxylase                  233   9e-71   Hibiscus cannabinus [bimli-jute]
gb|ABA59555.1|  cinnamate-4-hydroxylase                                 233   1e-70   Parthenocissus henryana
ref|XP_011021057.1|  PREDICTED: trans-cinnamate 4-monooxygenase         233   1e-70   Populus euphratica
emb|CAK95273.1|  cinnamate-4-hydroxylase                                233   1e-70   Cucumis sativus [cucumbers]
gb|ACE95171.1|  cinnamate-4-hydroxylase                                 233   1e-70   Populus tomentosa [Chinese white poplar]
gb|ABF69102.1|  trans-cinnamate 4-hydroxylase                           233   1e-70   Populus tremuloides
gb|AFU54390.1|  cinnamate 4-hydroxylase                                 233   1e-70   Fagopyrum tataricum [Kangra buckwheat]
gb|EYU36901.1|  hypothetical protein MIMGU_mgv1a004876mg                233   2e-70   Erythranthe guttata [common monkey flower]
gb|AFG30055.1|  cinnamate-4-hydroxylase                                 233   2e-70   Malus hybrid cultivar
ref|XP_011041784.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    233   2e-70   Populus euphratica
ref|NP_001237317.1|  trans-cinnamate 4-monooxygenase                    233   2e-70   Glycine max [soybeans]
gb|ACR44227.1|  C4H                                                     233   2e-70   Glycine max [soybeans]
gb|ABF69099.1|  trans-cinnamate 4-hydroxylase                           232   2e-70   Populus tremuloides
gb|AHG97392.1|  C4H catalytic cinnamic acid-4-hydroxylase               232   2e-70   Ageratina adenophora
sp|Q43054.1|TCMO_POPKI  RecName: Full=Trans-cinnamate 4-monooxyge...    232   2e-70   Populus sieboldii x Populus grandidentata
gb|AID69233.1|  cinnamate 4-hydroxylase                                 232   2e-70   Garcinia mangostana [mangosteen]
gb|AFZ78542.1|  cinnamate 4-hydroxylase                                 232   3e-70   Populus tomentosa [Chinese white poplar]
gb|AEK94316.1|  cinnamic acid 4-hydroxylase-like protein                232   3e-70   Pyrus x bretschneideri [bai li]
sp|P37115.1|TCMO_VIGRR  RecName: Full=Trans-cinnamate 4-monooxyge...    232   3e-70   Vigna radiata var. radiata [golden gram]
gb|ABF69100.1|  trans-cinnamate 4-hydroxylase                           232   4e-70   Populus tremuloides
sp|Q43240.1|TCMO_ZINVI  RecName: Full=Trans-cinnamate 4-monooxyge...    231   4e-70   Zinnia elegans [garden zinnia]
ref|XP_002325638.1|  trans-cinnamate 4-monooxygenase family protein     231   5e-70   Populus trichocarpa [western balsam poplar]
gb|AAS48416.1|  cinammate 4-hydroxylase                                 231   5e-70   Allium cepa
sp|Q04468.1|TCMO_HELTU  RecName: Full=Trans-cinnamate 4-monooxyge...    231   5e-70   Helianthus tuberosus [Jerusalem artichoke]
gb|ACM69364.1|  cinnamic acid 4-hydroxylase                             231   6e-70   Humulus lupulus [common hop]
ref|XP_010685980.1|  PREDICTED: trans-cinnamate 4-monooxygenase         231   6e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010522015.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    231   7e-70   Tarenaya hassleriana [spider flower]
gb|AIB06733.1|  cinnamate 4-mono-oxygenase                              231   8e-70   Mangifera indica
gb|AFR37523.1|  cinnamate 4-hydroxylase                                 219   8e-70   Populus fremontii
gb|AAG10196.1|AF286647_1  cinnamate-4-hydroxylase                       231   9e-70   Gossypium arboreum [tree cotton]
gb|AAT39513.1|  cinnamate-4-hydroxylase                                 231   1e-69   Camptotheca acuminata
ref|XP_003616037.1|  Trans-cinnamate 4-monooxygenase                    231   1e-69   Medicago truncatula
gb|ADN32769.1|  cinnamate 4-hydroxylase                                 230   1e-69   Scutellaria baicalensis [Baikal skullcap]
gb|ADO16244.1|  cinnamate 4-hydroxylase                                 230   1e-69   Ocimum basilicum [basil]
gb|ABX74779.1|  cinnamate-4-hydroxylase                                 230   2e-69   Rubus coreanus [cha tian pao]
ref|XP_002458683.1|  hypothetical protein SORBIDRAFT_03g038160          230   2e-69   Sorghum bicolor [broomcorn]
gb|AGU91429.1|  trans-cinnamate 4-monooxygenase                         230   2e-69   Chrysanthemum boreale
gb|AEM63672.1|  cinnamate 4-hydroxylase                                 230   2e-69   Platycodon grandiflorus [balloon-flower]
gb|ADG43134.1|  cinnamate 4-hydroxylase                                 230   2e-69   Isatis tinctoria [woad]
sp|Q43033.1|TCMO_PETCR  RecName: Full=Trans-cinnamate 4-monooxyge...    229   2e-69   Petroselinum crispum
ref|XP_011015228.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    229   2e-69   Populus euphratica
ref|XP_010542699.1|  PREDICTED: trans-cinnamate 4-monooxygenase         229   3e-69   Tarenaya hassleriana [spider flower]
gb|ACM17896.1|  cinnamate-4-hydroxylase                                 229   3e-69   Rubus occidentalis [black raspberry]
gb|ABX74781.1|  cinnamate-4-hydroxylase                                 229   3e-69   Rubus sp. SSL-2007
gb|AHL83550.1|  C4H                                                     229   4e-69   Morus alba var. multicaulis
gb|AHA84274.1|  trans-cinnamate 4-monooxygenase                         229   4e-69   Phaseolus vulgaris [French bean]
gb|AEV93475.1|  4-coumarate:CoA ligase                                  229   4e-69   Caragana korshinskii
ref|XP_006842509.1|  hypothetical protein AMTR_s00077p00107120          229   4e-69   Amborella trichopoda
dbj|BAB71717.1|  cinnamic acid 4-hydroxylase                            229   4e-69   Lithospermum erythrorhizon
dbj|BAJ22964.1|  cinnamate 4-hydroxylase                                219   4e-69   Agastache foeniculum [anise hyssop]
gb|AGH32777.1|  cinnamic acid 4-hydroxylase                             229   5e-69   Camellia chekiangoleosa
gb|ACR10242.1|  cinnamate-4-hydroxylase                                 229   6e-69   Canarium album [Chinese white-olive]
ref|XP_007142041.1|  hypothetical protein PHAVU_008G247400g             228   7e-69   Phaseolus vulgaris [French bean]
ref|XP_002881114.1|  cinnamate-4-hydroxylase                            228   7e-69   
ref|XP_010414263.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    228   7e-69   Camelina sativa [gold-of-pleasure]
gb|ADO16181.1|  cytochrome P450 mono-oxygenase                          228   8e-69   Artemisia annua [sweet Annie]
ref|XP_010510361.1|  PREDICTED: trans-cinnamate 4-monooxygenase         228   8e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006410152.1|  hypothetical protein EUTSA_v10016545mg             228   8e-69   Eutrema salsugineum [saltwater cress]
gb|AAC99993.1|  cinnamate 4-hydroxylase                                 228   8e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AGG55322.1|  cinnamate 4-hydroxylase                                 228   8e-69   Paeonia lactiflora [common garden peony]
gb|ACZ06240.1|  cinnamate 4-hydroxylase 2                               228   9e-69   Gossypium hirsutum [American cotton]
ref|XP_006294053.1|  hypothetical protein CARUB_v10023044mg             228   9e-69   Capsella rubella
emb|CAP08828.1|  cinnamate-4-hydroxylase                                228   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAB58355.1|  cinnamate-4-hydroxylase                                 228   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AIT52342.1|  cinammate 4-hydroxylase 1                               228   1e-68   Daucus carota [carrots]
emb|CAP08827.1|  cinnamate-4-hydroxylase                                228   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242478.1|  PREDICTED: trans-cinnamate 4-monooxygenase         222   1e-68   Solanum lycopersicum
ref|XP_004242477.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    222   1e-68   Solanum lycopersicum
ref|XP_008355112.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    222   1e-68   
ref|XP_008810838.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    228   1e-68   Phoenix dactylifera
gb|AAO62904.1|  cinnamate 4-hydroxylase                                 228   1e-68   Ammi majus [ameo mayor]
gb|KJB83924.1|  hypothetical protein B456_013G271700                    228   2e-68   Gossypium raimondii
gb|ACJ37399.1|  trans-cinnamate 4-monooxygenase                         228   2e-68   Echinacea angustifolia [black sampson]
gb|ABF17873.1|  cinnamate 4-hydroxylase isoform 1                       228   2e-68   Brassica napus [oilseed rape]
ref|XP_008788521.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    227   2e-68   Phoenix dactylifera
dbj|BAI77480.1|  cinnamate-4-hydroxylase                                227   2e-68   Brassica rapa
ref|XP_004970385.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    227   2e-68   
gb|AGP25594.1|  cinnamate 4-hydroxylase                                 227   2e-68   Aquilaria sinensis
dbj|BAE72875.1|  Cinnamic acid 4-hydroxylase                            227   2e-68   Glandularia x hybrida [garden verbena]
gb|ACY78690.1|  trans-cinnamate 4-monooxygenase                         227   2e-68   Cynara cardunculus var. scolymus [artichoke]
dbj|BAF81522.1|  cinnamate-4-hydroxylase                                227   2e-68   Brassica rapa
ref|XP_010921158.1|  PREDICTED: trans-cinnamate 4-monooxygenase         227   3e-68   Elaeis guineensis
gb|AGM46644.1|  cinnamate 4-hydroxylase protein                         220   3e-68   Apium graveolens
ref|NP_001288861.1|  trans-cinnamate 4-monooxygenase                    227   3e-68   Brassica rapa
ref|XP_002523952.1|  cinnamate 4-hydroxylase, putative                  227   3e-68   Ricinus communis
gb|ADO24190.1|  cinnamate 4-hydroxylase                                 227   3e-68   Allium sativum
ref|XP_010922761.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    227   3e-68   Elaeis guineensis
gb|AGC29944.1|  CYP73A107                                               226   4e-68   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|KFK22945.1|  hypothetical protein AALP_AAs47561U000100               226   6e-68   Arabis alpina [alpine rockcress]
gb|AFV91401.1|  cinnamate 4-hydroxylase C4H2                            217   6e-68   Salix hybrid cultivar
gb|AFV91398.1|  cinnamate 4-hydroxylase C4H2                            216   7e-68   Salix hybrid cultivar
gb|AFV91396.1|  cinnamate 4-hydroxylase C4H2                            217   7e-68   Salix hybrid cultivar
ref|XP_010103664.1|  Trans-cinnamate 4-monooxygenase                    226   7e-68   Morus notabilis
gb|AFV91400.1|  cinnamate 4-hydroxylase C4H2                            217   7e-68   Salix dasyclados
ref|XP_009354880.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    226   8e-68   Pyrus x bretschneideri [bai li]
gb|AFV91399.1|  cinnamate 4-hydroxylase C4H2                            216   9e-68   Salix hybrid cultivar
emb|CAP08829.1|  cinnamate-4-hydroxylase                                226   9e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AFV91397.1|  cinnamate 4-hydroxylase C4H2                            216   9e-68   Salix triandra x Salix viminalis
ref|XP_009354868.1|  PREDICTED: trans-cinnamate 4-monooxygenase         225   9e-68   Pyrus x bretschneideri [bai li]
gb|AFV91402.1|  cinnamate 4-hydroxylase C4H2                            216   9e-68   Salix x smithiana
gb|ABE68874.1|  cinnamate 4-hydroxylase                                 225   1e-67   Brassica rapa subsp. pekinensis [bai cai]
gb|AJD22263.1|  cinnamate 4-hydroxylase                                 225   1e-67   Angelica dahurica
ref|XP_008782669.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    225   1e-67   Phoenix dactylifera
gb|ACB78015.1|  cinnamic acid 4-hydroxylase                             225   1e-67   Trifolium pratense [peavine clover]
sp|P37114.1|TCMO_MEDSA  RecName: Full=Trans-cinnamate 4-monooxyge...    225   1e-67   Medicago sativa [alfalfa]
gb|ACZ73612.1|  cinnamate 4-hydroxylase                                 225   1e-67   Bambusa oldhamii
gb|AAU09021.1|  Cinnamic acid 4-hydroxylase                             225   1e-67   Agastache rugosa
ref|XP_003564495.1|  PREDICTED: trans-cinnamate 4-monooxygenase         225   2e-67   Brachypodium distachyon [annual false brome]
emb|CDY23995.1|  BnaC03g16960D                                          225   2e-67   Brassica napus [oilseed rape]
emb|CDX84829.1|  BnaA03g14010D                                          225   2e-67   
gb|AFY17065.1|  cinnamate 4-hydroxylase 2                               224   2e-67   Panicum virgatum
gb|ABF17875.1|  cinnamate 4-hydroxylase isoform 2                       224   2e-67   Brassica napus [oilseed rape]
emb|CDX97826.1|  BnaC04g41130D                                          224   2e-67   
ref|XP_008792249.1|  PREDICTED: trans-cinnamate 4-monooxygenase         224   2e-67   Phoenix dactylifera
ref|XP_009141068.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    224   3e-67   Brassica rapa
gb|AFD29887.1|  cinnamate 4-hydroxylase                                 224   4e-67   Bambusa emeiensis
gb|AFV47361.1|  C4H                                                     224   4e-67   Helichrysum aureonitens
gb|KDO45077.1|  hypothetical protein CISIN_1g021610mg                   218   4e-67   Citrus sinensis [apfelsine]
ref|NP_180607.1|  trans-cinnamate 4-monooxygenase                       224   4e-67   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA24355.1|  trans-cinnamate 4-hydroxylase                          224   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017089.1|  Cinnamate-4-hydroxylase                            224   5e-67   Theobroma cacao [chocolate]
ref|XP_009132739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    223   5e-67   Brassica rapa
ref|XP_002266238.1|  PREDICTED: trans-cinnamate 4-monooxygenase         223   6e-67   Vitis vinifera
gb|KDO45078.1|  hypothetical protein CISIN_1g021610mg                   217   7e-67   Citrus sinensis [apfelsine]
ref|XP_007146898.1|  hypothetical protein PHAVU_006G079700g             223   8e-67   Phaseolus vulgaris [French bean]
gb|AAC35857.1|  cinnamic acid 4-hydroxylase                             222   1e-66   Capsicum chinense [bonnet pepper]
gb|AHJ61295.1|  cinnamate-4-hydroxylase                                 223   1e-66   Hordeum vulgare [barley]
dbj|BAJ95120.1|  predicted protein                                      223   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAP08846.1|  cinnamate-4-hydroxylase                                222   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AGJ71350.1|  cinnamate 4-hydroxylase 1                               223   1e-66   Eucalyptus urophylla
ref|XP_009354901.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    222   2e-66   
ref|XP_010032943.1|  PREDICTED: trans-cinnamate 4-monooxygenase         222   2e-66   Eucalyptus grandis [rose gum]
gb|ACH56520.1|  cinnamate-4-hydroxylase                                 222   2e-66   Gossypium hirsutum [American cotton]
emb|CAE54486.1|  unnamed protein product                                212   2e-66   Pinus pinaster [cluster pine]
ref|XP_010931381.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    222   2e-66   
gb|ACZ54906.1|  cinnamate 4-hydroxylase                                 221   3e-66   Leucaena leucocephala [cassie]
gb|AEM63593.1|  cinnamate 4-hydroxylase                                 221   3e-66   Leucaena leucocephala [cassie]
gb|AID51447.1|  cinnamate 4-hydroxylase 2                               221   7e-66   Astragalus membranaceus
sp|Q96423.1|TCMO_GLYEC  RecName: Full=Trans-cinnamate 4-monooxyge...    220   8e-66   Glycyrrhiza echinata [hedgehog licorice]
gb|AEA72281.1|  cinnamate 4-hydroxylase                                 220   8e-66   Angelica gigas
gb|AFD36436.1|  cinnamate 4-hydroxylase 1                               220   1e-65   Astragalus membranaceus
ref|XP_010938024.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    220   1e-65   Elaeis guineensis
gb|AIS92509.1|  cinnamate 4-hydroxylase                                 220   1e-65   Epimedium sagittatum
gb|AEH68208.1|  cinnamate 4-hydroxylase                                 220   1e-65   Astragalus mongholicus
ref|XP_008657127.1|  PREDICTED: trans-cinnamate 4-monooxygenase         219   3e-65   Zea mays [maize]
gb|AGE10592.1|  cinnamate 4-hydroxylase                                 219   3e-65   Lonicera japonica [Japanese honeysuckle]
gb|KGN46762.1|  hypothetical protein Csa_6G133710                       216   4e-65   Cucumis sativus [cucumbers]
ref|XP_004151467.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    219   4e-65   Cucumis sativus [cucumbers]
gb|AGO03798.1|  cytochrome P450-like protein                            218   4e-65   Tanacetum cinerariifolium [pyrethrum]
gb|AGN70893.1|  cinammate 4-hydroxylase                                 218   5e-65   Dendrobium officinale
ref|XP_006432069.1|  hypothetical protein CICLE_v10000921mg             218   6e-65   Citrus clementina [clementine]
emb|CDY23996.1|  BnaC03g16950D                                          218   6e-65   Brassica napus [oilseed rape]
gb|ACE88962.1|  cinnamic acid 4-hydroxylase                             217   1e-64   Phyllostachys edulis [kikko-chiku]
gb|ABF58026.1|  cinnamate-4-hydroxylate-like                            216   1e-64   Hibiscus cannabinus [bimli-jute]
gb|ACY06865.2|  cinnamate 4-hydroxylase                                 218   1e-64   Astragalus chrysochlorus
gb|ACB78014.1|  cinnamic acid 4-hydroxylase                             217   1e-64   Trifolium pratense [peavine clover]
ref|XP_009410039.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    217   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACB78016.1|  cinnamic acid 4-hydroxylase                             217   1e-64   Trifolium pratense [peavine clover]
sp|Q43067.2|TCMO_PEA  RecName: Full=Trans-cinnamate 4-monooxygena...    216   2e-64   Pisum sativum [garden pea]
gb|AFK42083.1|  unknown                                                 206   3e-64   Medicago truncatula
ref|XP_009421412.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    216   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009141067.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    215   9e-64   Brassica rapa
gb|AFV91409.1|  cinnamate 4-hydroxylase C4H2                            205   1e-63   Populus tremula [European aspen]
ref|XP_008457287.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    215   1e-63   Cucumis melo [Oriental melon]
emb|CDY29671.1|  BnaA04g17560D                                          214   1e-63   Brassica napus [oilseed rape]
gb|AHG06398.1|  cinnamic acid 4-hydroxylase                             214   2e-63   Ornithogalum longebracteatum [sea-onion]
emb|CDX97827.1|  BnaC04g41120D                                          214   2e-63   
gb|AAG09205.1|AF175275_1  trans-cinnamic acid hydroxylase               214   2e-63   Pisum sativum [garden pea]
gb|AAC49187.2|  trans-cinnamic acid hydroxylase                         214   2e-63   Pisum sativum [garden pea]
prf||2209439A  cytochrome P450 monooxygenase                            214   3e-63
gb|AAW70021.1|  cinnamic acid 4-hydroxylase                             214   3e-63   Ginkgo biloba [ginkgo]
ref|XP_004500376.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    213   5e-63   Cicer arietinum [garbanzo]
gb|ACN40359.1|  unknown                                                 213   7e-63   Picea sitchensis
gb|AHA92090.1|  cinnamate 4-hydroxylase                                 208   7e-63   Vanilla planifolia [cultivated vanilla]
ref|NP_001266151.1|  trans-cinnamate 4-monooxygenase                    213   8e-63   
gb|AFL65041.1|  trans-cinnamate 4-hydroxylase                           213   9e-63   Pinus pinaster [cluster pine]
gb|AHI17493.2|  cinnamate 4-hydroxylase                                 212   1e-62   Dryopteris fragrans
gb|AAD23378.1|AF096998_1  trans-cinnamate 4-hydroxylase                 211   2e-62   Pinus taeda
ref|XP_009132738.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    211   4e-62   Brassica rapa
emb|CDX84830.1|  BnaA03g14000D                                          211   4e-62   
gb|EMS49797.1|  Trans-cinnamate 4-monooxygenase                         211   7e-62   Triticum urartu
ref|NP_001275824.1|  cinnamate 4-hydroxylase CYP73                      210   9e-62   Citrus sinensis [apfelsine]
gb|EAY76296.1|  hypothetical protein OsI_04230                          209   1e-61   Oryza sativa Indica Group [Indian rice]
gb|EAZ35606.1|  hypothetical protein OsJ_19896                          209   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AHY28685.1|  cinnamate 4-hydroxylase 1                               199   2e-61   Pinus echinata [shortleaf pine]
gb|AHY28700.1|  cinnamate 4-hydroxylase 1                               198   3e-61   Pinus taeda
gb|AHY28687.1|  cinnamate 4-hydroxylase 1                               197   4e-61   Pinus echinata [shortleaf pine]
gb|AFY17064.1|  cinnamate 4-hydroxylase 1                               208   4e-61   Panicum virgatum
ref|XP_002980756.1|  trans-cinnamate 4-hydroxylase                      209   5e-61   Selaginella moellendorffii
ref|XP_002977018.1|  trans-cinnamate 4-hydroxylase                      208   6e-61   Selaginella moellendorffii
gb|ADF28536.1|  cinnamate 4-hydroxylase                                 208   6e-61   Selaginella moellendorffii
gb|ABV80353.1|  cytochrome P450-dependent monooxygenase                 208   7e-61   Selaginella moellendorffii
ref|XP_009421411.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    207   8e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461939.1|  hypothetical protein SORBIDRAFT_02g010910          205   4e-60   Sorghum bicolor [broomcorn]
ref|XP_001773868.1|  predicted protein                                  205   6e-60   
gb|EMT12860.1|  Trans-cinnamate 4-monooxygenase                         204   1e-59   
gb|EPS58735.1|  cinnamate 4-hydroxylase                                 204   1e-59   Genlisea aurea
emb|CDM82046.1|  unnamed protein product                                204   1e-59   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ96982.1|  predicted protein                                      204   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAG17469.1|AF123610_8  cytochrome P450                               204   1e-59   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK03000.1|  predicted protein                                      204   2e-59   
ref|NP_001140726.1|  putative cytochrome P450 superfamily protein       203   4e-59   
ref|NP_001149158.1|  trans-cinnamate 4-monooxygenase                    203   4e-59   
ref|XP_009416323.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    202   5e-59   
ref|XP_003568699.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    202   6e-59   
ref|NP_001055190.1|  Os05g0320700                                       202   6e-59   
gb|EAY97535.1|  hypothetical protein OsI_19463                          202   7e-59   
gb|ADF28535.1|  cinnamate 4-hydroxylase                                 202   8e-59   
ref|XP_001781223.1|  predicted protein                                  202   8e-59   
gb|AAV36374.1|  cinnamate 4-hydroxylase                                 191   2e-58   
gb|AFX98061.1|  cinnamate 4-hydroxylase                                 201   2e-58   
gb|EMS54616.1|  Trans-cinnamate 4-monooxygenase                         199   2e-58   
gb|AAV36368.1|  cinnamate 4-hydroxylase                                 190   3e-58   
ref|XP_006410151.1|  hypothetical protein EUTSA_v10016544mg             201   3e-58   
ref|NP_001140681.1|  putative cytochrome P450 superfamily protein       200   3e-58   
sp|Q9AR74.1|TCMO_RUTGR  RecName: Full=Trans-cinnamate 4-monooxyge...    201   3e-58   
gb|AAN63028.1|  cinnamate 4-hydroxylase                                 200   4e-58   
gb|AAV36401.1|  cinnamate 4-hydroxylase                                 189   5e-58   
pir||PC4237  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) C - ...    199   5e-58
gb|AAV36377.1|  cinnamate 4-hydroxylase                                 189   7e-58   
dbj|BAP11125.1|  putative trans-cinnamate 4-monooxygenase               189   2e-57   
gb|AER39775.1|  CYP73A91                                                198   2e-57   
ref|XP_006654260.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    198   3e-57   
gb|AER39776.1|  CYP73A91-2                                              198   3e-57   
gb|AER39777.1|  CYP73A91-3                                              197   3e-57   
gb|EMT32263.1|  Trans-cinnamate 4-monooxygenase                         197   9e-57   
ref|XP_008780487.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    187   2e-56   
ref|XP_009387809.1|  PREDICTED: cytochrome P450 CYP73A100-like          186   5e-56   
gb|AER39778.1|  CYP73A91-4                                              194   7e-56   
ref|XP_010927178.1|  PREDICTED: cytochrome P450 CYP73A100-like          194   8e-56   
ref|XP_008782811.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    194   1e-55   
ref|XP_008798169.1|  PREDICTED: cytochrome P450 CYP73A100-like          193   4e-55   
ref|XP_009391094.1|  PREDICTED: cytochrome P450 CYP73A100-like          190   4e-55   
ref|XP_010928775.1|  PREDICTED: cytochrome P450 CYP73A100-like          191   2e-54   
ref|XP_011089531.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    189   5e-54   
gb|KGN61202.1|  hypothetical protein Csa_2G070200                       179   9e-54   
gb|AHF20176.1|  cinnamate 4-hydroxylase                                 189   1e-53   
gb|AFV91404.1|  cinnamate 4-hydroxylase C4H2                            179   1e-53   
gb|KDP27749.1|  hypothetical protein JCGZ_19778                         189   1e-53   
ref|XP_004240122.1|  PREDICTED: cytochrome P450 CYP73A100-like          189   1e-53   
ref|XP_002266142.1|  PREDICTED: cytochrome P450 CYP73A100               188   2e-53   
gb|AFV91406.1|  cinnamate 4-hydroxylase C4H2                            179   2e-53   
emb|CDP12494.1|  unnamed protein product                                188   3e-53   
ref|XP_009417516.1|  PREDICTED: cytochrome P450 CYP73A100-like          187   5e-53   
ref|XP_002266037.1|  PREDICTED: cytochrome P450 CYP73A100               187   7e-53   
ref|XP_011089529.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    186   8e-53   
gb|AFV91407.1|  cinnamate 4-hydroxylase C4H2                            176   2e-52   
ref|XP_004151379.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    180   2e-52   
gb|KGN61203.1|  hypothetical protein Csa_2G070210                       179   2e-52   
sp|H2DH22.1|C7A10_PANGI  RecName: Full=Cytochrome P450 CYP73A100        185   3e-52   
ref|XP_010263371.1|  PREDICTED: cytochrome P450 CYP73A100-like          185   3e-52   
emb|CAN70035.1|  hypothetical protein VITISV_027249                     185   3e-52   
ref|XP_007014539.1|  Trans-cinnamate 4-monooxygenase                    185   4e-52   
ref|XP_002534996.1|  cinnamate 4-hydroxylase, putative                  184   7e-52   
ref|XP_006360653.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    184   8e-52   
ref|XP_009618442.1|  PREDICTED: cytochrome P450 CYP73A100-like          184   8e-52   
ref|XP_011017615.1|  PREDICTED: cytochrome P450 CYP73A100-like          184   9e-52   
ref|XP_006850963.1|  hypothetical protein AMTR_s00025p00202710          183   1e-51   
gb|AAK62344.1|  elicitor-inducible cytochrome P450                      183   1e-51   
gb|EYU36902.1|  hypothetical protein MIMGU_mgv1a004808mg                182   2e-51   
ref|XP_008450772.1|  PREDICTED: cytochrome P450 CYP73A100-like          182   3e-51   
ref|XP_008450733.1|  PREDICTED: cytochrome P450 CYP73A100-like          182   3e-51   
gb|AAD11427.1|  cinnamate 4-hydroxylase                                 183   3e-51   
gb|ACC63872.1|  trans-cinnamate 4-hydroxylase                           182   3e-51   
ref|XP_003637406.1|  Trans-cinnamate 4-monooxygenase                    182   4e-51   
ref|XP_009779123.1|  PREDICTED: cytochrome P450 CYP73A100-like          182   5e-51   
ref|XP_010669584.1|  PREDICTED: cytochrome P450 CYP73A100-like          182   8e-51   
gb|KHN11432.1|  Trans-cinnamate 4-monooxygenase                         181   8e-51   
gb|ABO93195.1|  cinnamic acid 4-hydroxylase                             176   8e-51   
ref|XP_008223950.1|  PREDICTED: cytochrome P450 CYP73A100-like          181   8e-51   
ref|XP_003555891.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    181   9e-51   
ref|XP_008450720.1|  PREDICTED: cytochrome P450 CYP73A100-like          181   1e-50   
gb|EMT08179.1|  Trans-cinnamate 4-monooxygenase                         179   2e-50   
gb|AGE10593.1|  cinnamate 4-hydroxylase                                 180   2e-50   
ref|XP_004152891.1|  PREDICTED: LOW QUALITY PROTEIN: trans-cinnam...    180   2e-50   
ref|XP_004299767.1|  PREDICTED: cytochrome P450 CYP73A100-like          180   3e-50   
ref|XP_010533060.1|  PREDICTED: cytochrome P450 CYP73A100-like          180   3e-50   
ref|XP_004172739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    179   3e-50   
ref|NP_001275769.1|  cinnamate 4-hydroxylase CYP73                      179   5e-50   
ref|XP_007225069.1|  hypothetical protein PRUPE_ppa018282mg             178   5e-50   
ref|XP_007142896.1|  hypothetical protein PHAVU_007G026000g             179   7e-50   
gb|AFR37656.1|  cinnamate 4-hydroxylase                                 167   1e-49   
ref|XP_004152894.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    178   1e-49   
gb|AFR37652.1|  cinnamate 4-hydroxylase                                 167   1e-49   
ref|XP_008450760.1|  PREDICTED: cytochrome P450 CYP73A100-like          178   2e-49   
gb|EAY85792.1|  hypothetical protein OsI_07154                          174   2e-49   
gb|EAY85791.1|  hypothetical protein OsI_07153                          174   2e-49   
gb|AFR37649.1|  cinnamate 4-hydroxylase                                 166   3e-49   
gb|KGN61199.1|  hypothetical protein Csa_2G068700                       176   3e-49   
ref|XP_004497107.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    177   3e-49   
gb|EYU36906.1|  hypothetical protein MIMGU_mgv1a025595mg                176   4e-49   
ref|XP_006453189.1|  hypothetical protein CICLE_v10008125mg             176   4e-49   
gb|EYU36905.1|  hypothetical protein MIMGU_mgv1a004883mg                176   4e-49   
ref|XP_010046885.1|  PREDICTED: cytochrome P450 CYP73A100-like          176   5e-49   
ref|XP_006665179.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    172   5e-49   
gb|AGJ71351.1|  cinnamate 4-hydroxylase 2                               176   5e-49   
gb|AFR37664.1|  cinnamate 4-hydroxylase                                 165   6e-49   
gb|KHN05578.1|  Trans-cinnamate 4-monooxygenase                         174   2e-48   
ref|XP_010106946.1|  Trans-cinnamate 4-monooxygenase                    176   3e-48   
ref|NP_001046819.1|  Os02g0467600                                       173   7e-48   
ref|XP_006647306.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    173   1e-47   
gb|EMT22866.1|  Trans-cinnamate 4-monooxygenase                         173   1e-47   
gb|ACR36061.1|  unknown                                                 172   1e-47   
ref|NP_001151365.1|  trans-cinnamate 4-monooxygenase                    172   1e-47   
ref|XP_011089530.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    172   2e-47   
gb|AFR37668.1|  cinnamate 4-hydroxylase                                 162   2e-47   
dbj|BAJ98052.1|  predicted protein                                      172   2e-47   
ref|XP_002452044.1|  hypothetical protein SORBIDRAFT_04g017460          172   2e-47   
ref|NP_001046814.1|  Os02g0467000                                       171   4e-47   
ref|XP_003574953.1|  PREDICTED: cytochrome P450 CYP73A100-like          171   8e-47   
ref|XP_001781937.1|  predicted protein                                  170   8e-47   
emb|CAA70595.1|  cinnamate 4-hydroxylase                                166   4e-45   
dbj|BAI40152.1|  cinnamate 4-hydroxylase                                153   1e-44   
gb|AFV91403.1|  cinnamate 4-hydroxylase C4H2                            155   3e-44   
gb|KHN30609.1|  Trans-cinnamate 4-monooxygenase                         162   4e-44   
gb|AFR37527.1|  cinnamate 4-hydroxylase                                 152   5e-44   
ref|XP_001773101.1|  predicted protein                                  160   2e-43   
gb|AFK25795.1|  cinnamate 4-hydroxylase                                 147   3e-42   
emb|CBI15809.3|  unnamed protein product                                155   3e-41   
gb|AFR37522.1|  cinnamate 4-hydroxylase                                 145   5e-41   
ref|XP_004172870.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    143   9e-40   
gb|KDO62016.1|  hypothetical protein CISIN_1g012770mg                   145   4e-38   
gb|KHN40993.1|  Trans-cinnamate 4-monooxygenase                         145   6e-38   
gb|AFG26507.1|  putative cinnamate 4-hydroxylase                        137   8e-38   
gb|ABD17288.2|  trans-cinnamate 4-monooxygenase                         134   2e-35   
gb|EPS68507.1|  cinnamate-4-hydroxylase 1                               137   3e-35   
gb|AFV91405.1|  cinnamate 4-hydroxylase C4H2                            129   2e-34   
gb|AGO01107.1|  trans-cinnamate 4-monooxygenase                         125   2e-33   
gb|AIT52343.1|  cinammate 4-hydroxylase 2                               127   3e-32   
dbj|BAA24356.1|  trans-ciinamate 4-hydroxylase                          121   4e-32   
emb|CAA94178.1|  Trans-cinnamate 4-monooxygenase                        116   2e-30   
gb|EPS65721.1|  cinnamic acid 4-hydroxylase                             112   2e-28   
gb|EEE56961.1|  hypothetical protein OsJ_06672                          112   5e-27   
gb|AGE10619.1|  cinnamate 4-hydroxylase                                 107   1e-25   
gb|EMT02305.1|  Trans-cinnamate 4-monooxygenase                         105   1e-24   
ref|XP_006372202.1|  hypothetical protein POPTR_0018s14270g             101   2e-23   
ref|NP_001172628.1|  Os01g0820000                                     99.4    5e-21   
gb|KDP45847.1|  hypothetical protein JCGZ_15291                       94.0    2e-19   
ref|XP_008390630.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like  87.8    9e-19   
gb|KDP25764.1|  hypothetical protein JCGZ_23934                       90.9    1e-18   
ref|XP_004304108.2|  PREDICTED: cytochrome P450 71D9-like             92.8    2e-18   
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg           89.0    4e-18   
gb|AIM47559.1|  CYP726A5                                              90.5    5e-18   
gb|KDP45511.1|  hypothetical protein JCGZ_17064                       90.5    6e-18   
gb|KDP45509.1|  hypothetical protein JCGZ_17062                       90.5    7e-18   
dbj|BAO56856.1|  cinnamate-4-hydroxylase                              87.8    7e-18   
gb|EYU20527.1|  hypothetical protein MIMGU_mgv1a025870mg              87.0    8e-18   
gb|KDO62264.1|  hypothetical protein CISIN_1g0110961mg                87.4    8e-18   
gb|KDP42351.1|  hypothetical protein JCGZ_02824                       89.7    1e-17   
ref|XP_002523467.1|  cytochrome P450, putative                        89.7    1e-17   
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like       89.7    1e-17   
ref|XP_004295868.2|  PREDICTED: cytochrome P450 71D11-like            89.7    2e-17   
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                 89.4    2e-17   
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like       89.4    2e-17   
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg           89.4    2e-17   
ref|XP_006367730.1|  PREDICTED: premnaspirodiene oxygenase-like       87.4    2e-17   
ref|XP_004305997.2|  PREDICTED: cytochrome P450 71D11-like            89.4    2e-17   
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like       89.0    2e-17   
ref|XP_009776870.1|  PREDICTED: premnaspirodiene oxygenase-like       87.0    3e-17   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like             87.4    4e-17   
ref|XP_006495418.1|  PREDICTED: cytochrome P450 71D10-like            85.1    4e-17   
ref|XP_007156883.1|  hypothetical protein PHAVU_002G025200g           88.2    4e-17   
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like             88.2    4e-17   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like       87.8    6e-17   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like             87.4    6e-17   
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like       87.4    6e-17   
gb|AAM74260.1|AC074355_22  Putative cytochrome P450                   83.6    6e-17   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like            87.4    7e-17   
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like       87.0    9e-17   
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like             87.0    1e-16   
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...  87.0    1e-16   
ref|XP_006452559.1|  hypothetical protein CICLE_v10010637mg           87.0    1e-16   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like       87.0    1e-16   
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like       87.0    1e-16   
emb|CAR92135.1|  5-epi-aristolochene-1,3-hydroxylase                  84.0    1e-16   
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...  86.7    1e-16   
emb|CAC24711.1|  cytochrome P450                                      86.7    1e-16   
ref|XP_007156884.1|  hypothetical protein PHAVU_002G025300g           86.7    1e-16   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg           86.3    2e-16   
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like       86.3    2e-16   
ref|XP_002513333.1|  cytochrome P450, putative                        86.3    2e-16   
gb|KHM99028.1|  Cytochrome P450 71D11                                 86.3    2e-16   
ref|XP_004973138.1|  PREDICTED: cytochrome P450 99A2-like             85.9    2e-16   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein  85.9    2e-16   
gb|KDO50396.1|  hypothetical protein CISIN_1g048376mg                 83.2    2e-16   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like       85.9    2e-16   
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7           85.9    3e-16   
gb|ABC69398.1|  CYP71D5v3                                             85.9    3e-16   
gb|ABC69402.1|  CYP71D5v2                                             85.5    3e-16   
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1  85.5    3e-16   
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase            85.5    3e-16   
dbj|BAK02752.1|  predicted protein                                    83.6    3e-16   
ref|XP_007020549.1|  Cytochrome P450                                  85.5    3e-16   
ref|XP_004305998.1|  PREDICTED: cytochrome P450 71D11-like            85.5    4e-16   
gb|KDO49907.1|  hypothetical protein CISIN_1g009497mg                 85.5    4e-16   
ref|XP_006487364.1|  PREDICTED: cytochrome P450 84A1-like             85.5    4e-16   
ref|XP_008794219.1|  PREDICTED: premnaspirodiene oxygenase-like       85.1    4e-16   
ref|XP_006423464.1|  hypothetical protein CICLE_v10028122mg           85.5    4e-16   
gb|AIM47560.1|  CYP726A6                                              85.1    4e-16   
ref|XP_004305999.2|  PREDICTED: uncharacterized protein LOC101299609  86.3    4e-16   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...  84.7    4e-16   
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like            85.1    4e-16   
gb|EMS58282.1|  Cytochrome P450 71A18                                 80.9    5e-16   
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like       85.1    5e-16   
ref|XP_009609720.1|  PREDICTED: premnaspirodiene oxygenase            84.0    5e-16   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like       85.1    5e-16   
ref|XP_004242298.1|  PREDICTED: premnaspirodiene oxygenase-like       83.6    5e-16   
ref|XP_006290942.1|  hypothetical protein CARUB_v10017056mg           85.1    5e-16   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...  85.1    5e-16   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg           85.1    5e-16   
gb|KDP42338.1|  hypothetical protein JCGZ_02811                       84.7    5e-16   
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like       84.7    6e-16   
gb|EMT19187.1|  Cytochrome P450 71D7                                  84.7    7e-16   
gb|EEE59442.1|  hypothetical protein OsJ_11620                        84.3    7e-16   
ref|XP_011469756.1|  PREDICTED: cytochrome P450 71A4-like             84.7    7e-16   
ref|XP_004506712.1|  PREDICTED: cytochrome P450 71D10-like            84.7    7e-16   
gb|ABC69399.1|  CYP71D49v1                                            84.3    7e-16   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like            84.3    8e-16   
gb|KHG28615.1|  Cytochrome P450                                       83.6    8e-16   
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like             84.3    8e-16   
gb|ABC69400.1|  CYP71D49v3                                            84.3    8e-16   



>gb|ADB65927.1| cinnamate 4-hydroxylase [Ipomoea batatas]
Length=505

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/137 (99%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAILVAIVVSKLRGKKYKLPPGPLPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM
Sbjct  14   FFAILVAIVVSKLRGKKYKLPPGPLPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYRRGW
Sbjct  134  TVPFFTNKVVQQYRRGW  150



>ref|XP_009766429.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana sylvestris]
Length=506

 Score =   246 bits (628),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 140/150 (93%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAI+VAIVVSKLR KK+KLPPGP+PVP+FGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLLEKTLIGLFFAIIVAIVVSKLRSKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDMFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYRRGW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRRGW  150



>gb|ABC69413.1| CYP73A47v2 [Nicotiana tabacum]
Length=505

 Score =   244 bits (623),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 138/150 (92%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAIL+A++VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFFAILIALIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>ref|XP_009601847.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana tomentosiformis]
Length=506

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAI+VAIVVSKLR K +KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLLEKTLIGLFFAIIVAIVVSKLRSKNFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDMFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYRRGW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRRGW  150



>emb|CAJ41419.1| trans-cinnamate 4-monooxygenase [Coffea arabica]
Length=230

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VAIVVSKLRGKK+KLPPGP+PVP+FGNWLQ+GDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  12   FAAIIVAIVVSKLRGKKFKLPPGPIPVPIFGNWLQIGDDLNHRNLTDYAKKFGEIFLLRM  71

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  72   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  131

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  132  TVPFFTNKVVQQYRHGW  148



>ref|XP_009607087.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana tomentosiformis]
 gb|ABC69412.1| CYP73A47v3 [Nicotiana tabacum]
Length=505

 Score =   242 bits (617),  Expect = 4e-74, Method: Composition-based stats.
 Identities = 137/150 (91%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAIL+AI+VS+LR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFFAILIAIIVSRLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            +AKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   FAKKFGDLFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>gb|ABC69046.1| cinnamic acid 4-hydroxylase [Solanum tuberosum]
Length=505

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAIL+AI+VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLLEKTLIGLFFAILIAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDVFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>gb|AFP89891.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89892.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89893.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89894.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89896.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89897.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89898.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89899.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89900.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89901.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=219

 Score =   233 bits (593),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA V+SKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>ref|XP_011089532.1| PREDICTED: trans-cinnamate 4-monooxygenase [Sesamum indicum]
Length=505

 Score =   241 bits (615),  Expect = 8e-74, Method: Composition-based stats.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAI+VA VVSKLRGKK KLPPGP+PVP+FGNWLQVGDDLNHRNL+DYAKKFG+IFLLRM
Sbjct  14   FFAIVVATVVSKLRGKKLKLPPGPIPVPIFGNWLQVGDDLNHRNLSDYAKKFGNIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|AFP89895.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=219

 Score =   232 bits (592),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA V+SKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|ACF19421.1| candidate cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   241 bits (615),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAILVAI+VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFFAILVAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGDIFLLRMGQRNLVVVSSPE AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDIFLLRMGQRNLVVVSSPESAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>ref|XP_009798122.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana sylvestris]
 gb|ABC69411.1| CYP73A47v1 [Nicotiana tabacum]
Length=505

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAIL+A++VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFFAILIALIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>ref|XP_006350887.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Solanum tuberosum]
Length=526

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAIL+AI+VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  22   MDLLLLEKTLIGLFFAILIAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  81

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  82   YAKKFGDVFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  141

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  142  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  171



>gb|AFR37513.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37515.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37517.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37518.1| cinnamate 4-hydroxylase, partial [Populus alba]
Length=152

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AHJ60265.1| cinnamate 4-monooxygenase [Ipomoea purpurea]
Length=505

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VAIVVSKLRGKKYKLPPGP+PVPVFGNWLQVGDDLNHRNLTDYAKKFGDIF+LRM
Sbjct  14   FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYREGW  150



>gb|AFR37514.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37516.1| cinnamate 4-hydroxylase, partial [Populus alba]
Length=153

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ADX33332.1| cinnamate-4-hydroxylase 1 [Petunia x hybrida]
Length=506

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAI++AIVVSKLR KK+KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLLEKTLIGLFFAIIIAIVVSKLRSKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>gb|AAG43824.1|AF212318_1 cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFAI+VAI+VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLVGLFFAIVVAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGDIFLLRMGQRNLVVVSSPE AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDIFLLRMGQRNLVVVSSPESAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>gb|AFP89890.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=219

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA V+SKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQG EFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGAEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>ref|XP_009374388.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=557

 Score =   241 bits (616),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK++LPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGD FLLRM
Sbjct  67   FVAVIVAITISKLRGKKFRLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDCFLLRM  126

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  127  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  186

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  187  TVPFFTNKVVQQYRYGW  203



>gb|ADY38556.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38557.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38560.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
Length=152

 Score =   229 bits (583),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  106  LVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRN  285
            ++AIV+SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRN
Sbjct  1    VLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRN  60

Query  286  LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF  465
            LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPF
Sbjct  61   LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPF  120

Query  466  FTNKVVQQYRRGW  504
            FTNKVVQQYR+GW
Sbjct  121  FTNKVVQQYRQGW  133



>gb|ADY38558.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38562.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38563.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38564.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38565.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38566.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38567.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
Length=152

 Score =   228 bits (582),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  106  LVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRN  285
            ++AIV+SKLRGK++ LPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRN
Sbjct  1    VLAIVISKLRGKRFNLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRN  60

Query  286  LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF  465
            LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPF
Sbjct  61   LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPF  120

Query  466  FTNKVVQQYRRGW  504
            FTNKVVQQYR+GW
Sbjct  121  FTNKVVQQYRQGW  133



>gb|ADY38559.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38561.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
Length=152

 Score =   228 bits (582),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  106  LVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRN  285
            ++AIV+SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRN
Sbjct  1    VLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRN  60

Query  286  LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF  465
            LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPF
Sbjct  61   LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPF  120

Query  466  FTNKVVQQYRRGW  504
            FTNKVVQQYR+GW
Sbjct  121  FTNKVVQQYRQGW  133



>dbj|BAB71716.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   239 bits (610),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 123/137 (90%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FF+ ++AIV+SKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLT+YAKKFG+IFLLRM
Sbjct  14   FFSFIIAIVISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRKGW  150



>gb|AFR37525.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37526.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37531.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=151

 Score =   228 bits (581),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFR37504.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37506.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37508.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37509.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37529.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37530.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37532.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37535.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37536.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37537.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37539.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37540.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=152

 Score =   228 bits (581),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFR37498.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37499.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37500.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37501.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37502.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37503.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37505.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37507.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37510.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37511.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37512.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37533.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37534.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37541.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=153

 Score =   228 bits (580),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFR37519.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37520.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37524.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=153

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+LVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAVLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ADZ54778.1| trans-cinnamate 4-monooxygenase [Prunus avium]
Length=505

 Score =   238 bits (607),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 124/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VAI++SKLRGK++KLPPGP+PVP+FGNW+QVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FIAIIVAIMISKLRGKRFKLPPGPIPVPIFGNWIQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRLGW  150



>emb|CDP19477.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VAIVVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  14   FAAIIVAIVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>ref|XP_010094425.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB56006.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   238 bits (607),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 125/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAIV+SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FAAVIVAIVISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLV+VSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVIVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFP49808.1| cinnamate 4-hydroxylase 4 [Coffea arabica]
Length=505

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VAIVVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  14   FAAIIVAIVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>sp|O24312.1|TCMO_POPTM RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
tremuloides]
 gb|AAB67874.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   238 bits (606),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPEL+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AAG10197.1| cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|ACZ06239.1| cinnamate 4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   237 bits (605),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL LEK L+ LFF I+ AI+VSKLRGK++KLPPGPLP+PVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLFLEKVLISLFFTIIFAILVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVV+SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|AAG50231.1|AF302495_1 cinnamate 4-hydroxylase [Populus trichocarpa x Populus deltoides]
Length=505

 Score =   237 bits (605),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>ref|XP_002319974.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 ref|XP_002319975.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ABK93900.1| unknown [Populus trichocarpa]
 gb|EEE95897.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 gb|EEE95898.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   237 bits (605),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ACC63873.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
Length=505

 Score =   237 bits (605),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>ref|XP_010252045.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   237 bits (605),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+ LFFAI++AI +SKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKALVALFFAIVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDI LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>gb|AFR37521.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=153

 Score =   226 bits (576),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A LVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAXLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFR37528.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=153

 Score =   225 bits (574),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQY  GW
Sbjct  134  TVPFFTNKVVQQYXYGW  150



>ref|XP_007011365.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY20175.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   236 bits (603),  Expect = 6e-72, Method: Composition-based stats.
 Identities = 131/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+ LF  +++AI++SKLR K+++LPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKALVSLFITVILAILISKLRSKRFRLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>pir||PC4236 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) B - Japanese 
aspen x large-toothed aspen (fragment)
 dbj|BAA11577.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=396

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>dbj|BAJ17666.1| cinnamate 4-hydroxylase [Gynura bicolor]
Length=505

 Score =   236 bits (603),  Expect = 6e-72, Method: Composition-based stats.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+ LF AI++AIV+SKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIALFTAIIIAIVISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIF LRMGQRNL+VVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   MAKKFGDIFHLRMGQRNLIVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>ref|XP_010253046.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   236 bits (603),  Expect = 7e-72, Method: Composition-based stats.
 Identities = 134/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ LFFAI++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKSLIALFFAIVLAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG+IFLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGNIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>gb|EYU46023.1| hypothetical protein MIMGU_mgv1a004904mg [Erythranthe guttata]
Length=505

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLFFA+ VA +VSKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFFAVTVATIVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAK+ GDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKRLGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|ADX33333.1| cinnamate-4-hydroxylase 2 [Petunia x hybrida]
Length=505

 Score =   236 bits (602),  Expect = 7e-72, Method: Composition-based stats.
 Identities = 134/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLF AI++A +VSKLR K++KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLLEKTLIGLFIAIIIATIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>sp|P48522.1|TCMO_CATRO RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Catharanthus 
roseus]
 emb|CAA83552.1| cinnamate 4-hydroxylase (CYP73) [Catharanthus roseus]
Length=505

 Score =   236 bits (602),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA +VSKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNL+DYAKKFG+IFLLRM
Sbjct  14   FAAIIVASIVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLSDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AEA02458.1| cinnamate 4-hydroxylase [Prunus armeniaca]
Length=504

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>ref|XP_008240713.1| PREDICTED: trans-cinnamate 4-monooxygenase [Prunus mume]
Length=504

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>ref|XP_007205045.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
 gb|EMJ06244.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
Length=504

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|AEA02459.1| cinnamate 4-hydroxylase [Prunus cerasifera x Prunus munsoniana]
Length=504

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|ABN48717.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+GLF AI+VA VVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKALIGLFSAIVVAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAK+FGDIFLLRMGQRNL VVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKRFGDIFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|ABC75596.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+GLF AI+VA VVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKALIGLFSAIVVAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAK+FGDIFLLRMGQRNL VVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKRFGDIFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|AJD25173.1| cytochrome P450 CYP73A120 [Salvia miltiorrhiza]
Length=504

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+GLF AI+VA VVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKALIGLFSAIVVAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAK+FGDIFLLRMGQRNL VVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKRFGDIFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>ref|NP_001281035.1| trans-cinnamate 4-monooxygenase [Malus domestica]
 gb|AAY87450.1| cinnamic acid hydroxylase [Malus domestica]
Length=504

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGD FLLRM
Sbjct  14   FVAVIVAIAISKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AHY94893.1| cinnamate-4-hydroxylase [Prunella vulgaris]
Length=505

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTL+GLFFAI+VA VVS+LRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLVEKTLIGLFFAIVVAAVVSELRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAK+FGDI LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKRFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>ref|XP_003544934.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Glycine max]
Length=505

 Score =   235 bits (600),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 125/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI VS LRG+K+KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|AIY32618.1| cinnamate-4-hydroxylase [Perilla frutescens]
Length=505

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA +VSKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNL+DYAKKFG+IFLLRM
Sbjct  14   FAAIVVATIVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLSDYAKKFGNIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYRRGW
Sbjct  134  TVPFFTNKVVQQYRRGW  150



>emb|CAM84301.1| putative cinnamate 4-hydroxylase [Cynara cardunculus var. scolymus]
Length=211

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLF AIL AI +SKLRGK++KLPPGP PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLVGLFVAILGAIFISKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG IFLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGQIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>gb|ABY51678.1| cinnamic acid 4-hydroxylase [Plagiochasma appendiculatum]
Length=277

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLL LF AI+ +I +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLVEKTLLALFAAIIASIFISKLRGKRFKLPPGPVPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG+IFLLRMGQRNLVVVSSP LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGEIFLLRMGQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRTGW  150



>ref|XP_011080651.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Sesamum indicum]
Length=505

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA VVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNL+DYAKKFGDI LLRM
Sbjct  14   FLAIVVATVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLSDYAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>gb|AHB52741.1| cinnamate 4-hydroxylase [Pyrus x bretschneideri]
Length=504

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK++LPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGD FLLRM
Sbjct  14   FVAVIVAITISKLRGKKFRLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|KHG02507.1| Cytochrome P450 protein [Gossypium arboreum]
Length=532

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL LEK L+ LFF I+ AI+VSKLRGK++KLPPGPLP+PVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLFLEKVLISLFFTIIFAILVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>ref|XP_004294725.1| PREDICTED: trans-cinnamate 4-monooxygenase [Fragaria vesca subsp. 
vesca]
Length=504

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLF AI+VAI+VSKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFIAIVVAIIVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGD+F+LRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   MAKKFGDVFMLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|KDP45711.1| hypothetical protein JCGZ_17318 [Jatropha curcas]
Length=505

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL+LEKTLLGLF A++VAIVVSKLRGK++KLPPGPLP+PVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLVLEKTLLGLFAAVIVAIVVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>ref|XP_008456253.1| PREDICTED: trans-cinnamate 4-monooxygenase [Cucumis melo]
Length=505

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+++AI +SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FLAVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>gb|ABF69101.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPEL+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|KJB72975.1| hypothetical protein B456_011G207000 [Gossypium raimondii]
Length=505

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL LEK L+ LFF I+ AI+VSKLRGK++KLPPGPLP+PVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLFLEKVLISLFFTIIFAILVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVV+SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|AGX85600.1| coumarate 4-hydroxylase [Scoparia dulcis]
Length=505

 Score =   234 bits (598),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 121/137 (88%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAI++A VVSKLRGKK++LPPGP+PVP+FGNWLQ+GDDLNHRNL+DYAKKFGD+FLLRM
Sbjct  14   FFAIVLASVVSKLRGKKFRLPPGPIPVPIFGNWLQIGDDLNHRNLSDYAKKFGDMFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQY  GW
Sbjct  134  TVPFFTNKVVQQYHTGW  150



>gb|AEM63594.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
 gb|AEX08610.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFA +VAI VSKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FFAAVVAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNL+VVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLLVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRDGW  150



>gb|AFN44010.1| cinnamate 4-hydroxylase [Neolamarckia cadamba]
Length=505

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA V+SKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|AID16078.1| cinnamate 4-hydroxylase [Morus alba]
Length=505

 Score =   234 bits (597),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VA V+SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFG IFLLRM
Sbjct  14   FAAVIVATVISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGGIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>ref|XP_004154553.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=505

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F ++++AI +SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FLSVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>ref|XP_004139932.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=505

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F ++++AI +SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FLSVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>gb|AEN19718.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MD  LLEKTLL LF A+++AIV+SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDFPLLEKTLLTLFVAVVLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFF NKVVQQYR+GW
Sbjct  121  VYGEHWRKMRRIMTVPFFINKVVQQYRQGW  150



>gb|ACF74449.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   234 bits (596),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+ AIVVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG IFLLRM
Sbjct  14   FAAIIGAIVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGQIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ABX75854.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MD  LLEKTLL LF A+++AIV+SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDFPLLEKTLLTLFVAVVLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFF NKVVQQYR+GW
Sbjct  121  VYGEHWRKMRRIMTVPFFINKVVQQYRQGW  150



>gb|ADO16243.1| cinnamate 4-hydroxylase [Ocimum tenuiflorum]
Length=505

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAI+VA VVSK RG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAK+FG+IFLLRM
Sbjct  14   FFAIVVAAVVSKFRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPEFAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ABD77493.2| cinnamic acid 4-hydroxylase [Arnebia euchroma]
Length=504

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FF++++AIV+SKL GKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLT+YAKKFG+IFLLRM
Sbjct  14   FFSVIIAIVISKLGGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>gb|AGJ84133.1| putative trans-cinnamate 4-hydroxylase [Hibiscus cannabinus]
Length=505

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+ LFF I+ AI+V+KLRGK+YKLPPGPLPVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKVLISLFFTIIFAILVAKLRGKRYKLPPGPLPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
              KKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LTKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|ABA59555.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
 gb|ACA25599.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
Length=505

 Score =   233 bits (595),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+L+EK LL +F AI++AI +SKL GKK+KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLILIEKALLAVFCAIILAITISKLLGKKFKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIF+LRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFMLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  150



>ref|XP_011021057.1| PREDICTED: trans-cinnamate 4-monooxygenase [Populus euphratica]
Length=505

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>emb|CAK95273.1| cinnamate-4-hydroxylase [Cucumis sativus]
Length=505

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F ++++AI +SKLRGK++K PPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FLSVVLAIAISKLRGKRFKPPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>gb|ACE95171.1| cinnamate-4-hydroxylase [Populus tomentosa]
 gb|AFZ78541.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ABF69102.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFU54390.1| cinnamate 4-hydroxylase [Fagopyrum tataricum]
Length=504

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAI VAIV+SKLRGKKYKLPPGP+PVP+FGNWLQVGDDLNHRNLT+ AKK+G+IFLLRM
Sbjct  14   FFAISVAIVISKLRGKKYKLPPGPIPVPIFGNWLQVGDDLNHRNLTELAKKYGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+G+DMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGRDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|EYU36901.1| hypothetical protein MIMGU_mgv1a004876mg [Erythranthe guttata]
Length=506

 Score =   233 bits (593),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI++A VVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLT+YAKKFGDI +LRM
Sbjct  15   FAAIVIAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDILMLRM  74

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  75   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  134

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R GW
Sbjct  135  TVPFFTNKVVQQNRHGW  151



>gb|AFG30055.1| cinnamate-4-hydroxylase [Malus hybrid cultivar]
Length=504

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK+KLPPGP+PVPVFGNWLQ GDDLNHRNLTD AKKFGD FLLRM
Sbjct  14   FVAVIVAIAISKLRGKKFKLPPGPIPVPVFGNWLQDGDDLNHRNLTDMAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>ref|XP_011041784.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+G F AILVAIVVSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKTLVGSFVAILVAIVVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLAD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDI LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>ref|NP_001237317.1| trans-cinnamate 4-monooxygenase [Glycine max]
 sp|Q42797.1|TCMO_SOYBN RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycine 
max]
 emb|CAA63172.1| cinnamic acid 4-hydroxylase [Glycine max]
 gb|ACN81819.1| coumarate 4-hydroxylase [Glycine max]
 gb|AEX32785.1| cinnamate-4-hydroxylase [Glycine max]
Length=506

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLF A +VAI VS LRG+K+KLPPGPLPVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|ACR44227.1| C4H [Glycine max]
 gb|ADG63467.1| C4H [Glycine max]
Length=506

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLF A +VAI VS LRG+K+KLPPGPLPVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIGLFLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  150



>gb|ABF69099.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AHG97392.1| C4H catalytic cinnamic acid-4-hydroxylase [Ageratina adenophora]
Length=505

 Score =   232 bits (592),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 133/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTL+ LF AI+VAIV+SKLRGKK+ LPPGP+PVP+FGNWLQVGDDLNHRNLT 
Sbjct  1    MDLLLIEKTLIALFSAIIVAIVISKLRGKKFNLPPGPIPVPIFGNWLQVGDDLNHRNLTG  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG IFLLRMGQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGQIFLLRMGQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>sp|Q43054.1|TCMO_POPKI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
sieboldii x Populus grandidentata]
 pir||JC5129 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) A - Japanese 
aspen x large-toothed aspen
 dbj|BAA11579.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
 dbj|BAA11576.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=505

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+LVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FVAVLVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AID69233.1| cinnamate 4-hydroxylase [Garcinia mangostana]
Length=505

 Score =   232 bits (592),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFA +VAIV+S LRGK++KLPPGPLP+PVFGNWL+VGDDLNHRNLT+ AKKFG IFLLRM
Sbjct  14   FFAAVVAIVISTLRGKRFKLPPGPLPIPVFGNWLEVGDDLNHRNLTELAKKFGQIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>gb|AFZ78542.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+LVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAVLVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AEK94316.1| cinnamic acid 4-hydroxylase-like protein [Pyrus x bretschneideri]
Length=504

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK++LPPGP+PVPVFGNWLQVGD LNHRNLTD AKKFGD FLLRM
Sbjct  14   FVAVIVAITISKLRGKKFRLPPGPIPVPVFGNWLQVGDGLNHRNLTDMAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>sp|P37115.1|TCMO_VIGRR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Vigna 
radiata var. radiata]
 gb|AAA33755.1| cinnamate 4-hydroxylase [Vigna radiata var. radiata]
Length=505

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAIVVSKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLT  AK+FGDIFLLRM
Sbjct  14   FLAAVVAIVVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTQLAKRFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|ABF69100.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+LVAI+VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAVLVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>sp|Q43240.1|TCMO_ZINVI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Zinnia 
violacea]
 gb|AAB42024.1| cinnamic acid 4-hydroxylase [Zinnia violacea]
Length=505

 Score =   231 bits (590),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLL LF AI+ +I +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLVEKTLLALFAAIIASIFISKLRGKRFKLPPGPVPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG+IFLLRMGQRNLVVVSSP LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGEIFLLRMGQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRTGW  150



>ref|XP_002325638.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ACC63871.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
 gb|EEF00020.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AILVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AAS48416.1| cinammate 4-hydroxylase [Allium cepa]
Length=505

 Score =   231 bits (590),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 121/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAI +AIV+SKLRGKK+KLPPGPLPVP+FGNWLQVGDDLNHRNL ++AKKFGD+FLLRM
Sbjct  14   FFAITLAIVISKLRGKKFKLPPGPLPVPIFGNWLQVGDDLNHRNLANFAKKFGDVFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LA++VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLARDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVV QYR GW
Sbjct  134  TVPFFTNKVVNQYRYGW  150



>sp|Q04468.1|TCMO_HELTU RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Helianthus 
tuberosus]
 emb|CAA78982.1| trans-cinnamate 4-monooxygenase [Helianthus tuberosus]
Length=505

 Score =   231 bits (590),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 132/150 (88%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTL+ LF AI+ AI++SKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLIEKTLVALFAAIIGAILISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AK+FG+I LLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKRFGEILLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>gb|ACM69364.1| cinnamic acid 4-hydroxylase [Humulus lupulus]
Length=505

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+ LF A+++AI ++K+RGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIALFVAVVLAIAIAKIRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   MAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>ref|XP_010685980.1| PREDICTED: trans-cinnamate 4-monooxygenase [Beta vulgaris subsp. 
vulgaris]
Length=504

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL +KTL  +FFAI +AIV+SKL+GKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLFQKTLYAIFFAITLAIVISKLKGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG++FLLRMGQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGEMFLLRMGQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>ref|XP_010522015.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Tarenaya hassleriana]
Length=505

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +FFA+++AIV+SKLRGKK KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKSLIAVFFAVVLAIVISKLRGKKLKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A+KFGDI LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|AIB06733.1| cinnamate 4-mono-oxygenase [Mangifera indica]
Length=505

 Score =   231 bits (588),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 121/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI++AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+I LLRM
Sbjct  14   FVAIVLAITISKLRGKRFKLPPGPIPVPLFGNWLQVGDDLNHRNLTDLAKKFGEILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AFR37523.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=141

 Score =   219 bits (559),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+LVAI+VS+LRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDI LLRM
Sbjct  6    FVAVLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  65

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  66   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  125

Query  454  TVPFFTNKVVQQYRRG  501
            TVPFF  KVVQQYR G
Sbjct  126  TVPFFXXKVVQQYRYG  141



>gb|AAG10196.1|AF286647_1 cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|KHG13044.1| Cytochrome P450 protein [Gossypium arboreum]
Length=505

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL LEK LLGLF A+++AI +SKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLFLEKALLGLFVAVVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>gb|AAT39513.1| cinnamate-4-hydroxylase [Camptotheca acuminata]
Length=505

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLL LF AI++AI +SKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLVEKTLLALFAAIVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGD+FLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDMFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>ref|XP_003616037.1| Trans-cinnamate 4-monooxygenase [Medicago truncatula]
 gb|ABC59087.1| cytochrome P450 monooxygenase CYP73A3 [Medicago truncatula]
 gb|ADK91846.1| coumarate 4-hydroxylase [Medicago truncatula]
 gb|AES98995.1| cytochrome P450 family cinnamate 4-hydroxylase [Medicago truncatula]
Length=506

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A  +AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAK+FG++FLLRM
Sbjct  14   FIAATIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEMFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ADN32769.1| cinnamate 4-hydroxylase [Scutellaria baicalensis]
Length=507

 Score =   230 bits (587),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA +VSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLT YAKKFG+IFL RM
Sbjct  14   FLAIIVATMVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTAYAKKFGEIFLHRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R GW
Sbjct  134  TVPFFTNKVVQQNRAGW  150



>gb|ADO16244.1| cinnamate 4-hydroxylase [Ocimum basilicum]
Length=505

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VA VVSKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAK+FG+IFLLRM
Sbjct  14   FSAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVF VYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPEHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFAVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ABX74779.1| cinnamate-4-hydroxylase [Rubus coreanus]
Length=504

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLLGLF A++VAI VSKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLMEKTLLGLFAAVVVAITVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG++F+LRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   MAKKFGEVFMLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>ref|XP_002458683.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
 gb|EES03803.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
Length=505

 Score =   230 bits (587),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F +++VAI VSK+RG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFGDIFLLRM
Sbjct  14   FASVVVAIAVSKMRGRKLRLPPGPVPVPIFGNWLQVGDDLNHRNLAALARKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|AGU91429.1| trans-cinnamate 4-monooxygenase [Chrysanthemum boreale]
Length=505

 Score =   230 bits (586),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  AILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQ  279
            AIL AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+IFLLRMGQ
Sbjct  16   AILGAIFISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMGQ  75

Query  280  RNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  459
            RNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTV
Sbjct  76   RNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTV  135

Query  460  PFFTNKVVQQYRRGW  504
            PFFTNKVVQQYR GW
Sbjct  136  PFFTNKVVQQYRFGW  150



>gb|AEM63672.1| cinnamate 4-hydroxylase [Platycodon grandiflorus]
Length=505

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI+VAI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLT YAKKFGD+FLLRM
Sbjct  14   FVAIVVAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTVYAKKFGDVFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|ADG43134.1| cinnamate 4-hydroxylase [Isatis tinctoria]
Length=509

 Score =   230 bits (586),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>sp|Q43033.1|TCMO_PETCR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Petroselinum 
crispum]
 gb|AAC41660.1| trans-cinnamate 4-monooxygenase [Petroselinum crispum]
Length=506

 Score =   229 bits (585),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 121/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI +SKLRGKK KLPPGP+PVPVFGNWLQVGDDLN RNL DYAKKFGD+F+LRM
Sbjct  15   FIATIVAITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVDYAKKFGDLFMLRM  74

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVY +HWRKMRRIM
Sbjct  75   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYSEHWRKMRRIM  134

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  135  TVPFFTNKVVQQYRFGW  151



>ref|XP_011015228.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+G F AILVAIVVSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKTLVGSFVAILVAIVVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLAD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDI LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR  W
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYEW  150



>ref|XP_010542699.1| PREDICTED: trans-cinnamate 4-monooxygenase [Tarenaya hassleriana]
Length=505

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +FFA+L+AI +SKLRGKK KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKSLIAVFFAVLLAIAISKLRGKKLKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A+KFG+IFLLRMGQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARKFGEIFLLRMGQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R+GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNRQGW  150



>gb|ACM17896.1| cinnamate-4-hydroxylase [Rubus occidentalis]
Length=504

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLLGLF A++VAI VSKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLMEKTLLGLFVAVVVAITVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG++F+LRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   MAKKFGEVFMLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>gb|ABX74781.1| cinnamate-4-hydroxylase [Rubus sp. SSL-2007]
Length=504

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLLGLF A++VAI VSKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLT+
Sbjct  1    MDLLLMEKTLLGLFVAVVVAITVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG++F+LRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   MAKKFGEVFMLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>gb|AHL83550.1| C4H [Morus alba var. multicaulis]
Length=505

 Score =   229 bits (584),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VA V+SKLRGK++KLPPGP+PVPVFGNWLQVGD LNHRNLTD AKKFG I LLRM
Sbjct  14   FAAVIVATVISKLRGKRFKLPPGPIPVPVFGNWLQVGDALNHRNLTDLAKKFGGILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|AHA84274.1| trans-cinnamate 4-monooxygenase [Phaseolus vulgaris]
Length=506

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F + +VAI VSKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLT  AK+FGDIFLLRM
Sbjct  14   FLSAVVAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTGLAKRFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>gb|AEV93475.1| 4-coumarate:CoA ligase [Caragana korshinskii]
Length=505

 Score =   229 bits (584),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EKTLL LF A  +AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLIEKTLLALFIAATIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AK+FG+I LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKRFGEILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>ref|XP_006842509.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
 gb|ERN04184.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
Length=504

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL EK LLGLF AI+ AI VSKLRGK+ +LPPGPL +P+FGNWLQVGDDLNHRNL+D
Sbjct  1    MDLLLAEKVLLGLFVAIVTAITVSKLRGKRLRLPPGPLTIPIFGNWLQVGDDLNHRNLSD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGD+FLLRMGQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDVFLLRMGQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>dbj|BAB71717.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   229 bits (584),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 103/108 (95%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTDYAKKFG+IFLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRT
Sbjct  43   FGNWLQVGDDLNHRNLTDYAKKFGEIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRT  102

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR+GW
Sbjct  103  RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRQGW  150



>dbj|BAJ22964.1| cinnamate 4-hydroxylase [Agastache foeniculum]
Length=194

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTDYAK+FGDIFLLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRT
Sbjct  13   FGNWLQVGDDLNHRNLTDYAKRFGDIFLLRMGQRNLVVVSSPDSAKEVLHTQGVEFGSRT  72

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR+GW
Sbjct  73   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRQGW  120



>gb|AGH32777.1| cinnamic acid 4-hydroxylase [Camellia chekiangoleosa]
Length=505

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+ LF A+++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIALFIAVVLAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG IF+LRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGQIFMLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>gb|ACR10242.1| cinnamate-4-hydroxylase [Canarium album]
Length=505

 Score =   229 bits (583),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+LLEK LL LF AI++AI VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLT 
Sbjct  1    MDLILLEKALLALFVAIVLAIAVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTY  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDI LLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+G+DMVFT
Sbjct  61   LAKKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGKDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  150



>ref|XP_007142041.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
 gb|ESW14035.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
Length=505

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F + +VAI VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLT  AK+FGDIFLLRM
Sbjct  14   FLSAVVAIAVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTGLAKRFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRHGW  150



>ref|XP_002881114.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57373.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=505

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+PVP+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVVLATVISKLRGKKLKLPPGPMPVPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_010414263.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
 ref|XP_010469851.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
Length=505

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVVLATVVSKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|ADO16181.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=505

 Score =   228 bits (582),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 121/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  AILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQ  279
            AIL AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+IFLLRMGQ
Sbjct  16   AILGAIFISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMGQ  75

Query  280  RNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  459
            RNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTV
Sbjct  76   RNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTV  135

Query  460  PFFTNKVVQQYRRGW  504
            PFFTNKVVQQYR GW
Sbjct  136  PFFTNKVVQQYRFGW  150



>ref|XP_010510361.1| PREDICTED: trans-cinnamate 4-monooxygenase [Camelina sativa]
Length=505

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVVLATVVSKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_006410152.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
 dbj|BAJ33716.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51605.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
Length=505

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+PVFGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPMPIPVFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|AAC99993.1| cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|AGG55322.1| cinnamate 4-hydroxylase [Paeonia lactiflora]
Length=505

 Score =   228 bits (582),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 119/137 (87%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++ AI VSKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNL D+AKKFG++ LLRM
Sbjct  14   FIAMITAITVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLADFAKKFGEVLLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ACZ06240.1| cinnamate 4-hydroxylase 2 [Gossypium hirsutum]
Length=505

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL LEK LLGLF A+++AI +SKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLFLEKALLGLFVAVVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVF IFTG+GQDMVFT
Sbjct  61   LAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFGIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>ref|XP_006294053.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
 gb|EOA26951.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
Length=506

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  2    MDLLLLEKSLIAVFVAVVLATVVSKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  61

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  62   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  121

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  122  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  151



>emb|CAP08828.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLITVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|AAB58355.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08830.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08831.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08832.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08833.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08838.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08839.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08842.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08843.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08844.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08845.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|AIT52342.1| cinammate 4-hydroxylase 1 [Daucus carota]
Length=506

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI +SKLRGKK KLPPGPLPVPVFGNWLQVGDDLNHRNL DYAKKFG++FLLRM
Sbjct  15   FIATIVAITISKLRGKKLKLPPGPLPVPVFGNWLQVGDDLNHRNLVDYAKKFGEVFLLRM  74

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  75   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  134

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  135  TVPFFTNKVVQQYRFGW  151



>emb|CAP08827.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08834.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08835.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08836.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08837.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_004242478.1| PREDICTED: trans-cinnamate 4-monooxygenase [Solanum lycopersicum]
Length=317

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLR K++KLPPGP+PVP+FGNWLQVGDDLNHRNLT+YAKKFGD+FLLRMGQRNL VVSS
Sbjct  24   SKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRMGQRNLAVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRGGW  150



>ref|XP_004242477.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Solanum lycopersicum]
Length=318

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLR K++KLPPGP+PVP+FGNWLQVGDDLNHRNLT+YAKKFGD+FLLRMGQRNL VVSS
Sbjct  24   SKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRMGQRNLAVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRGGW  150



>ref|XP_008355112.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Malus domestica]
Length=308

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHR LTD AKKFGD FLLRM
Sbjct  14   FVAVIVAITISKLRGKKFKLPPGPMPVPVFGNWLQVGDDLNHRKLTDLAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV DI  G+GQDMVF VYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVVDILNGKGQDMVFCVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVP FTNKVVQQYR+GW
Sbjct  134  TVPLFTNKVVQQYRQGW  150



>ref|XP_008810838.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   228 bits (580),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+L+EK LLGLF A+ +AI VSKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLT 
Sbjct  1    MDLVLVEKALLGLFAAVTIAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTA  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AK+FGDIFLLRMGQRNLVVVSSPELA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKRFGDIFLLRMGQRNLVVVSSPELAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNRHGW  150



>gb|AAO62904.1| cinnamate 4-hydroxylase [Ammi majus]
Length=506

 Score =   228 bits (580),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI +SKLRGKK KLPPGP+PVPVFGNWLQVGDDLN RNL +YAKKFGD+FLLRM
Sbjct  15   FIATIVAITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVEYAKKFGDLFLLRM  74

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVY +HWRKMRRIM
Sbjct  75   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYSEHWRKMRRIM  134

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  135  TVPFFTNKVVQQYRFGW  151



>gb|KJB83924.1| hypothetical protein B456_013G271700 [Gossypium raimondii]
Length=505

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+++AI +SKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKK+GDIFLLRM
Sbjct  14   FAAVVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKYGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPE+AKEVLH+QGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPEIAKEVLHSQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>gb|ACJ37399.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   228 bits (580),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 131/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+ LF AI+ +I +SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLIALFAAIIASIFISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG+I LLRMGQRNLVVVSSP LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGEILLLRMGQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQY  GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYHSGW  150



>gb|ABF17873.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 gb|ABF17874.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 emb|CDY02068.1| BnaC04g14330D [Brassica napus]
Length=505

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_008788521.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   227 bits (579),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 118/137 (86%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F +++VAI VSKLRGK+ +LPPGPLPVPVFGNWLQVGDDLNHRNL+  A++FGDI LLRM
Sbjct  14   FASVVVAIAVSKLRGKRLRLPPGPLPVPVFGNWLQVGDDLNHRNLSALARRFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPSLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRTGW  150



>dbj|BAI77480.1| cinnamate-4-hydroxylase [Brassica rapa]
 emb|CDY10741.1| BnaA05g11950D [Brassica napus]
Length=505

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_004970385.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Setaria italica]
Length=505

 Score =   227 bits (579),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 118/137 (86%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F +++VAI VSKLRG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A++FGDIFLLRM
Sbjct  14   FASVVVAIAVSKLRGRKLRLPPGPVPVPIFGNWLQVGDDLNHRNLAALARRFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRAGW  150



>gb|AGP25594.1| cinnamate 4-hydroxylase [Aquilaria sinensis]
Length=504

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTLL LF  +++AI +SKL GKKY+LPPGPLPVPVFGNWLQVGDDLNHRNL+D
Sbjct  1    MDLLLLEKTLLALFATVILAIAISKLCGKKYRLPPGPLPVPVFGNWLQVGDDLNHRNLSD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A+KFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR+GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRQGW  150



>dbj|BAE72875.1| Cinnamic acid 4-hydroxylase [Verbena x hybrida]
Length=505

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F AI++A VVSKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFGD+FLLRM
Sbjct  14   FSAIVIAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDLFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LA++VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLARDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQ+ R GW
Sbjct  134  TVPFFTNKVVQRNRHGW  150



>gb|ACY78690.1| trans-cinnamate 4-monooxygenase [Cynara cardunculus var. scolymus]
Length=505

 Score =   227 bits (579),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 134/149 (90%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEKTL+GLF AIL AI +SKLRGK++KLPPGP PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLLLEKTLVGLFVAILGAIFISKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFG IFLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGQIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRG  501
            VYG+HWRKMRRIMTVPFFTNKVVQQYR G
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFG  149



>dbj|BAF81522.1| cinnamate-4-hydroxylase [Brassica rapa]
 dbj|BAI77479.1| cinnamate-4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_010921158.1| PREDICTED: trans-cinnamate 4-monooxygenase [Elaeis guineensis]
Length=505

 Score =   227 bits (578),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 120/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+ +AI VSK+RGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLT  AK+FGDIFLLRM
Sbjct  14   FAAVTLAIAVSKIRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTALAKRFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R GW
Sbjct  134  TVPFFTNKVVQQNRHGW  150



>gb|AGM46644.1| cinnamate 4-hydroxylase protein, partial [Apium graveolens]
Length=266

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI +SKLRGKK  LPPGP+PVPVFGNWLQVGDDLN RNL + AKKFGD+F+LRM
Sbjct  13   FIATIVAITISKLRGKKLNLPPGPIPVPVFGNWLQVGDDLNQRNLVELAKKFGDLFMLRM  72

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVY +HWRKMRRIM
Sbjct  73   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYSEHWRKMRRIM  132

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  133  TVPFFTNKVVQQYRFGW  149



>ref|NP_001288861.1| trans-cinnamate 4-monooxygenase [Brassica rapa]
 dbj|BAI77481.1| cinnamate-4-hydroxylase [Brassica rapa]
Length=505

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_002523952.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
 gb|EEF38439.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAIV+SKLRGK++KLPPGPLPVPVFGNWLQVGDDLN RNL D AKKFGDI LLRM
Sbjct  14   FAAVIVAIVISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNQRNLADLAKKFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ADO24190.1| cinnamate 4-hydroxylase [Allium sativum]
Length=507

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            FFAI +AIV+SKLRG+K+KLPPGPLPVP+FGNWLQVGDDLNHRNLT+ AKKFGD+FLLRM
Sbjct  14   FFAITLAIVISKLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTNLAKKFGDVFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LA++VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLARDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVV QYR GW
Sbjct  134  TVPFFTNKVVNQYRYGW  150



>ref|XP_010922761.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   227 bits (578),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 118/137 (86%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F +++VAI VSKLRGK+ +LPPGPLPVPVFGNWLQVGDDLNHRNL+  A++FGDI LLRM
Sbjct  14   FASVVVAIAVSKLRGKRLRLPPGPLPVPVFGNWLQVGDDLNHRNLSTLARRFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPSLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRAGW  150



>gb|AGC29944.1| CYP73A107 [Sinopodophyllum hexandrum]
 gb|AGV76060.1| cinnamate-4-hydroxylase [Sinopodophyllum hexandrum]
Length=504

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL+LEKTL+GLF AI+ AIV+SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD
Sbjct  1    MDLLILEKTLIGLFVAIIGAIVISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A+KFG+I LLRMGQRNL+VVSSP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARKFGEILLLRMGQRNLIVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>gb|KFK22945.1| hypothetical protein AALP_AAs47561U000100 [Arabis alpina]
Length=505

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVILATVVSKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQRNREGW  150



>gb|AFV91401.1| cinnamate 4-hydroxylase C4H2, partial [Salix hybrid cultivar]
Length=198

 Score =   217 bits (552),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  12   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  71

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  72   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  119



>gb|AFV91398.1| cinnamate 4-hydroxylase C4H2, partial [Salix hybrid cultivar]
Length=197

 Score =   216 bits (551),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  12   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  71

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  72   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  119



>gb|AFV91396.1| cinnamate 4-hydroxylase C4H2, partial [Salix hybrid cultivar]
Length=202

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  15   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  74

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  75   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  122



>ref|XP_010103664.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB96547.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   226 bits (575),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  112  AIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLV  291
            AI+VS+LRGK++KLPPGPL VP+FGNWLQVGDDLNHRNL+D A+KFGDIFLLRMGQRNLV
Sbjct  20   AILVSRLRGKRFKLPPGPLTVPIFGNWLQVGDDLNHRNLSDLARKFGDIFLLRMGQRNLV  79

Query  292  VVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFT  471
            VVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFT
Sbjct  80   VVSSPDLAKQVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFT  139

Query  472  NKVVQQYRRGW  504
            NKVVQQYR GW
Sbjct  140  NKVVQQYRLGW  150



>gb|AFV91400.1| cinnamate 4-hydroxylase C4H2, partial [Salix dasyclados]
Length=202

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  15   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  74

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  75   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  122



>ref|XP_009354880.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+ +AI +SKLR KK+KLPPGP+PVPVFGNWLQVGDDLNHR+L+D A+KFGD FLLRM
Sbjct  14   FVAVTIAIAISKLRSKKFKLPPGPIPVPVFGNWLQVGDDLNHRSLSDLARKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSS ELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSTELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR+GW
Sbjct  134  TVPFFTNKVVQQYRQGW  150



>gb|AFV91399.1| cinnamate 4-hydroxylase C4H2, partial [Salix hybrid cultivar]
Length=201

 Score =   216 bits (551),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  15   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  74

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  75   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  122



>emb|CAP08829.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +  A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLITVVVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|AFV91397.1| cinnamate 4-hydroxylase C4H2, partial [Salix triandra x Salix 
viminalis]
Length=201

 Score =   216 bits (551),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  14   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  73

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  74   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  121



>ref|XP_009354868.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=504

 Score =   225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGKK+KLPPGP+PVPVFG  LQVGDDLNHRNLTD AKKFGD FLLRM
Sbjct  14   FVAVIVAITISKLRGKKFKLPPGPIPVPVFGTGLQVGDDLNHRNLTDLAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R GW
Sbjct  134  TVPFFTNKVVQQCRYGW  150



>gb|AFV91402.1| cinnamate 4-hydroxylase C4H2, partial [Salix x smithiana]
Length=202

 Score =   216 bits (551),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  16   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  75

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  76   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  123



>gb|ABE68874.1| cinnamate 4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ   GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNHEGW  150



>gb|AJD22263.1| cinnamate 4-hydroxylase [Angelica dahurica]
Length=505

 Score =   225 bits (574),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI +SKLRGKK KLPPGP+PVPVFGNWLQVGDDLN RNL  YAKKFGD+F+LRM
Sbjct  14   FIATIVAITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVGYAKKFGDLFMLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVY +HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYSEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>ref|XP_008782669.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   225 bits (574),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+LLEK+LLGLF A+ +AI VSKLRGK+++LPPGPLPVP+FGNWLQVGDDLNHRNLT 
Sbjct  1    MDLVLLEKSLLGLFAAVTLAIAVSKLRGKRFRLPPGPLPVPIFGNWLQVGDDLNHRNLTA  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AK+FGDIFLLRMGQRNLVVVSSPE+A++VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKRFGDIFLLRMGQRNLVVVSSPEMARDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNRHGW  150



>gb|ACB78015.1| cinnamic acid 4-hydroxylase, partial [Trifolium pratense]
Length=498

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
             F  ++AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FG+I LLRM
Sbjct  6    LFIAVIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRM  65

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  66   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  125

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  126  TVPFFTNKVVQQYRFGW  142



>sp|P37114.1|TCMO_MEDSA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Medicago 
sativa]
Length=506

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A  +A+ +SKLRGK++KLPPGP+PVP+FG WLQVGDDLNHRNLTDYAK+FG+IFLLRM
Sbjct  14   FIAATIAVTISKLRGKRFKLPPGPIPVPIFGYWLQVGDDLNHRNLTDYAKRFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQ VEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQCVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|ACZ73612.1| cinnamate 4-hydroxylase [Bambusa oldhamii]
Length=507

 Score =   225 bits (574),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F +++VAI VSK+RG+K +LPPGPLPVP+FGNWLQVGDDLNHRNL   A+KFG+IFLLRM
Sbjct  14   FASVVVAIAVSKIRGRKLRLPPGPLPVPIFGNWLQVGDDLNHRNLAALARKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQY  GW
Sbjct  134  TVPFFTNKVVQQYHPGW  150



>gb|AAU09021.1| Cinnamic acid 4-hydroxylase [Agastache rugosa]
Length=502

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS
Sbjct  24   SKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRHGW  150



>ref|XP_003564495.1| PREDICTED: trans-cinnamate 4-monooxygenase [Brachypodium distachyon]
Length=505

 Score =   225 bits (573),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  106  LVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRN  285
            LVAI VSK+RG+K KLPPGPLPVP+FGNWLQVGDDLNHRNL   A+KFG+IFLLRMGQRN
Sbjct  18   LVAIAVSKIRGRKLKLPPGPLPVPIFGNWLQVGDDLNHRNLAAMARKFGEIFLLRMGQRN  77

Query  286  LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF  465
            LVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF
Sbjct  78   LVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF  137

Query  466  FTNKVVQQYRRGW  504
            FTNKVVQQYR GW
Sbjct  138  FTNKVVQQYRAGW  150



>emb|CDY23995.1| BnaC03g16960D [Brassica napus]
Length=505

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQRNREGW  150



>emb|CDX84829.1| BnaA03g14010D [Brassica napus]
Length=505

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQRNREGW  150



>gb|AFY17065.1| cinnamate 4-hydroxylase 2 [Panicum virgatum]
Length=505

 Score =   224 bits (572),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL  EK L+GLF +++VAI V KLRG+K +LPPGP+PVPVFGNWLQVGDDLNHRNL  
Sbjct  1    MDLLFAEKLLVGLFASVVVAIAVPKLRGRKLRLPPGPVPVPVFGNWLQVGDDLNHRNLAA  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A+KFGDIFLLRMGQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARKFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYGDHWRKMRRIMTVPFFTNKVVQQY  GW
Sbjct  121  VYGDHWRKMRRIMTVPFFTNKVVQQYSPGW  150



>gb|ABF17875.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 gb|ABF17876.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 emb|CDY29670.1| BnaA04g17570D [Brassica napus]
Length=505

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK  LPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLNLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQRNREGW  150



>emb|CDX97826.1| BnaC04g41130D [Brassica napus]
Length=505

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK  LPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKKLNLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQRNREGW  150



>ref|XP_008792249.1| PREDICTED: trans-cinnamate 4-monooxygenase [Phoenix dactylifera]
Length=505

 Score =   224 bits (572),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+LLEK LLGLF AI+VAI VSKLRGK+++LPPGPLPVPVFGNWLQVGDDLNHRNL+ 
Sbjct  1    MDLVLLEKALLGLFAAIVVAIAVSKLRGKRFRLPPGPLPVPVFGNWLQVGDDLNHRNLSA  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A++FGDI LLRMGQRNLVVVSSP +A++VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARRFGDILLLRMGQRNLVVVSSPAVARDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRTGW  150



>ref|XP_009141068.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK  LPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFPAVVLATVISKLRGKKLNLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQRNREGW  150



>gb|AFD29887.1| cinnamate 4-hydroxylase [Bambusa emeiensis]
Length=507

 Score =   224 bits (570),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F +++VAI VSK+RG+K +LPPGPLPVP+FGNWLQVGDDLNHRNL   A+KFG+IFLLRM
Sbjct  14   FASVVVAIAVSKIRGRKLRLPPGPLPVPIFGNWLQVGDDLNHRNLAALARKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQY  GW
Sbjct  134  TVPFFTNKVVQQYHPGW  150



>gb|AFV47361.1| C4H [Helichrysum aureonitens]
Length=504

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F  IL AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+IFLLRM
Sbjct  14   FATILGAIFISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRK+RRIM
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKVRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRYGW  150



>gb|KDO45077.1| hypothetical protein CISIN_1g021610mg [Citrus sinensis]
Length=310

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNL+D AKK+GD+ LLRM
Sbjct  14   FAAVVVAITVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLSDLAKKYGDVLLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R  W
Sbjct  134  TVPFFTNKVVQQQRFNW  150



>ref|NP_180607.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 sp|P92994.1|TCMO_ARATH RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Arabidopsis 
thaliana]
 gb|AAB58356.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAB63088.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAL38321.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAP68314.1| At2g30490 [Arabidopsis thaliana]
 emb|CAP08840.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08841.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AEC08397.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 gb|AGA15806.1| C4H [Expression vector pUDE172]
Length=505

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVL TQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>dbj|BAA24355.1| trans-cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP+L KEVL TQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>ref|XP_007017089.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY34708.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLRGK++KLPPGP PVPVFGNWLQVGDDLNHRNLT  AKKFGDIFLLRM
Sbjct  14   FVAVVVAITISKLRGKRFKLPPGPFPVPVFGNWLQVGDDLNHRNLTGLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>ref|XP_009132739.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK+L+ +F A+++A V+SKLRGK  KLPPGP+P+P+FGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLLEKSLIAVFAAVVLATVISKLRGKILKLPPGPIPIPIFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FLLRMGQRNLVVVSSP L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLLRMGQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMT PFFTNKVVQ+ R GW
Sbjct  121  VYGEHWRKMRRIMTAPFFTNKVVQRNREGW  150



>ref|XP_002266238.1| PREDICTED: trans-cinnamate 4-monooxygenase [Vitis vinifera]
 emb|CAN77208.1| hypothetical protein VITISV_026676 [Vitis vinifera]
Length=505

 Score =   223 bits (569),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+L+EK LL +F AI++AI +SKL GKK KLPPGPLPVPVFGNWLQVGDDLNH NL+D
Sbjct  1    MDLILIEKALLAVFCAIILAITISKLLGKKLKLPPGPLPVPVFGNWLQVGDDLNHLNLSD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDIF+LRMGQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDIFMLRMGQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRVGW  150



>gb|KDO45078.1| hypothetical protein CISIN_1g021610mg [Citrus sinensis]
Length=298

 Score =   217 bits (553),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNL+D AKK+GD+ LLRM
Sbjct  14   FAAVVVAITVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLSDLAKKYGDVLLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R  W
Sbjct  134  TVPFFTNKVVQQQRFNW  150



>ref|XP_007146898.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
 gb|ESW18892.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
Length=505

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLL LEK L  LFFA ++A+  +KLRGK+++LPPGPL VP+FGNWLQVGDDLNH NL  
Sbjct  1    MDLLFLEKVLTALFFAAVIAVTAAKLRGKRFRLPPGPLSVPIFGNWLQVGDDLNHLNLAG  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A++FGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT
Sbjct  61   IARRFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRVGW  150



>gb|AAC35857.1| cinnamic acid 4-hydroxylase [Capsicum chinense]
Length=469

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPE AKEVLHTQGVEFGSRT
Sbjct  7    FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPESAKEVLHTQGVEFGSRT  66

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  67   RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRGGW  114



>gb|AHJ61295.1| cinnamate-4-hydroxylase [Hordeum vulgare]
Length=505

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  AILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQ  279
            A++ AIVVSK+RG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFG++FLLRMGQ
Sbjct  16   AVVGAIVVSKIRGRKLRLPPGPIPVPIFGNWLQVGDDLNHRNLAAMARKFGEVFLLRMGQ  75

Query  280  RNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  459
            RNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV
Sbjct  76   RNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  135

Query  460  PFFTNKVVQQYRRGW  504
            PFFTNKVVQQYR GW
Sbjct  136  PFFTNKVVQQYRPGW  150



>dbj|BAJ95120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  AILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQ  279
            A++ AIVVSK+RG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFG++FLLRMGQ
Sbjct  16   AVVGAIVVSKIRGRKLRLPPGPIPVPIFGNWLQVGDDLNHRNLAAMARKFGEVFLLRMGQ  75

Query  280  RNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  459
            RNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV
Sbjct  76   RNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  135

Query  460  PFFTNKVVQQYRRGW  504
            PFFTNKVVQQYR GW
Sbjct  136  PFFTNKVVQQYRPGW  150



>emb|CAP08846.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=488

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  106  LVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRN  285
            ++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+FLLRMGQRN
Sbjct  1    ILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRMGQRN  60

Query  286  LVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPF  465
            LVVVSSP+L KEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPF
Sbjct  61   LVVVSSPDLTKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPF  120

Query  466  FTNKVVQQYRRGW  504
            FTNKVVQQ R GW
Sbjct  121  FTNKVVQQNREGW  133



>gb|AGJ71350.1| cinnamate 4-hydroxylase 1 [Eucalyptus urophylla]
Length=505

 Score =   223 bits (567),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AK+FGDI LLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  43   FGNWLQVGDDLNHRNLTDLAKRFGDILLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  102

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  103  RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYREGW  150



>ref|XP_009354901.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI +SKLR KK+KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGD FLLRM
Sbjct  14   FLAVIVAIAISKLRSKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDCFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQ VEFGSRTRNVV DIF G+GQDMVF VYG HWR MRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQAVEFGSRTRNVVVDIFNGKGQDMVFCVYGVHWRNMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTN+VVQQYR GW
Sbjct  134  TVPFFTNRVVQQYRYGW  150



>ref|XP_010032943.1| PREDICTED: trans-cinnamate 4-monooxygenase [Eucalyptus grandis]
 gb|KCW52446.1| hypothetical protein EUGRSUZ_J01844 [Eucalyptus grandis]
Length=505

 Score =   222 bits (566),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AK+FGDI LLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRT
Sbjct  43   FGNWLQVGDDLNHRNLTDLAKRFGDILLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRT  102

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  103  RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYREGW  150



>gb|ACH56520.1| cinnamate-4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  118  VVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVV  297
             +SKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVV
Sbjct  22   TISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVV  81

Query  298  SSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNK  477
            SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNK
Sbjct  82   SSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNK  141

Query  478  VVQQYRRGW  504
            VVQQYR GW
Sbjct  142  VVQQYRFGW  150



>emb|CAE54486.1| unnamed protein product [Pinus pinaster]
Length=174

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNL D AKK+G+IFLL+MGQRNLVVVSSPELAKEVLHTQGVEFGSRT
Sbjct  46   FGNWLQVGDDLNHRNLGDLAKKYGEIFLLKMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  105

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR  W
Sbjct  106  RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFAW  153



>ref|XP_010931381.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   222 bits (565),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+LLEK LLGLF A+ +AI VSKLRGK+++LPPGPLPVPVFGNWLQVGDDLNHRNL+ 
Sbjct  1    MDLVLLEKALLGLFAAVTLAIAVSKLRGKRFRLPPGPLPVPVFGNWLQVGDDLNHRNLSA  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             A++FG+I LLRMGQRNLVVVSSP +A+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LARRFGNILLLRMGQRNLVVVSSPAVAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQYRTGW  150



>gb|ACZ54906.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNL+VVSS
Sbjct  24   SKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLLVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRDGW  150



>gb|AEM63593.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNL+VVSS
Sbjct  24   SKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLLVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRDGW  150



>gb|AID51447.1| cinnamate 4-hydroxylase 2 [Astragalus membranaceus]
Length=505

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT
Sbjct  43   FGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  102

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  103  RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>sp|Q96423.1|TCMO_GLYEC RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycyrrhiza 
echinata]
 dbj|BAA13414.1| cytochrome P450 (CYP73A14) [Glycyrrhiza echinata]
Length=505

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRG+++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FGDIFLLRMGQRNLVVVSS
Sbjct  24   SKLRGRRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRFGW  150



>gb|AEA72281.1| cinnamate 4-hydroxylase [Angelica gigas]
Length=505

 Score =   220 bits (561),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 120/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A +VAI VSKLRGKK KLPPGP PVPVFGNWLQVGDDLN RNL  YAKKFGD+FLLRM
Sbjct  14   FIATIVAITVSKLRGKKLKLPPGPFPVPVFGNWLQVGDDLNQRNLVGYAKKFGDLFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRNVVFD+FTG+GQDMVFTVY +HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDVFTGKGQDMVFTVYSEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>gb|AFD36436.1| cinnamate 4-hydroxylase 1 [Astragalus membranaceus]
Length=505

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  VSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVS  300
            +SKLRGK++KLPPG +PVP+FGNWLQVGDDLNHRNLTD AK+FGDIFLLRMGQRNLVVVS
Sbjct  23   ISKLRGKRFKLPPGQIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVS  82

Query  301  SPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKV  480
            SP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKV
Sbjct  83   SPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKV  142

Query  481  VQQYRRGW  504
            VQQYR GW
Sbjct  143  VQQYRFGW  150



>ref|XP_010938024.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   220 bits (560),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+ +AI VSKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLT  AK+FG+I LLRM
Sbjct  14   FAAVSLAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTALAKRFGNILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELA++VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELARDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQ  R GW
Sbjct  134  TVPFFTNKVVQHNRHGW  150



>gb|AIS92509.1| cinnamate 4-hydroxylase [Epimedium sagittatum]
Length=505

 Score =   220 bits (560),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  187  NWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRN  366
            NWLQVGDDLNHRNLTDYA+KFG+IFLLRMGQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN
Sbjct  45   NWLQVGDDLNHRNLTDYARKFGEIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRN  104

Query  367  VVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  105  VVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFGW  150



>gb|AEH68208.1| cinnamate 4-hydroxylase [Astragalus mongholicus]
Length=505

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  VSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVS  300
            +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FGDIFLLRMGQRNLVV+S
Sbjct  23   ISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVIS  82

Query  301  SPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKV  480
            SP+LAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKV
Sbjct  83   SPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKV  142

Query  481  VQQYRRGW  504
            VQQYR GW
Sbjct  143  VQQYRFGW  150



>ref|XP_008657127.1| PREDICTED: trans-cinnamate 4-monooxygenase [Zea mays]
 gb|AFW84752.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=505

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  AILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQ  279
            +++VAI VSK+RG+K +LPPGP+PVPVFGNWLQVGDDLNHRNL   ++KFGD+FLLRMGQ
Sbjct  16   SVMVAIAVSKIRGRKLRLPPGPVPVPVFGNWLQVGDDLNHRNLAALSRKFGDVFLLRMGQ  75

Query  280  RNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTV  459
            RNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFT +GQDMVFTVYGDHWRKMRRIMTV
Sbjct  76   RNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTDKGQDMVFTVYGDHWRKMRRIMTV  135

Query  460  PFFTNKVVQQYRRGW  504
            PFFTNKVVQQYR GW
Sbjct  136  PFFTNKVVQQYRHGW  150



>gb|AGE10592.1| cinnamate 4-hydroxylase [Lonicera japonica]
Length=505

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  VSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVS  300
            +SKLRGKK+KLPPGPLPVPVFGNWLQVGDDLNHRNLTD AKKFGD+F+LRMGQRNLVVVS
Sbjct  23   ISKLRGKKFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDVFMLRMGQRNLVVVS  82

Query  301  SPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKV  480
            SP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKV
Sbjct  83   SPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKV  142

Query  481  VQQYRRGW  504
            VQQYR GW
Sbjct  143  VQQYRYGW  150



>gb|KGN46762.1| hypothetical protein Csa_6G133710 [Cucumis sativus]
Length=391

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F ++++AI +SKLRGK++KLPPGPLPVP+FGNWLQVGDDLNHRNLTD AKKFGDIFLLRM
Sbjct  14   FLSVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNK  477
            TVPFFTNK
Sbjct  134  TVPFFTNK  141



>ref|XP_004151467.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
 ref|XP_004173174.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=507

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+GLFF ++VAI +SK RGK++KLPPGP+P+P+FGNWLQVGDDLNHRNL +
Sbjct  1    MDLLLLEKALVGLFFTMVVAISISKFRGKRFKLPPGPIPIPIFGNWLQVGDDLNHRNLRE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AK+FGDI LLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFT +GQDMVFT
Sbjct  61   LAKRFGDILLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTDKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNRLGW  150



>gb|AGO03798.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=505

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  VSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVS  300
            +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+IFLLRMGQRNLVVVS
Sbjct  23   ISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMGQRNLVVVS  82

Query  301  SPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKV  480
            SP+LAK+VLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKV
Sbjct  83   SPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKV  142

Query  481  VQQYRRGW  504
            VQQYR GW
Sbjct  143  VQQYRFGW  150



>gb|AGN70893.1| cinammate 4-hydroxylase [Dendrobium catenatum]
Length=505

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDL+L+EK LLGLF A+ +A+VVSKL GKK KLPPGPLPVP+FGNWLQVGDDLNHRNL  
Sbjct  1    MDLVLVEKALLGLFAAVTLAVVVSKLSGKKLKLPPGPLPVPIFGNWLQVGDDLNHRNLAS  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AKKFGDI LLRMGQRNLVVVSSP+ A+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFT
Sbjct  61   LAKKFGDILLLRMGQRNLVVVSSPDHAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRK+RRIMTVPFFTNKVVQQYR GW
Sbjct  121  VYGEHWRKVRRIMTVPFFTNKVVQQYRYGW  150



>ref|XP_006432069.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
 gb|AAK57011.1|AF378333_1 cinnamate 4-hydroxylase [Citrus x paradisi]
 gb|ESR45309.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
Length=505

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++VAI VSKLRGK++KLPPGPLPVPVFGNWLQVGDDLNHRNL+D AKK+GD+ LLRM
Sbjct  14   FAAVVVAITVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLSDLAKKYGDVLLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R  W
Sbjct  134  TVPFFTNKVVQQQRFNW  150



>emb|CDY23996.1| BnaC03g16950D [Brassica napus]
Length=481

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL EK L+ +F A+++A ++SKLRGKK KLPPGP+PVPVFGNWLQVGDDLNHRNL D
Sbjct  1    MDLLLSEKPLIAVFLAVVLATMISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNHRNLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+F LRMGQR+LVV+SSP+LAKEVL TQGVEFGSR RN+V+DIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFHLRMGQRDLVVISSPDLAKEVLQTQGVEFGSRYRNIVYDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNREGW  150



>gb|ACE88962.1| cinnamic acid 4-hydroxylase [Phyllostachys edulis]
Length=472

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F + +VAI VSK+RG+K +LPPGPL VP+FGNWLQVGDDLNHR+LT  A+KFG+IFLLRM
Sbjct  14   FASAVVAIAVSKIRGRKLRLPPGPLAVPIFGNWLQVGDDLNHRSLTALARKFGEIFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVV Q R GW
Sbjct  134  TVPFFTNKVVAQNRAGW  150



>gb|ABF58026.1| cinnamate-4-hydroxylate-like [Hibiscus cannabinus]
 gb|ACR08417.1| cinnamate 4-hydroxylase [Hibiscus cannabinus]
 gb|ACU86960.1| cinnamate 4-hydroxylase 2 [Hibiscus cannabinus]
Length=444

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/106 (95%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +1

Query  187  NWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRN  366
            NWLQVGDDLNHRNLTD  KKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRN
Sbjct  1    NWLQVGDDLNHRNLTDLTKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRN  60

Query  367  VVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  61   VVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRHGW  106



>gb|ACY06865.2| cinnamate 4-hydroxylase [Astragalus chrysochlorus]
Length=506

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FGDIFLLRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQ R GW
Sbjct  144  QQNRFGW  150



>gb|ACB78014.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FG+I LLRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRMGQRNLVVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRFGW  150



>ref|XP_009410039.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+ +AIV+SKLRGK +KLPPGPLPVPVFGNWLQVGDDLNHRNLT  AK+FGDI LLRM
Sbjct  14   FAAVTLAIVMSKLRGKHFKLPPGPLPVPVFGNWLQVGDDLNHRNLTALAKRFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            G RNLVVVS+PELA+EVLH QGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GVRNLVVVSNPELAREVLHAQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R+GW
Sbjct  134  TVPFFTNKVVQQNRQGW  150



>gb|ACB78016.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  SKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  303
            SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FG+I LLRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRMGQRNLVVVSS  83

Query  304  PELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVV  483
            PELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVV
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV  143

Query  484  QQYRRGW  504
            QQYR GW
Sbjct  144  QQYRFGW  150



>sp|Q43067.2|TCMO_PEA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Pisum 
sativum]
Length=505

 Score =   216 bits (551),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A + AI +SKLRGK +KLPPGP PVPVFGNWLQVGDDLNHRNLTD AK+F +I LLRM
Sbjct  14   FLAAITAITISKLRGKPFKLPPGPFPVPVFGNWLQVGDDLNHRNLTDLAKRFAEILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
             QRNLVV+SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQD+VFTVYG+HWRKMRRIM
Sbjct  74   EQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDIVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>gb|AFK42083.1| unknown [Medicago truncatula]
Length=152

 Score =   206 bits (523),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A  +AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTDYAK+FG++FLLRM
Sbjct  14   FIAATIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEMFLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFF  468
            TVPFF
Sbjct  134  TVPFF  138



>ref|XP_009421412.1| PREDICTED: trans-cinnamate 4-monooxygenase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=503

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A+ + IVVSKLRGK  KLPPGPLPVPVFGNWLQVGDDLNHRNLT  AK+FGDI LLRM
Sbjct  14   FAAVTLGIVVSKLRGKHLKLPPGPLPVPVFGNWLQVGDDLNHRNLTALAKRFGDILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            G RNLVVVSSP LA+EVLH QGVEFGSRTRNVVFDIFTG+GQDMVFTVYGDHWRKMRRIM
Sbjct  74   GVRNLVVVSSPTLAREVLHAQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQ R GW
Sbjct  134  TVPFFTNKVVQQNREGW  150



>ref|XP_009141067.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EK+L+ +F A+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHR L D
Sbjct  1    MDLLLVEKSLIAVFLAVVLATVVSKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRKLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FL +MGQRN+VVVSSP+L KEVLHTQGVEFGSR RN+V+DIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLFKMGQRNIVVVSSPDLTKEVLHTQGVEFGSRHRNMVYDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ   GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNHEGW  150



>gb|AFV91409.1| cinnamate 4-hydroxylase C4H2, partial [Populus tremula]
Length=181

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +1

Query  196  QVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVF  375
            QVGDDLNHRNLTD AKKFGDIFLLRMGQRNLVVVSSP+L+KEVLHTQGVEFGSRTRNVVF
Sbjct  1    QVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVF  60

Query  376  DIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            DIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR GW
Sbjct  61   DIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW  103



>ref|XP_008457287.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis melo]
Length=507

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLLLEK L+G+F  I+VAI +SK++GK++ LPPGP+P+P+FGNWLQVGDDLNH NL +
Sbjct  1    MDLLLLEKALVGMFVTIVVAISISKIKGKRFNLPPGPIPIPIFGNWLQVGDDLNHHNLRE  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
             AK+FGDI LLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFT +GQDMVFT
Sbjct  61   LAKRFGDILLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTDKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ R GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNRLGW  150



>emb|CDY29671.1| BnaA04g17560D [Brassica napus]
Length=505

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EK+L+ +F A+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHR L D
Sbjct  1    MDLLLVEKSLIAVFVAVVLATVVSKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRKLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FL +MGQRN+VVVSSP+L KEVLHTQGVEFGSR RN+V+DIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLFKMGQRNIVVVSSPDLTKEVLHTQGVEFGSRHRNMVYDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ   GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNHEGW  150



>gb|AHG06398.1| cinnamic acid 4-hydroxylase [Ornithogalum saundersiae]
Length=505

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A++++I VSKLRGKK +LPPGPLPVPVFGNWLQVGDDLNHRNLT  A+KFG++ LLRM
Sbjct  14   FAAVVLSIAVSKLRGKKLRLPPGPLPVPVFGNWLQVGDDLNHRNLTALARKFGEVLLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
            GQRNLVVVSSP LA++VLHT GVEFGSRTRNVVFDIFTGEGQDMVFTVYG+HWRKMRRIM
Sbjct  74   GQRNLVVVSSPSLARDVLHTHGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVV QYR GW
Sbjct  134  TVPFFTNKVVGQYRFGW  150



>emb|CDX97827.1| BnaC04g41120D [Brassica napus]
Length=505

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  55   MDllllektllglFFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTD  234
            MDLLL+EK+L+ +F A+++A VVSKLRGKK KLPP P+P+P+FGNWLQVGDDLNHR L D
Sbjct  1    MDLLLVEKSLIAVFVAVVLATVVSKLRGKKLKLPPSPIPIPIFGNWLQVGDDLNHRKLVD  60

Query  235  YAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFT  414
            YAKKFGD+FL +MGQRN+VVVSSP+L KEVLHTQGVEFGSR RN+V+DIFTG+GQDMVFT
Sbjct  61   YAKKFGDLFLFKMGQRNIVVVSSPDLTKEVLHTQGVEFGSRHRNMVYDIFTGKGQDMVFT  120

Query  415  VYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            VYG+HWRKMRRIMTVPFFTNKVVQQ   GW
Sbjct  121  VYGEHWRKMRRIMTVPFFTNKVVQQNHEGW  150



>gb|AAG09205.1|AF175275_1 trans-cinnamic acid hydroxylase [Pisum sativum]
Length=497

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A + AI +SKLRGK +KLPPGP PVPVFGNWLQVGDDLNHRNLTD AK+F +I LLRM
Sbjct  14   FLAAITAITISKLRGKPFKLPPGPFPVPVFGNWLQVGDDLNHRNLTDLAKRFAEILLLRM  73

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
             QRNLVV+SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQD+VFTVYG+HWRKMRRIM
Sbjct  74   EQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDIVFTVYGEHWRKMRRIM  133

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  134  TVPFFTNKVVQQYRFGW  150



>gb|AAC49187.2| trans-cinnamic acid hydroxylase [Pisum sativum]
Length=503

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A + AI +SKLRGK +KLPPGP PVPVFGNWLQVGDDLNHRNLTD AK+F +I LLRM
Sbjct  12   FLAAITAITISKLRGKPFKLPPGPFPVPVFGNWLQVGDDLNHRNLTDLAKRFAEILLLRM  71

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
             QRNLVV+SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQD+VFTVYG+HWRKMRRIM
Sbjct  72   EQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDIVFTVYGEHWRKMRRIM  131

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  132  TVPFFTNKVVQQYRFGW  148



>prf||2209439A cytochrome P450 monooxygenase
Length=503

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   FFAILVAIVVSKLRgkkyklppgplpvpvFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  273
            F A + AI +SKLRGK +KLPPGP PVPVFGNWLQVGDDLNHRNLTD AK+F +I LLRM
Sbjct  12   FLAAITAITISKLRGKPFKLPPGPFPVPVFGNWLQVGDDLNHRNLTDLAKRFAEILLLRM  71

Query  274  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGDHWRKMRRIM  453
             QRNLVV+SSPELAKEVLHTQGVEFGSRTRNVVFDIFTG+GQD+VFTVYG+HWRKMRRIM
Sbjct  72   EQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDIVFTVYGEHWRKMRRIM  131

Query  454  TVPFFTNKVVQQYRRGW  504
            TVPFFTNKVVQQYR GW
Sbjct  132  TVPFFTNKVVQQYRFGW  148



>gb|AAW70021.1| cinnamic acid 4-hydroxylase [Ginkgo biloba]
Length=505

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  FGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT  360
            FGNWLQVGDDLNHRNLTD AKK+G+IFLL+MGQRNLVVVSSPE AKEVLHTQGVEFGSRT
Sbjct  44   FGNWLQVGDDLNHRNLTDLAKKYGEIFLLKMGQRNLVVVSSPEYAKEVLHTQGVEFGSRT  103

Query  361  RNVVFDIFTGEGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVQQYRRGW  504
            RNVVFDIFTG+GQDMVFTVYG+HWRKMRRIMTVPFFTNKVVQQYR  W
Sbjct  104  RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFAW  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905