BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF015M10

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    131   1e-45   Nicotiana sylvestris
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    127   9e-45   Nicotiana tomentosiformis
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    121   4e-42   Sesamum indicum [beniseed]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    124   9e-42   Sesamum indicum [beniseed]
emb|CDP14208.1|  unnamed protein product                                110   4e-40   Coffea canephora [robusta coffee]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    107   1e-38   Nicotiana tomentosiformis
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                114   2e-38   Erythranthe guttata [common monkey flower]
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                110   4e-37   Erythranthe guttata [common monkey flower]
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    103   5e-37   Nicotiana sylvestris
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    102   1e-36   Solanum lycopersicum
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...  99.4    1e-35   Solanum tuberosum [potatoes]
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...  89.4    2e-33   Solanum lycopersicum
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    105   8e-33   Vitis vinifera
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...  84.7    5e-32   Solanum tuberosum [potatoes]
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    102   2e-31   Nicotiana sylvestris
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    102   3e-31   Nicotiana tomentosiformis
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...  93.2    4e-28   Prunus mume [ume]
gb|KDP26218.1|  hypothetical protein JCGZ_22464                         100   6e-28   Jatropha curcas
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    100   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg           91.7    2e-27   Prunus persica
gb|AFK42347.1|  unknown                                               96.3    3e-26   Medicago truncatula
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                96.3    3e-26   Medicago truncatula
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...  89.0    7e-26   Fragaria vesca subsp. vesca
emb|CDY14768.1|  BnaC04g47650D                                        97.4    8e-26   Brassica napus [oilseed rape]
gb|KJB16379.1|  hypothetical protein B456_002G227200                  90.5    1e-25   Gossypium raimondii
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  89.0    1e-25   
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...  90.1    2e-25   
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  90.9    2e-25   
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...  95.1    5e-25   Brassica rapa
emb|CDY06925.1|  BnaA04g23900D                                        94.7    1e-24   
emb|CBI30075.3|  unnamed protein product                              75.5    7e-24   Vitis vinifera
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative         82.8    9e-24   Ricinus communis
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg           81.3    2e-23   Citrus clementina [clementine]
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...  82.8    2e-23   
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...  80.9    3e-23   Citrus sinensis [apfelsine]
ref|XP_002323262.1|  Calmodulin-like family protein                   81.6    1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...  80.1    2e-22   Populus euphratica
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...  89.7    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_002308908.1|  Calmodulin-like family protein                   80.5    3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...  81.6    5e-22   Cicer arietinum [garbanzo]
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                 77.8    6e-22   Citrus sinensis [apfelsine]
emb|CDY23852.1|  BnaC04g01850D                                        88.6    7e-22   Brassica napus [oilseed rape]
emb|CDY00910.1|  BnaC05g42900D                                        87.8    1e-21   
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...  87.0    1e-21   Tarenaya hassleriana [spider flower]
ref|XP_010102734.1|  putative calcium-binding protein CML36           77.4    1e-21   
gb|AGV22098.1|  calmodulin-like protein                               86.7    2e-21   Brassica juncea [brown mustard]
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...  86.7    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg           82.8    3e-21   Eutrema salsugineum [saltwater cress]
emb|CDY60169.1|  BnaAnng16630D                                        85.5    5e-21   Brassica napus [oilseed rape]
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                 81.6    5e-21   Citrus sinensis [apfelsine]
emb|CDX79938.1|  BnaA05g02180D                                        85.5    6e-21   
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...  85.1    6e-21   Brassica rapa
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...  77.0    8e-21   Populus euphratica
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...  84.3    1e-20   Brassica rapa
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...  77.8    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457           84.3    3e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194           82.8    4e-20   Arabidopsis lyrata subsp. lyrata
gb|AAM61257.1|  calmodulin-like protein                               84.0    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181672.1|  putative calcium-binding protein CML35              84.0    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                  80.1    5e-20   Arabis alpina [alpine rockcress]
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...  80.1    7e-20   Tarenaya hassleriana [spider flower]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                  79.7    1e-19   Arabis alpina [alpine rockcress]
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg           80.1    2e-19   Capsella rubella
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg           82.4    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg           77.8    4e-19   Capsella rubella
ref|NP_187630.1|  putative calcium-binding protein CML36              79.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAA48190.1|  calmodulin like protein                              80.1    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...  67.0    9e-19   Phoenix dactylifera
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3             66.6    1e-18   Elaeis guineensis
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...  68.2    1e-18   Glycine max [soybeans]
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...  67.0    1e-18   Elaeis guineensis
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...  77.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...  77.0    2e-18   Camelina sativa [gold-of-pleasure]
gb|KJB35924.1|  hypothetical protein B456_006G133800                  89.4    3e-18   Gossypium raimondii
ref|XP_008800223.1|  PREDICTED: calmodulin-like                       69.7    3e-18   Phoenix dactylifera
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...  69.3    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...  75.1    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...  72.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...  72.0    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...  68.2    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...  83.6    3e-16   Solanum tuberosum [potatoes]
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g           67.4    4e-16   Phaseolus vulgaris [French bean]
ref|NP_001265939.1|  Hop-interacting protein THI026                   82.8    6e-16   Solanum lycopersicum
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg           73.9    1e-15   
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...  65.1    1e-15   Eucalyptus grandis [rose gum]
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...  62.4    1e-15   Glycine max [soybeans]
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...  79.3    6e-15   
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...  55.5    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...  65.5    1e-13   
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...  52.8    3e-13   
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...  52.8    3e-13   
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...  53.1    1e-12   
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...  49.7    3e-11   Elaeis guineensis
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...  48.1    8e-11   Phoenix dactylifera
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...  57.0    9e-11   Malus domestica [apple tree]
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  59.7    1e-10   Sesamum indicum [beniseed]
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...  46.6    1e-10   Elaeis guineensis
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...  49.7    1e-10   Phoenix dactylifera
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like       54.7    2e-10   Glycine max [soybeans]
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg              49.3    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like    52.4    4e-10   Eucalyptus grandis [rose gum]
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...  53.1    5e-10   Elaeis guineensis
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...  55.8    5e-10   
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...  50.1    5e-10   Phoenix dactylifera
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  54.3    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_009770094.1|  PREDICTED: calmodulin-like                       56.6    7e-10   Nicotiana sylvestris
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  57.0    7e-10   Cicer arietinum [garbanzo]
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...  50.4    9e-10   Fragaria vesca subsp. vesca
gb|KHN04934.1|  Calmodulin-like protein 8                             53.1    9e-10   Glycine soja [wild soybean]
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like               56.6    1e-09   Solanum tuberosum [potatoes]
ref|XP_004230637.1|  PREDICTED: calmodulin-like                       56.2    1e-09   Solanum lycopersicum
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           53.1    1e-09   Prunus persica
ref|XP_008457589.1|  PREDICTED: probable calcium-binding protein ...  45.8    1e-09   Cucumis melo [Oriental melon]
ref|XP_007144825.1|  hypothetical protein PHAVU_007G187200g           51.6    1e-09   Phaseolus vulgaris [French bean]
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg              52.8    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_003556466.1|  PREDICTED: calmodulin-like protein 8-like is...  53.1    2e-09   Glycine max [soybeans]
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  53.1    2e-09   Prunus mume [ume]
ref|XP_010104706.1|  putative calcium-binding protein CML25           52.0    2e-09   Morus notabilis
gb|EPS63975.1|  hypothetical protein M569_10810                       53.9    3e-09   Genlisea aurea
ref|XP_009617304.1|  PREDICTED: calmodulin-like                       53.9    5e-09   Nicotiana tomentosiformis
ref|XP_011082591.1|  PREDICTED: calmodulin-like                       54.3    5e-09   Sesamum indicum [beniseed]
ref|XP_011079925.1|  PREDICTED: calmodulin-like                       54.3    6e-09   Sesamum indicum [beniseed]
emb|CDW53538.1|  Calmodulin                                           52.0    6e-09   Trichuris trichiura
gb|AFK83800.1|  calmodulin                                            45.1    6e-09   Mnemiopsis leidyi [American comb jelly]
gb|KFD49502.1|  hypothetical protein M513_09613                       52.0    8e-09   Trichuris suis
gb|KDP21392.1|  hypothetical protein JCGZ_21863                       55.5    8e-09   Jatropha curcas
ref|XP_002671503.1|  predicted protein                                58.2    8e-09   Naegleria gruberi strain NEG-M
ref|XP_011150176.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    9e-09   Harpegnathos saltator
gb|KGG50401.1|  calmodulin                                            51.6    1e-08   Mitosporidium daphniae
ref|XP_002738868.1|  PREDICTED: calmodulin-like                       45.1    1e-08   Saccoglossus kowalevskii
ref|XP_011257081.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    1e-08   Camponotus floridanus
gb|EFN67816.1|  Calmodulin                                            51.2    1e-08   Camponotus floridanus
ref|XP_011066820.1|  PREDICTED: neo-calmodulin-like                   51.2    1e-08   Acromyrmex echinatior
gb|EZA54087.1|  Calmodulin                                            51.2    1e-08   Ooceraea biroi
ref|XP_011150175.1|  PREDICTED: calmodulin-A-like isoform X2          51.2    1e-08   Harpegnathos saltator
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...  45.4    1e-08   Nicotiana tomentosiformis
ref|XP_011339099.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    1e-08   Ooceraea biroi
ref|XP_011150174.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    1e-08   Harpegnathos saltator
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...  50.4    1e-08   Malus domestica [apple tree]
ref|XP_011171909.1|  PREDICTED: neo-calmodulin-like                   51.2    1e-08   Solenopsis invicta [imported red fire ant]
ref|XP_011257079.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    1e-08   Camponotus floridanus
ref|XP_010038682.1|  PREDICTED: calmodulin-like protein 11            47.0    1e-08   Eucalyptus grandis [rose gum]
ref|XP_006014812.1|  PREDICTED: calmodulin                            53.9    1e-08   
ref|XP_011257080.1|  PREDICTED: calmodulin-A-like isoform X2          51.2    1e-08   Camponotus floridanus
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  50.4    1e-08   Malus domestica [apple tree]
ref|XP_003400211.1|  PREDICTED: calmodulin-like                       51.2    1e-08   Bombus terrestris [large earth bumblebee]
ref|XP_008550049.1|  PREDICTED: calmodulin-A-like                     51.2    1e-08   Microplitis demolitor
ref|XP_011339098.1|  PREDICTED: calmodulin-A-like isoform X2          51.2    1e-08   
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...  54.3    1e-08   
ref|XP_004151276.1|  PREDICTED: probable calcium-binding protein ...  45.1    1e-08   Cucumis sativus [cucumbers]
ref|XP_011339096.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    1e-08   Ooceraea biroi
ref|XP_006558597.1|  PREDICTED: calmodulin-like isoform X4            51.2    1e-08   Apis mellifera [bee]
ref|XP_006558598.1|  PREDICTED: calmodulin-like isoform X5            51.2    1e-08   Apis mellifera [bee]
gb|KJB50384.1|  hypothetical protein B456_008G168100                  50.4    1e-08   Gossypium raimondii
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  48.1    1e-08   Eucalyptus grandis [rose gum]
ref|XP_006558596.1|  PREDICTED: calmodulin-like isoform X3            51.2    1e-08   Apis mellifera [bee]
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  50.1    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_006616491.1|  PREDICTED: calmodulin-like isoform X5            51.2    1e-08   Apis dorsata [rock honeybee]
ref|XP_006616488.1|  PREDICTED: calmodulin-like isoform X2            51.6    1e-08   Apis dorsata [rock honeybee]
ref|XP_006616489.1|  PREDICTED: calmodulin-like isoform X3            51.2    1e-08   Apis dorsata [rock honeybee]
gb|EPS62655.1|  hypothetical protein M569_12136                       49.3    2e-08   Genlisea aurea
ref|XP_624589.2|  PREDICTED: calmodulin-like isoformX2                51.2    2e-08   Apis mellifera [bee]
ref|XP_006616490.1|  PREDICTED: calmodulin-like isoform X4            51.2    2e-08   Apis dorsata [rock honeybee]
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     53.5    2e-08   Callorhinchus milii [Australian ghost shark]
ref|XP_006616487.1|  PREDICTED: calmodulin-like isoform X1            51.2    2e-08   Apis dorsata [rock honeybee]
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...  43.9    2e-08   Nicotiana sylvestris
ref|XP_011150177.1|  PREDICTED: neo-calmodulin-like isoform X4        50.8    2e-08   Harpegnathos saltator
gb|EGI57712.1|  Calmodulin                                            50.4    2e-08   Acromyrmex echinatior
ref|XP_007295339.1|  calmodulin                                       47.8    2e-08   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...  44.7    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...  48.9    2e-08   Cicer arietinum [garbanzo]
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            51.2    2e-08   
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...  48.5    2e-08   Solanum tuberosum [potatoes]
gb|AET05414.2|  EF hand calcium-binding family protein                52.0    2e-08   Medicago truncatula
dbj|BAM78547.1|  GCaMP7a                                              51.2    2e-08   synthetic construct
ref|XP_007298032.1|  EF-hand                                          49.3    2e-08   Stereum hirsutum FP-91666 SS1
dbj|GAA42135.2|  calmodulin-like protein 1                            43.1    2e-08   Clonorchis sinensis [oriental liver fluke]
ref|XP_011307674.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    2e-08   Fopius arisanus
ref|XP_003630938.1|  Calcium-binding pollen allergen                  52.0    2e-08   
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...  49.3    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...  47.8    2e-08   Prunus mume [ume]
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            47.4    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY97018.1|  hypothetical protein OsI_18939                        47.4    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_011307673.1|  PREDICTED: calmodulin-A-like isoform X2          51.2    3e-08   Fopius arisanus
ref|XP_011257082.1|  PREDICTED: neo-calmodulin-like isoform X4        50.1    3e-08   Camponotus floridanus
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            50.8    3e-08   
ref|XP_008216621.1|  PREDICTED: calmodulin-A-like                     51.2    3e-08   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       48.9    3e-08   Phoenix dactylifera
ref|XP_011307672.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    3e-08   Fopius arisanus
gb|ELU13700.1|  hypothetical protein CAPTEDRAFT_169155                50.4    3e-08   Capitella teleta
gb|AHY86314.1|  Y-GECO1                                               54.3    3e-08   synthetic construct
gb|AHY86315.1|  Y-GECO1f                                              54.3    3e-08   synthetic construct
ref|XP_001326924.1|  calmodulin                                       48.1    3e-08   Trichomonas vaginalis G3
ref|XP_007033045.1|  Calmodulin like 23, putative                     48.9    3e-08   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   49.3    3e-08   Elaeis guineensis
gb|ADD38579.1|  Calmodulin                                            49.3    3e-08   Lepeophtheirus salmonis
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...  47.0    3e-08   
gb|EPS64880.1|  hypothetical protein M569_09899                       49.3    3e-08   Genlisea aurea
ref|XP_011498410.1|  PREDICTED: neo-calmodulin-like isoform X2        51.2    3e-08   Ceratosolen solmsi marchali
ref|XP_003695096.1|  PREDICTED: calmodulin-like                       50.4    3e-08   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8             47.8    3e-08   Phoenix dactylifera
gb|ACO12252.1|  Calmodulin                                            49.3    4e-08   Lepeophtheirus salmonis
ref|XP_504759.1|  YALI0E34111p                                        49.3    4e-08   Yarrowia lipolytica CLIB122
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   45.8    4e-08   Hormiphora californensis
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            47.4    4e-08   
gb|EKC24243.1|  Calmodulin                                            51.6    4e-08   Crassostrea gigas
ref|XP_011498409.1|  PREDICTED: neo-calmodulin-like isoform X1        50.8    4e-08   Ceratosolen solmsi marchali
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           48.1    4e-08   Prunus persica
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  50.1    4e-08   Cucumis melo [Oriental melon]
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   45.8    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001147205.1|  calmodulin                                       54.7    4e-08   
ref|XP_003704227.1|  PREDICTED: calmodulin-like                       48.9    4e-08   
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...  50.1    4e-08   
gb|KFO18269.1|  Calmodulin                                            52.4    4e-08   Fukomys damarensis [Damara mole rat]
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  43.1    4e-08   Sesamum indicum [beniseed]
ref|XP_005483194.1|  PREDICTED: calmodulin                            52.4    5e-08   
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3             51.6    5e-08   Eucalyptus grandis [rose gum]
gb|EYU40733.1|  hypothetical protein MIMGU_mgv1a014669mg              48.5    5e-08   Erythranthe guttata [common monkey flower]
gb|ACN35459.1|  unknown                                               54.7    5e-08   Zea mays [maize]
gb|EFA05282.1|  hypothetical protein TcasGA2_TC015439                 56.2    5e-08   
ref|XP_008472657.1|  PREDICTED: calmodulin-like                       49.3    5e-08   
gb|ACG37753.1|  calmodulin                                            54.7    5e-08   Zea mays [maize]
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       46.2    5e-08   Saccoglossus kowalevskii
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...  45.4    5e-08   Setaria italica
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg           49.3    5e-08   Citrus clementina [clementine]
gb|KJB08532.1|  hypothetical protein B456_001G087100                  48.1    5e-08   Gossypium raimondii
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...  44.7    6e-08   Malus domestica [apple tree]
gb|ABK21927.1|  unknown                                               48.9    6e-08   Picea sitchensis
emb|CDP19328.1|  unnamed protein product                              51.6    6e-08   Coffea canephora [robusta coffee]
ref|XP_003372739.1|  EF hand domain containing protein                51.2    6e-08   Trichinella spiralis
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           50.4    6e-08   Phaseolus vulgaris [French bean]
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...  46.2    7e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139379.1|  PREDICTED: calmodulin-like protein 8-like        43.9    7e-08   
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  49.7    7e-08   
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...  43.1    7e-08   Solanum lycopersicum
gb|KIW16124.1|  calmodulin                                            50.4    7e-08   Exophiala spinifera
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                   50.8    7e-08   Eucalyptus grandis [rose gum]
ref|XP_004867158.1|  PREDICTED: calmodulin isoform X3                 51.2    7e-08   
ref|XP_004308823.1|  PREDICTED: calmodulin-5/6/7/8-like               51.2    8e-08   Fragaria vesca subsp. vesca
ref|XP_008197240.1|  PREDICTED: neo-calmodulin-like isoform X2        50.1    8e-08   Tribolium castaneum [rust-red flour beetle]
gb|EFZ10130.1|  hypothetical protein SINV_07599                       48.9    8e-08   
ref|XP_971297.2|  PREDICTED: neo-calmodulin-like isoform X3           50.1    8e-08   Tribolium castaneum [rust-red flour beetle]
ref|XP_002721725.1|  PREDICTED: calmodulin-like protein 3             52.4    8e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003637661.1|  Calcium-binding pollen allergen                  47.0    8e-08   
ref|XP_011498411.1|  PREDICTED: neo-calmodulin-like isoform X3        49.7    8e-08   Ceratosolen solmsi marchali
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg           43.1    8e-08   Eutrema salsugineum [saltwater cress]
ref|XP_004923690.1|  PREDICTED: calmodulin-like                       50.4    8e-08   
pdb|3SG5|A  Chain A, Crystal Structure Of Dimeric Gcamp3-d380y, Q...  50.8    8e-08   Gallus gallus [bantam]
ref|XP_966558.2|  PREDICTED: neo-calmodulin-like                      56.2    9e-08   
ref|XP_008197239.1|  PREDICTED: neo-calmodulin-like isoform X1        50.1    9e-08   Tribolium castaneum [rust-red flour beetle]
pdb|3SG4|A  Chain A, Crystal Structure Of Gcamp3-d380y, Lp(linker 2)  50.8    9e-08   Gallus gallus [bantam]
ref|NP_001053179.1|  Os04g0492800                                     52.8    9e-08   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             49.7    9e-08   Nicotiana sylvestris
prf||0608335A  calmodulin                                             49.3    9e-08
gb|EMS61663.1|  Calmodulin-like protein 5                             45.8    1e-07   Triticum urartu
ref|XP_011498412.1|  PREDICTED: neo-calmodulin-like isoform X4        49.7    1e-07   Ceratosolen solmsi marchali
gb|AFK34900.1|  unknown                                               46.2    1e-07   Lotus japonicus
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8             45.8    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    42.0    1e-07   Solanum tuberosum [potatoes]
gb|ADJ53338.1|  GCaMP3                                                50.4    1e-07   synthetic construct
pdb|3SG7|A  Chain A, Crystal Structure Of Gcamp3-kf(linker 1)         50.4    1e-07   Gallus gallus [bantam]
gb|EHH17309.1|  hypothetical protein EGK_13688                        50.8    1e-07   Macaca mulatta [rhesus macaque]
pdb|4IK3|A  Chain A, High Resolution Structure Of Gcamp3 At Ph 8.5    50.4    1e-07   Entacmaea quadricolor
ref|XP_006664172.1|  PREDICTED: calmodulin-like protein 5-like        47.8    1e-07   Oryza brachyantha
ref|NP_173866.1|  putative calcium-binding protein CML25              48.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
pdb|4IK1|A  Chain A, High Resolution Structure Of Gcampj At Ph 8.5    50.4    1e-07   Entacmaea quadricolor
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11            48.9    1e-07   Pyrus x bretschneideri [bai li]
gb|EMT30279.1|  Calmodulin-like protein 5                             45.8    1e-07   
ref|XP_010279286.1|  PREDICTED: calmodulin-like protein 11            46.6    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_005717351.1|  Calmodulin                                       44.7    1e-07   Chondrus crispus [carageen]
pdb|3WLC|A  Chain A, Crystal Structure Of Dimeric Gcamp6m             50.8    1e-07   Gallus gallus [bantam]
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     50.1    1e-07   Crassostrea gigas
ref|XP_008119752.1|  PREDICTED: calmodulin                            50.8    1e-07   
pdb|3SG3|A  Chain A, Crystal Structure Of Gcamp3-d380y                50.4    1e-07   Gallus gallus [bantam]
ref|XP_004156491.1|  PREDICTED: calmodulin-like protein 8-like        43.5    1e-07   
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg           48.5    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2            50.4    1e-07   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4             47.8    1e-07   Tarenaya hassleriana [spider flower]
gb|AEO16865.1|  GEX-GECO1                                             52.4    1e-07   
pdb|4IK5|A  Chain A, High Resolution Structure Of Delta-rest-gcamp3   50.1    1e-07   
pdb|4OY4|A  Chain A, Calcium-free Campari V0.2                        50.4    1e-07   
ref|XP_004605359.1|  PREDICTED: calmodulin-like protein 3             45.4    1e-07   
gb|AGG76568.1|  red fluorescent calcium-binding protein RCaMP1h       50.8    1e-07   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            46.2    1e-07   
ref|XP_001622774.1|  predicted protein                                51.2    1e-07   
gb|EFA08949.1|  hypothetical protein TcasGA2_TC006656                 49.3    1e-07   
ref|XP_458926.2|  DEHA2D10582p                                        48.5    1e-07   
gb|KGN60815.1|  hypothetical protein Csa_2G011480                     42.7    1e-07   
prf||1003191A  calmodulin                                             48.5    1e-07
ref|XP_011288132.1|  PREDICTED: calmodulin                            50.4    1e-07   
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...  42.7    1e-07   
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...  45.4    1e-07   
gb|EMT30278.1|  Calmodulin-like protein 5                             45.1    1e-07   
ref|XP_005242003.1|  PREDICTED: calmodulin                            50.1    1e-07   
gb|ELW54873.1|  F-box only protein 47                                 48.9    2e-07   
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    43.5    2e-07   
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg           41.2    2e-07   
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...  49.3    2e-07   
ref|XP_004897704.1|  PREDICTED: calmodulin-like protein 3             49.7    2e-07   
ref|XP_003758346.1|  PREDICTED: calmodulin-like                       50.1    2e-07   
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...  44.3    2e-07   
gb|EHJ76967.1|  putative calmodulin-A                                 48.9    2e-07   
ref|XP_005704341.1|  calmodulin isoform 1                             48.9    2e-07   
gb|AAB41135.1|  calmodulin                                            45.1    2e-07   
ref|XP_004336073.1|  Calmodulin, putative                             48.9    2e-07   
gb|AHA51313.1|  EF-hand_1 domain-containing protein                   48.9    2e-07   
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...  42.0    2e-07   
emb|CDY40786.1|  BnaAnng06490D                                        47.8    2e-07   
dbj|BAJ85572.1|  predicted protein                                    55.8    2e-07   
ref|XP_005605456.1|  PREDICTED: calmodulin                            49.7    2e-07   
ref|XP_004970312.1|  PREDICTED: calmodulin-3-like isoform X1          49.7    2e-07   
gb|KFY20747.1|  hypothetical protein V491_03461                       49.3    2e-07   
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  43.1    2e-07   
ref|XP_002520954.1|  calmodulin, putative                             52.4    2e-07   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                     51.2    2e-07   
gb|EZA53976.1|  Calmodulin                                            53.1    2e-07   
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg           47.4    2e-07   
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  41.6    2e-07   
gb|EHB00855.1|  Calmodulin                                            50.1    2e-07   
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g           48.9    2e-07   
gb|KIY52148.1|  calmodulin                                            49.3    2e-07   
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg              48.1    2e-07   
gb|EPY50961.1|  calmodulin Cam1                                       49.7    2e-07   
ref|XP_006122412.1|  PREDICTED: calmodulin                            49.7    2e-07   
gb|EPX74846.1|  calmodulin Cam1                                       49.7    2e-07   
ref|NP_593340.1|  calmodulin Cam1                                     49.7    2e-07   
ref|XP_004867156.1|  PREDICTED: calmodulin isoform X1                 50.4    2e-07   
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg              42.0    2e-07   
ref|XP_009611663.1|  PREDICTED: calmodulin-like protein 8             48.5    2e-07   
pdb|3U0K|A  Chain A, Crystal Structure Of The Genetically Encoded...  50.4    2e-07   
ref|XP_006088486.1|  PREDICTED: calmodulin-like protein 3             51.2    2e-07   
ref|XP_002420201.1|  CaM, putative; calmodulin, putative              48.1    2e-07   
ref|XP_004241038.1|  PREDICTED: calmodulin-like protein 8             48.5    2e-07   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...  49.3    2e-07   
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836           47.8    2e-07   
emb|CDO99124.1|  unnamed protein product                              47.4    2e-07   
gb|KHJ48498.1|  EF hand                                               47.0    2e-07   
ref|XP_011113630.1|  hypothetical protein H072_7905                   46.6    2e-07   
ref|XP_011339456.1|  PREDICTED: calmodulin isoform X2                 53.1    2e-07   
ref|XP_006350654.1|  PREDICTED: calmodulin-like protein 11-like       48.5    2e-07   
ref|NP_001270011.1|  calmodulin 2 (phosphorylase kinase, delta)       49.3    2e-07   
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8      46.2    2e-07   
ref|XP_009702107.1|  PREDICTED: calmodulin-like                       49.3    2e-07   
ref|XP_006839639.1|  PREDICTED: calmodulin                            49.7    2e-07   
ref|XP_007372997.1|  hypothetical protein SPAPADRAFT_58807            47.8    2e-07   
ref|XP_009048149.1|  hypothetical protein LOTGIDRAFT_148903           47.8    2e-07   
ref|XP_004970313.1|  PREDICTED: calmodulin-3-like isoform X2          49.7    2e-07   
ref|XP_001749021.1|  hypothetical protein                             47.4    2e-07   
ref|XP_711861.1|  likely calmodulin                                   48.1    2e-07   
ref|NP_001104289.1|  calmodulin                                       49.3    2e-07   
ref|XP_004196648.1|  Piso0_003872                                     47.8    2e-07   
gb|KDQ10734.1|  hypothetical protein BOTBODRAFT_190368                46.2    2e-07   
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  47.4    2e-07   
ref|XP_002593251.1|  hypothetical protein BRAFLDRAFT_115029           45.8    2e-07   
sp|P02595.2|CALM_PATSP  RecName: Full=Calmodulin; Short=CaM           49.3    2e-07   
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4             49.3    2e-07   
ref|XP_006095104.1|  PREDICTED: calmodulin-like                       47.8    3e-07   
ref|XP_011339455.1|  PREDICTED: calmodulin-like protein 5 isoform X1  52.4    3e-07   
ref|XP_003770562.1|  PREDICTED: calmodulin-like                       48.9    3e-07   
gb|ELK12789.1|  Calmodulin                                            49.3    3e-07   
ref|XP_009419782.1|  PREDICTED: calmodulin-like protein 11            44.7    3e-07   
ref|XP_392226.2|  PREDICTED: probable calcium-binding protein CML...  53.1    3e-07   
ref|XP_011055887.1|  PREDICTED: calmodulin isoform X2                 52.8    3e-07   
ref|XP_006568277.1|  PREDICTED: probable calcium-binding protein ...  53.1    3e-07   
ref|XP_010986526.1|  PREDICTED: calmodulin                            49.7    3e-07   
ref|XP_011339457.1|  PREDICTED: calmodulin isoform X3                 52.8    3e-07   
emb|CDP16307.1|  unnamed protein product                              44.7    3e-07   
sp|P62184.2|CALM_RENRE  RecName: Full=Calmodulin; Short=CaM           48.9    3e-07   
ref|NP_001146794.1|  uncharacterized protein LOC100280399             48.5    3e-07   
ref|XP_011055886.1|  PREDICTED: caltractin isoform X1                 52.8    3e-07   
emb|CAD41532.1|  OSJNBb0091E11.1                                      52.0    3e-07   
ref|XP_003689570.1|  PREDICTED: uncharacterized protein LOC100865094  53.1    3e-07   
gb|AEO16870.1|  G-GECO1.2                                             50.4    3e-07   
emb|CAH67730.1|  H0522A01.1                                           52.0    3e-07   
gb|ELV14138.1|  Calmodulin                                            48.9    3e-07   
prf||0711223A  calmodulin                                             48.9    3e-07
ref|XP_006568276.1|  PREDICTED: probable calcium-binding protein ...  52.8    3e-07   
emb|CEL63589.1|  Calmodulin OS=Agaricus bisporus PE=1 SV=2            45.8    3e-07   
gb|ABK26821.1|  unknown                                               44.3    3e-07   
ref|XP_011140004.1|  PREDICTED: calmodulin-like isoform X2            53.1    3e-07   
ref|XP_006609940.1|  PREDICTED: probable calcium-binding protein ...  53.1    3e-07   
ref|XP_006627766.1|  PREDICTED: calcium-binding protein 1-like        48.5    3e-07   
pdb|2K0J|A  Chain A, Solution Structure Of Cam Complexed To Drp1p     49.3    3e-07   
ref|XP_007162475.1|  hypothetical protein PHAVU_001G155400g           46.6    3e-07   
ref|XP_011467223.1|  PREDICTED: calcium-binding protein CML24-like    43.9    3e-07   
ref|XP_011055888.1|  PREDICTED: calmodulin isoform X3                 52.8    3e-07   
gb|AAG00262.1|AF089808_1  calmodulin                                  45.8    3e-07   
gb|AEO16868.1|  G-GECO1                                               50.1    3e-07   
ref|XP_006432945.1|  hypothetical protein CICLE_v10003695mg           47.4    3e-07   
pdb|4DJC|A  Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-...  48.9    3e-07   
ref|XP_003867318.1|  Cmd1 calmodulin                                  47.8    3e-07   
ref|XP_011140003.1|  PREDICTED: calmodulin-like protein 11 isofor...  52.8    3e-07   
gb|ABK26031.1|  unknown                                               44.3    3e-07   
ref|XP_008931196.1|  PREDICTED: calmodulin                            48.9    3e-07   
ref|XP_002430223.1|  calmodulin-A, putative                           48.9    3e-07   
ref|XP_011140005.1|  PREDICTED: calmodulin-like isoform X3            52.8    3e-07   
ref|NP_001127790.1|  calmodulin-like                                  52.8    3e-07   
ref|XP_004976061.1|  PREDICTED: probable calcium-binding protein ...  53.1    3e-07   
dbj|GAM17285.1|  hypothetical protein SAMD00019534_004600             48.5    3e-07   
ref|XP_007532277.1|  PREDICTED: calmodulin                            48.9    4e-07   
emb|CDQ64500.1|  unnamed protein product                              49.3    4e-07   
ref|XP_008835072.1|  PREDICTED: calmodulin-like protein 3             48.9    4e-07   
prf||0409298A  troponin C-like protein                                47.4    4e-07
ref|XP_005383080.1|  PREDICTED: calmodulin-like                       47.8    4e-07   
gb|KDO48936.1|  hypothetical protein CISIN_1g031616mg                 48.1    4e-07   
sp|O96102.3|CALM_PHYPO  RecName: Full=Calmodulin; Short=CaM           48.1    4e-07   
gb|AEO16869.1|  G-GECO1.1                                             50.4    4e-07   
ref|XP_011416012.1|  PREDICTED: calmodulin-A-like isoform X1          54.7    4e-07   
emb|CDX98375.1|  BnaC06g17360D                                        45.4    4e-07   
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...  43.1    4e-07   
ref|XP_009398373.1|  PREDICTED: calmodulin-like isoform X2            46.6    4e-07   
ref|XP_006652455.1|  PREDICTED: probable calcium-binding protein ...  52.8    4e-07   
ref|XP_006868502.1|  PREDICTED: calmodulin                            48.9    4e-07   
ref|XP_007599517.1|  calmodulin                                       47.8    4e-07   
emb|CDQ92434.1|  unnamed protein product                              49.3    4e-07   
gb|AFV80092.1|  calmodulin-like protein                               48.5    4e-07   
gb|EMT24894.1|  Putative calcium-binding protein CML22                55.5    4e-07   
gb|ABF21069.1|  mitochondrial calcium sensor cameleon 4mtD3cpv        49.7    4e-07   
ref|XP_004963110.1|  PREDICTED: calmodulin-like protein 5-like        47.4    4e-07   
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...  46.6    4e-07   
ref|XP_005869569.1|  PREDICTED: calmodulin-like protein 3             50.1    4e-07   
ref|XP_006471667.1|  PREDICTED: calmodulin-like protein 11-like       48.1    4e-07   
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         41.2    4e-07   
gb|EHB02604.1|  Calmodulin                                            49.3    4e-07   
gb|AEO16864.1|  GEM-GECO1                                             50.4    4e-07   
gb|ADP36946.1|  hypothetical protein                                  47.8    4e-07   
gb|ABD98034.1|  calmodulin                                            44.7    4e-07   
dbj|BAB32439.1|  calmodulin                                           47.4    4e-07   
ref|XP_009400065.1|  PREDICTED: neo-calmodulin-like                   45.1    4e-07   
gb|ETE70432.1|  Calmodulin                                            48.9    4e-07   
ref|XP_011073471.1|  PREDICTED: calmodulin-like protein 8             46.2    4e-07   
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                 48.5    4e-07   
gb|ACH46218.1|  putative calmodulin variant 1                         47.8    4e-07   
sp|Q39752.3|CALM_FAGSY  RecName: Full=Calmodulin; Short=CaM           49.7    4e-07   
gb|ELW48699.1|  Calmodulin                                            48.9    4e-07   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             48.5    4e-07   
gb|EEE62792.1|  hypothetical protein OsJ_17595                        43.1    4e-07   
ref|XP_011416014.1|  PREDICTED: calmodulin-A-like isoform X2          54.3    4e-07   
gb|EKC32559.1|  Calmodulin                                            54.7    4e-07   
gb|EYU41429.1|  hypothetical protein MIMGU_mgv1a021942mg              46.2    4e-07   
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11            47.4    4e-07   
ref|XP_006568278.1|  PREDICTED: probable calcium-binding protein ...  52.8    4e-07   
ref|XP_003393814.1|  PREDICTED: calmodulin-like                       52.8    4e-07   
gb|ADT61781.1|  calmodulin                                            48.9    4e-07   
ref|XP_011281779.1|  PREDICTED: calmodulin                            48.5    4e-07   
ref|XP_002593252.1|  hypothetical protein BRAFLDRAFT_124868           45.8    4e-07   
gb|EFX01025.1|  calmodulin                                            45.8    4e-07   
gb|AFQ60635.1|  Nano-lantern_Ca2+_CaM-4GS                             50.1    4e-07   
dbj|BAE89379.1|  unnamed protein product                              48.5    4e-07   
ref|XP_008557060.1|  PREDICTED: probable calcium-binding protein ...  54.7    4e-07   
ref|XP_003494757.1|  PREDICTED: calmodulin-like isoform 1             52.4    4e-07   
emb|CDX67796.1|  BnaA07g18360D                                        45.4    4e-07   
gb|AJE29627.1|  RA-CaM                                                48.5    4e-07   
gb|AFQ60634.1|  Nano-lantern_Ca2+_CaM-2GS                             50.1    4e-07   
ref|XP_004349444.1|  calmodulin                                       49.7    4e-07   
ref|XP_005383897.1|  PREDICTED: calmodulin-like protein 3 isoform X1  48.5    4e-07   
gb|AFQ60633.1|  Nano-lantern_Ca2+_CaM-2G                              50.1    4e-07   
ref|XP_011211821.1|  PREDICTED: uncharacterized calcium-binding p...  52.4    4e-07   
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...  46.6    4e-07   
ref|XP_003494758.1|  PREDICTED: calmodulin-like isoform 2             52.4    4e-07   
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  41.6    5e-07   
gb|KFX94087.1|  hypothetical protein V490_04534                       47.4    5e-07   
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        46.2    5e-07   
gb|KEH26932.1|  EF hand calcium-binding family protein                45.1    5e-07   
gb|KEQ72355.1|  EF-hand                                               47.4    5e-07   
ref|XP_011119385.1|  hypothetical protein AOL_s00043g597              46.2    5e-07   
ref|XP_010996006.1|  PREDICTED: calmodulin                            48.5    5e-07   
ref|XP_008557059.1|  PREDICTED: uncharacterized protein LOC103577...  54.3    5e-07   
ref|XP_001387021.1|  calmodulin                                       47.0    5e-07   
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...  46.6    5e-07   
ref|XP_004296596.1|  PREDICTED: calmodulin-like protein 11 isofor...  45.8    5e-07   
gb|ACG31559.1|  calmodulin                                            49.7    5e-07   
gb|EKC20234.1|  Calmodulin                                            48.5    5e-07   
ref|XP_002022003.1|  GL14408                                          54.3    5e-07   
ref|XP_011427009.1|  PREDICTED: calmodulin-A-like                     47.8    5e-07   
gb|KDP40249.1|  hypothetical protein JCGZ_02247                       45.8    5e-07   
gb|KFY44228.1|  hypothetical protein V495_03553                       47.4    5e-07   
gb|KIW95870.1|  calmodulin                                            47.0    5e-07   
ref|XP_003748509.1|  PREDICTED: calmodulin-like                       49.7    5e-07   
ref|XP_006852110.1|  hypothetical protein AMTR_s00049p00017460        49.7    5e-07   
ref|XP_006684309.1|  hypothetical protein CANTEDRAFT_118328           48.1    5e-07   
ref|XP_009104207.1|  PREDICTED: calmodulin-like protein 4             45.4    5e-07   
ref|XP_005354963.1|  PREDICTED: calmodulin-like protein 3             47.0    5e-07   
gb|KIW00695.1|  calmodulin                                            45.8    5e-07   
gb|ENN77948.1|  hypothetical protein YQE_05625                        48.5    5e-07   
emb|CAG10181.1|  unnamed protein product                              48.9    5e-07   
gb|AAC68889.1|  VU91A calmodulin                                      47.8    5e-07   
sp|P23286.2|CALM_CANAX  RecName: Full=Calmodulin; Short=CaM           48.1    5e-07   
gb|KJB38242.1|  hypothetical protein B456_006G243600                  46.2    5e-07   
ref|XP_005071796.1|  PREDICTED: calmodulin-like protein 3             47.0    5e-07   
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  45.8    5e-07   
gb|EUB64098.1|  Calmodulin                                            48.9    6e-07   
ref|XP_007208587.1|  hypothetical protein PRUPE_ppa023004mg           45.1    6e-07   
ref|XP_011176907.1|  PREDICTED: uncharacterized calcium-binding p...  52.4    6e-07   
gb|EHB13359.1|  Calmodulin                                            50.4    6e-07   
ref|XP_003494993.1|  PREDICTED: calmodulin-like protein 3             47.0    6e-07   
tpg|DAA13808.1|  TPA: calmodulin 2-like                               48.1    6e-07   
gb|AIB03828.1|  calmodulin                                            47.4    6e-07   
ref|XP_008516751.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin       48.1    6e-07   



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   131 bits (329),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  353
            G+KKP G +TPTSVLP L++EIS DE S +    YAELVQAF +ID D DGKIRKEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEA  103

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLE
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLE  136


 Score = 79.0 bits (193),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  + SAF PPSCD ELRDAFDFFD DHDG I+AEELFNVF+TI
Sbjct  129  GDGCISL--EEFGAIRSAFGPPSCDGELRDAFDFFDADHDGMITAEELFNVFRTI  181



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   127 bits (319),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 4/93 (4%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  353
            G+KKP G +TPTSVLP L++EIS D+ S +    YAELVQAF +ID D DGKI KEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEA  103

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLE
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLE  136


 Score = 80.1 bits (196),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  +SSAF PPSCD ELRD FDFFD DHDGKI+AE+LFNVF+TI
Sbjct  129  GDGCISL--EEFGAISSAFGPPSCDGELRDVFDFFDADHDGKITAEKLFNVFRTI  181



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   121 bits (304),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEA  353
            G KKP G STPTSVLP L+ +IS +E S     +Y EL QAF++IDRD DGKI+KEELEA
Sbjct  44   GSKKPNGLSTPTSVLPTLSADISAEEWSEISADVYFELKQAFEMIDRDGDGKIKKEELEA  103

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            LL ++GAEPP++EEL+LMLS+VDRDGDGCI+LE
Sbjct  104  LLCRLGAEPPNQEELQLMLSDVDRDGDGCITLE  136


 Score = 76.6 bits (187),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + SAFAPP+CD ELRD FDFFD+D DGKI+AEELFNVFKTI
Sbjct  137  EFYAIGSAFAPPTCDMELRDTFDFFDSDRDGKITAEELFNVFKTI  181



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   124 bits (311),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEA  353
            G+KKP G STPTSVLP+L+ EISP+E     + +Y EL QAF++IDRD DGKI+KEELE 
Sbjct  44   GFKKPTGLSTPTSVLPSLSAEISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEG  103

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            LL ++G EPP +EEL+LML+EVDRDGDGCISLE
Sbjct  104  LLCRLGPEPPCQEELKLMLTEVDRDGDGCISLE  136


 Score = 73.2 bits (178),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  + SAFAPP+ D ELRDAFDFFD+D DGKI+AEEL NVFKTI
Sbjct  129  GDGCISLE--EFYAIGSAFAPPARDGELRDAFDFFDSDRDGKITAEELLNVFKTI  181



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   110 bits (276),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 5/89 (6%)
 Frame = +3

Query  201  GGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  +TPTSVLP  L+ EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELEALLS+
Sbjct  66   GSPATPTSVLPPTLSSEITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSR  125

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            VGAEPPS EEL ++LSEVDRDGDGCISLE
Sbjct  126  VGAEPPSAEELNMLLSEVDRDGDGCISLE  154


 Score = 80.9 bits (198),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  + SAF PPSCDSE+RDAFDFFDTDHDG+I+AEEL+NVF+ I
Sbjct  147  GDGCISL--EEFEAIGSAFGPPSCDSEMRDAFDFFDTDHDGRITAEELYNVFRVI  199



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   107 bits (268),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 6/89 (7%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G+KKP G +TPTSVLP    EIS DE    ++E++QAF +ID D DGKIRKE+LEA+L++
Sbjct  44   GFKKPNGLATPTSVLPP--SEISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            VG +PPS EEL  +L+EVDR+GDGCISLE
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLE  126


 Score = 79.7 bits (195),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  +SSAF PP+CD ELR+AFDFFD DHDGKI+AEELFNVF+TI
Sbjct  119  GDGCISL--EEFGAISSAFGPPACDDELRNAFDFFDADHDGKITAEELFNVFRTI  171



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   114 bits (285),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 5/93 (5%)
 Frame = +3

Query  189  YKKPGGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEA  353
            +KKP G STPTSVLP A + EIS +E S     +Y +L QAF++IDRD DGK+ K ELE 
Sbjct  47   FKKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELED  106

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            LL  +GA+PPSREELRLMLSEVDRDGDGCI+LE
Sbjct  107  LLCGLGADPPSREELRLMLSEVDRDGDGCITLE  139


 Score = 72.0 bits (175),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + SAFAPP+CD+E+R+ FDFFD+D DGKI+AEELF VF+TI
Sbjct  140  EFHSIGSAFAPPTCDTEMRETFDFFDSDRDGKITAEELFGVFRTI  184



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   110 bits (274),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 9/84 (11%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG STPTSVLP+ +D         L +EL QAF++IDRD DGKI+KEELE LLS++GAEP
Sbjct  44   GGLSTPTSVLPSADD---------LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEP  94

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
            PS+EEL+LM+SEVDRDGDGCISLE
Sbjct  95   PSQEELKLMVSEVDRDGDGCISLE  118


 Score = 71.6 bits (174),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  + SAFAPP+CD ELR  FDFFD+D DGKI+AEELF VF+TI
Sbjct  111  GDGCISL--EEFYAIGSAFAPPTCDGELRSTFDFFDSDRDGKITAEELFRVFETI  163



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   103 bits (257),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 71/89 (80%), Gaps = 6/89 (7%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G++KP G +TPTSVLP   ++IS DE    ++E++QAF +ID   DGKIRKE+LEA+L++
Sbjct  44   GFQKPNGLATPTSVLPP--NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            VG +PPS EEL  +L+EVDR+GDGCISLE
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLE  126


 Score = 78.2 bits (191),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  +SSAF PP+CD ELR+AFDFFD +HDGKI+AEELFNVF+TI
Sbjct  119  GDGCISL--EEFGAISSAFGPPACDDELRNAFDFFDANHDGKITAEELFNVFRTI  171



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   102 bits (254),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 5/89 (6%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G++KP G STPTSVLP   +EIS  E+  +YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  41   GFRKPTGSSTPTSVLP---NEISAAEV--VYAELIHAFHMMDTDGDGKIRKEELEAILSR  95

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            VG EPPS+EEL L+L EVD DGDGCISL+
Sbjct  96   VGTEPPSKEELMLLLEEVDVDGDGCISLQ  124


 Score = 77.8 bits (190),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L  +EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+A+ELF+VF+ I
Sbjct  117  GDGCISL--QEFGAISSAFGPPACDSELRDAFDFFDADHDGKITADELFSVFRQI  169


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +  E
Sbjct  140  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFE  197



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score = 99.4 bits (246),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 5/89 (6%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G+ KP G STPTSVLP   +EIS  E+   YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  43   GFSKPTGSSTPTSVLP---NEISAAEVG--YAELIHAFHMMDTDGDGKIRKEELEAILSR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            VG EPPS+EEL L+L EVD +GDGCISL+
Sbjct  98   VGTEPPSKEELMLLLEEVDVNGDGCISLQ  126


 Score = 77.8 bits (190),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L  +EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+A+ELF+VF+ I
Sbjct  119  GDGCISL--QEFGAISSAFGPPACDSELRDAFDFFDADHDGKITADELFSVFRQI  171


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 7/70 (10%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG-------  437
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG       
Sbjct  142  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDF  201

Query  438  CISLEGVQRA  467
            C+ +E  QR 
Sbjct  202  CVMMEQQQRC  211



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score = 89.4 bits (220),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  225  VLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  401
            VLP+ N +  P E+S  +Y+ELVQAF++ID D DGKI KEEL A+L++VG++PP+ EEL 
Sbjct  81   VLPSTNTQW-PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELV  139

Query  402  LMLSEVDRDGDGCISLE  452
             +L+EVD +GDGCISL+
Sbjct  140  QLLNEVDVNGDGCISLQ  156


 Score = 79.7 bits (195),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L  +EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+TI
Sbjct  149  GDGCISL--QEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRTI  201



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   105 bits (263),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +3

Query  216  PTSVLPALNDEIS---PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  386
            PTSVLP  + EIS    D  S +  ELV AFK+IDRD DGKI K ELEALLS+VG EPPS
Sbjct  59   PTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPS  118

Query  387  REELRLMLSEVDRDGDGCISLE  452
             EE+ +MLSEVDRDGDGCISLE
Sbjct  119  EEEIMMMLSEVDRDGDGCISLE  140


 Score = 61.6 bits (148),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  +SSAF P +CD+ELRDAF FFDTD DGKI+AEEL  VF  I
Sbjct  133  GDGCISL--EEFGAISSAFGP-ACDTELRDAFCFFDTDRDGKITAEELNQVFAAI  184



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score = 84.7 bits (208),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  404
            VLP+   +   +  + +Y+ELVQAF++ID D DGKI KEE+ A+L++VG++PP+ EEL  
Sbjct  47   VLPSTTTQWPSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQ  106

Query  405  MLSEVDRDGDGCISLE  452
            +L+EVD +GDGCISL+
Sbjct  107  LLNEVDVNGDGCISLQ  122


 Score = 80.1 bits (196),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L  +EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+TI
Sbjct  115  GDGCISL--QEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRTI  167



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   102 bits (254),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 9/92 (10%)
 Frame = +3

Query  204  GESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEELEALL  359
            G STPTSVLP  L++EIS D+ S       G+Y++LVQAF LID D DGKIRKE+LEA+L
Sbjct  45   GISTPTSVLPTTLSNEISADDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAIL  104

Query  360  SQVGAE-PPSREELRLMLSEVDRDGDGCISLE  452
            S+VG + PPS EEL  +L+EVD++GDGCISLE
Sbjct  105  SRVGGKSPPSEEELISLLNEVDKNGDGCISLE  136


 Score = 60.1 bits (144),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 8/61 (13%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPS------CDSELRDAFDFFDTDHDGKISAEELFNVFKT  585
            G   ++L   +F ++SSAF  P          E+RDAFDFFD DHDGKI+AEELFNVF+ 
Sbjct  129  GDGCISL--EDFGIISSAFELPEEMTAEDGGDEMRDAFDFFDADHDGKITAEELFNVFRM  186

Query  586  I  588
            I
Sbjct  187  I  187



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   102 bits (254),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  YKKPGGESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEE  344
            +K   G STPTSVLP  L++EIS ++ S       G+Y++LVQAF LID D DGKIRKE+
Sbjct  40   HKPYNGLSTPTSVLPTTLSNEISAEDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQ  99

Query  345  LEALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLE  452
            LEA+LS+VG + PPS EEL  +L+EVD++GDGCISLE
Sbjct  100  LEAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLE  136


 Score = 59.7 bits (143),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 8/61 (13%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDS------ELRDAFDFFDTDHDGKISAEELFNVFKT  585
            G   ++L   +F ++SSAF      +      E+RDAFDFFDTDHDGKI+AEELFNVF+ 
Sbjct  129  GDGCISL--EDFGIISSAFELTEATTAEDGGDEMRDAFDFFDTDHDGKITAEELFNVFRM  186

Query  586  I  588
            I
Sbjct  187  I  187



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score = 93.2 bits (230),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIRTPTSVLPERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  381  PSREELRLMLSEVDRDGDGCISLEGV  458
            PS+EE+ LMLSEVDR+G+G I+L+ +
Sbjct  123  PSQEEVMLMLSEVDREGNGSITLDAL  148


 Score = 58.5 bits (140),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ DSELRDAF  FD+DHDGKISAEELFNVF  I
Sbjct  158  PAADSELRDAFKVFDSDHDGKISAEELFNVFTAI  191


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +3

Query  207  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  386
            E   +  L AL + + P       +EL  AFK+ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAEELFNVFTAIGDDRCT  197

Query  387  REELRLMLSEVDRDGDGCISLEGVQR  464
             E+ R M++ VD++GDG +  E   R
Sbjct  198  LEDCRRMIAGVDKNGDGFVCFEDFAR  223



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score =   100 bits (249),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            TPTSVLP ++ + S D  +  Y++LVQAFKLIDRD+DG + + ELEALLS++GAEPPS+E
Sbjct  58   TPTSVLPEISGDWS-DISTDFYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQE  116

Query  393  ELRLMLSEVDRDGDGCISLEGV  458
            E+  MLSEVD  GDGCIS+E +
Sbjct  117  EVATMLSEVDHVGDGCISVEAL  138


 Score = 50.4 bits (119),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ D ELR AF+FFD D DGKI+AEELF V+K I
Sbjct  148  PAGDDELRVAFEFFDADQDGKITAEELFGVYKAI  181



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   100 bits (248),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 4/90 (4%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPD----ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  362
            K GG +TP SVL + + EIS D      +  + E +QAFKLIDRD DGK+   ELE LLS
Sbjct  47   KGGGGATPKSVLRSCSQEISGDWSDLSAANTHLEHLQAFKLIDRDGDGKVTIHELEGLLS  106

Query  363  QVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            ++G EPPS+EE+ LML+E+D+DGDGCISLE
Sbjct  107  RIGGEPPSKEEMLLMLTEIDQDGDGCISLE  136


 Score = 49.7 bits (117),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  +SS+  P +  S+LR+AF+ FD D DGKISAEEL  VF  I
Sbjct  137  EFEAISSSLVPAAL-SDLREAFNVFDADRDGKISAEELLGVFSAI  180


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +3

Query  228  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  407
              A++  + P  LS    +L +AF + D D DGKI  EEL  + S +G +  + E+ R M
Sbjct  138  FEAISSSLVPAALS----DLREAFNVFDADRDGKISAEELLGVFSAIGDDRCTLEDCRRM  193

Query  408  LSEVDRDGDGCISLEGVQR  464
            +  VD +GDG +  E   R
Sbjct  194  IRSVDTNGDGFVCFEDFSR  212



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score = 91.7 bits (226),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            + GG  TPTSVL   + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA
Sbjct  62   EAGGIGTPTSVLLERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGA  120

Query  375  EPPSREELRLMLSEVDRDGDGCISLEGV  458
            +PPS+EE+ LMLSEVDR+G+G ISLE +
Sbjct  121  DPPSQEEVMLMLSEVDREGNGSISLEAL  148


 Score = 58.2 bits (139),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ DSELRDAF+ FD+DHDGKISAEEL NVF  I
Sbjct  158  PAADSELRDAFEVFDSDHDGKISAEELLNVFTAI  191


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            +EL  AF++ D D DGKI  EEL  + + +G +  + E+ R M++ VD++GDG +  E  
Sbjct  162  SELRDAFEVFDSDHDGKISAEELLNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDF  221

Query  459  QR  464
             R
Sbjct  222  AR  223



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score = 96.3 bits (238),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  381  PSREELRLMLSEVDRDGDGCISLEGV  458
            P+ EE+ LMLSEVD DG GCIS+E +
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETI  131


 Score = 48.9 bits (115),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ + ELR+AF+ FDTD DG+ISAEEL  VF+ I
Sbjct  145  PNPEEELREAFEVFDTDRDGRISAEELLRVFRAI  178



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score = 96.3 bits (238),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  381  PSREELRLMLSEVDRDGDGCISLEGV  458
            P+ EE+ LMLSEVD DG GCIS+E +
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETI  131


 Score = 48.9 bits (115),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ + ELR+AF+ FDTD DG+ISAEEL  VF+ I
Sbjct  145  PNPEEELREAFEVFDTDRDGRISAEELLRVFRAI  178



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score = 89.0 bits (219),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 9/91 (10%)
 Frame = +3

Query  192  KKPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  368
             KPGG  +TPTSVLP    E S         ++ QAF+LIDRD+DG + + ELEALL ++
Sbjct  46   HKPGGPAATPTSVLPGDWSEFS-------SVDMAQAFRLIDRDNDGVVSRTELEALLKRL  98

Query  369  -GAEPPSREELRLMLSEVDRDGDGCISLEGV  458
             GAEPP++EE+ +MLSEVD DGDGCI LE +
Sbjct  99   LGAEPPTQEEVAMMLSEVDGDGDGCIPLEAL  129


 Score = 55.1 bits (131),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +1

Query  457  FSVLSSAFAP---PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
               L   F P   P+ DSELR+AF+ FDTDHDGKISAEEL +VF  I
Sbjct  126  LEALLHRFGPGCEPAADSELREAFEVFDTDHDGKISAEELLSVFTAI  172


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            +EL +AF++ D D DGKI  EEL ++ + +G E  + EE R M++EVD++GDG +  +  
Sbjct  143  SELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDF  202

Query  459  QR  464
             R
Sbjct  203  AR  204



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score = 97.4 bits (241),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            KPG  +TP SVLP  +D        G Y+EL+QAFKLIDRDDDG + + +L ALLS++  
Sbjct  51   KPGPAATPISVLPGDHD--------GFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSP  102

Query  375  EPPSREELRLMLSEVDRDGDGCISLE  452
            EPPS+EE+ LML EVD  GDGCISLE
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLE  128


 Score = 46.6 bits (109),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 5/46 (11%)
 Frame = +1

Query  466  LSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+S  A  S DS     E+R+ F+FFD DHDG+ISAEEL  VF  I
Sbjct  130  LASRVAGTSSDSDEGSVEMREVFEFFDVDHDGRISAEELHRVFGVI  175



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score = 90.5 bits (223),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 7/86 (8%)
 Frame = +3

Query  204  GESTPTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            G  TPTSVLP    E S D L   +  Y EL QAFK +D+D+DG I + E+EALLS+   
Sbjct  61   GTGTPTSVLP----ETSVDWLDFSANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFAR  116

Query  375  EPPSREELRLMLSEVDRDGDGCISLE  452
            +PPS+EE+  ML EVD DGDGCISLE
Sbjct  117  QPPSQEEISSMLGEVDGDGDGCISLE  142


 Score = 53.1 bits (126),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
               L +  A P+C+ ELR+ FD FDTDHDGKI+AEEL   +K
Sbjct  141  LETLINQVAGPACEPELRETFDIFDTDHDGKITAEELMAFYK  182


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            EL + F + D D DGKI  EEL A   + +G E  + E+ RLM++ VD++GDG +  +  
Sbjct  156  ELRETFDIFDTDHDGKITAEELMAFYKEKLGDERCTLEDCRLMIASVDKNGDGFVCFDDF  215

Query  459  QR  464
             R
Sbjct  216  SR  217



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score = 89.0 bits (219),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG +TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALL ++G  P
Sbjct  128  GGITTPTSVLPEKSGDWS-DFSADL--DMAQAFKLIDRDNDGVVSRKELEALLCRLGNAP  184

Query  381  PSREELRLMLSEVDRDGDGCISLEGV  458
            PS+EE+ LMLSEVDRDG+G I+LE +
Sbjct  185  PSQEEVTLMLSEVDRDGNGSITLEAL  210


 Score = 53.9 bits (128),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ DSELRDAF+ FDTD+DGKISAEEL  VF  I
Sbjct  220  PAADSELRDAFEVFDTDNDGKISAEELLRVFTAI  253


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  404
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  206  TLEALLNQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  265

Query  405  MLSEVDRDGDGCISLE  452
            M+  VD+DGDG +  E
Sbjct  266  MIDGVDKDGDGFVCFE  281



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score = 90.1 bits (222),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  377
            GG +TPTSVL   + + S  E S  L  ++ +AFKLIDRD+DG + ++ELEALL Q+G  
Sbjct  116  GGVTTPTSVLAERSGDWS--EFSADLQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNN  173

Query  378  PPSREELRLMLSEVDRDGDGCISLEGV  458
            PPS+EE+ LMLSEVDRDG G I+LE +
Sbjct  174  PPSQEEVTLMLSEVDRDGSGSITLEAL  200


 Score = 52.8 bits (125),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P  DSELRDAF+ FDTD+DGKISAEEL  VF  I
Sbjct  210  PPADSELRDAFEVFDTDNDGKISAEELLRVFTAI  243


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  404
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  196  TLEALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  255

Query  405  MLSEVDRDGDGCISLE  452
            M++EVD++GDG +  E
Sbjct  256  MIAEVDKNGDGFVCFE  271



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score = 90.9 bits (224),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 7/88 (8%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAEL--VQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            GG +TPTSVLP    E S D  S   A+L   QAFKLIDRD+DG + ++ELEALLS++G 
Sbjct  57   GGIATPTSVLP----EKSGD-WSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLSRLGN  111

Query  375  EPPSREELRLMLSEVDRDGDGCISLEGV  458
            +PPS+EE+ LMLSEVDRDG+G I+LE +
Sbjct  112  DPPSQEEVTLMLSEVDRDGNGSITLEAL  139


 Score = 51.6 bits (122),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ DSELRDAF+  DTD+DGKISAEEL  VF  I
Sbjct  149  PAADSELRDAFEVXDTDNDGKISAEELLRVFTAI  182


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  404
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  135  TLEALLNQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRR  194

Query  405  MLSEVDRDGDGCISLE  452
            M+  VD+DGDG +  E
Sbjct  195  MIDGVDKDGDGFVCFE  210



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score = 95.1 bits (235),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 60/86 (70%), Gaps = 9/86 (10%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            KPG  +TP SVLP   D          Y+EL+QAFKLIDRDDDG + ++EL ALLS +  
Sbjct  50   KPGPAATPVSVLPGEQD---------FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSP  100

Query  375  EPPSREELRLMLSEVDRDGDGCISLE  452
            EPPS+EE+ LML EVD  GDGCISLE
Sbjct  101  EPPSQEEVTLMLQEVDGGGDGCISLE  126


 Score = 46.2 bits (108),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 5/46 (11%)
 Frame = +1

Query  466  LSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+S  A  S DS     E+R+ F+FFD DHDG+ISAEEL  VF  I
Sbjct  128  LASRVAGTSSDSDEGSVEMREVFEFFDLDHDGRISAEELHRVFGVI  173



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            KPG  +TP SVLP  + +         Y+EL+QAFKLIDRDDDG + ++EL ALLS++  
Sbjct  51   KPGPAATPVSVLPGGDQD--------FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSP  102

Query  375  EPPSREELRLMLSEVDRDGDGCISLE  452
            EPPS+EE+ LML EVD  GDGCISLE
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLE  128


 Score = 45.4 bits (106),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E+R+ F+FFD DHDG+ISAEEL  VF  I
Sbjct  147  EMREVFEFFDVDHDGRISAEELHRVFGVI  175



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score = 75.5 bits (184),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  DDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            D DGKI K ELEALLS+VG EPPS EE+ +MLSEVDRDGDGCISLE
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLE  93


 Score = 62.0 bits (149),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L   EF  +SSAF P +CD+ELRDAF FFDTD DGKI+AEEL  VF  I
Sbjct  86   GDGCISL--EEFGAISSAFGP-ACDTELRDAFCFFDTDRDGKITAEELNQVFAAI  137


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
             EL  AF   D D DGKI  EEL  + + +G +  + E+ + M++ VD++GDG +  E  
Sbjct  108  TELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDF  167

Query  459  QR  464
             R
Sbjct  168  SR  169



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score = 82.8 bits (203),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 5/82 (6%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            TP SVLP L+ + S D  S  ++ELVQAFKL+D D+DG + + +LE+LL ++GAE    E
Sbjct  53   TPPSVLPDLSGDWS-DVSSDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----E  107

Query  393  ELRLMLSEVDRDGDGCISLEGV  458
            E+  MLSEVDRDGDGCIS+E +
Sbjct  108  EVATMLSEVDRDGDGCISVEAL  129


 Score = 54.3 bits (129),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 4/45 (9%)
 Frame = +1

Query  466  LSSAFAPPSC----DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L S    P+C    D ELR AF+FFDTDHDGKI+AEEL  V+K I
Sbjct  129  LMSRIGGPACEPAGDDELRVAFEFFDTDHDGKITAEELMGVYKAI  173



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score = 92.4 bits (228),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 14/93 (15%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEA  353
            G +KP   STPTSV+P         E+SG     Y ELVQAFKLIDRDDDG + + EL A
Sbjct  50   GDRKPSPASTPTSVIP---------EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAA  100

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +L ++  EPPS EE+R+ML EVD  GDGCISLE
Sbjct  101  VLRRLSPEPPSEEEVRMMLREVD-GGDGCISLE  132


 Score = 44.3 bits (103),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +1

Query  442  LASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            LASR     +SA        ELR+ F+FFD D DG+ISAEEL  VF  I
Sbjct  134  LASRVAG--TSATGSSVEKGELREVFEFFDADRDGRISAEELLRVFGVI  180



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score = 81.3 bits (199),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +3

Query  213  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  383
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  384  SREELRLMLSEVDRDGDGCISLEGV  458
            ++EE++ MLSEVDR+GDG I LE +
Sbjct  115  TQEEVKSMLSEVDREGDGYIPLEAL  139


 Score = 54.3 bits (129),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             S + ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +
Sbjct  140  ISRVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKL  183



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score = 82.8 bits (203),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +3

Query  222  SVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  398
            SVLP  + E S  E S  L  ++ QAFK IDRD+DG + ++ELEALL ++G +P SREE+
Sbjct  65   SVLPERSGEWS--EFSADLQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEV  122

Query  399  RLMLSEVDRDGDGCISLEGV  458
             LMLSEVDRDG+G ISLE V
Sbjct  123  TLMLSEVDRDGNGSISLEAV  142


 Score = 52.8 bits (125),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ DSELRDAF+ FDTD+DGKISAEEL + F+ I
Sbjct  152  PAADSELRDAFEVFDTDNDGKISAEELLSFFRAI  185



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score = 80.9 bits (198),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  213  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  383
            TPTSVL  ++    ++S D    L  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  384  SREELRLMLSEVDRDGDGCISLEGV  458
            ++EE+  MLSEVDR+GDG I LE +
Sbjct  115  TQEEVSSMLSEVDREGDGYIPLEAL  139


 Score = 54.3 bits (129),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             S + ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +
Sbjct  140  ISRVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKL  183



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score = 81.6 bits (200),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  381  PSREELRLMLSEVD  422
            PS +E+ +ML EVD
Sbjct  115  PSSQEMAVMLGEVD  128


 Score = 51.6 bits (122),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +1

Query  442  LASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
            LASR    L SA  P   D ELRDAF FFD+D DGKI+AEEL NV+K
Sbjct  135  LASR----LGSACEPAGGD-ELRDAFVFFDSDRDGKITAEELLNVYK  176



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score = 80.1 bits (196),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  381  PSREELRLMLSEVDR  425
            PS EE+ +ML E D 
Sbjct  115  PSSEEMAVMLGERDH  129


 Score = 52.4 bits (124),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = +1

Query  439  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
            ALASR    L SA   P+ D ELRDAF FFD+D DG+I+AEEL NV+K
Sbjct  134  ALASR----LGSA-CEPAGDDELRDAFVFFDSDRDGRITAEELLNVYK  176



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score = 89.7 bits (221),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +3

Query  192  KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  359
            +KP   STP SVLP ++ + S  ++S      YAELVQAFKLIDRDDDG + + EL ALL
Sbjct  51   RKPDPASTPISVLPEISGDWS--QISAGDRDFYAELVQAFKLIDRDDDGMVSRSELAALL  108

Query  360  SQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            S++  +PPS+EE+ +ML  VD   DGCISLE
Sbjct  109  SRLSPDPPSQEEVSMMLRVVDGGDDGCISLE  139


 Score = 42.4 bits (98),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ELR+ F FFD D DG+ISAEEL  VF  I
Sbjct  157  GELREVFGFFDADRDGRISAEELHRVFAVI  186



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score = 80.5 bits (197),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = +3

Query  204  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  383
            G  TPTS+LP ++ + + D  + LY EL QAFKLIDRD+DG + + ELEALL+++GAEPP
Sbjct  54   GFRTPTSILPQVSGDWT-DISADLYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPP  112

Query  384  SREELRLMLSEVDRDGDGCISLEGV  458
            S EE+ ++L EVD      IS+E +
Sbjct  113  SSEEMAVILGEVDH-----ISVEAL  132


 Score = 51.2 bits (121),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = +1

Query  439  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
            ALASR    L +A   P+ D ELRDAF FFD+D DGKI+A+EL NV+K
Sbjct  131  ALASR----LGTA-CEPAGDDELRDAFVFFDSDRDGKITADELLNVYK  173



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score = 81.6 bits (200),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTSVLP ++ + S D    +  EL QAF+LIDRD+DG + +EELE +L+++GA  
Sbjct  52   GGSQTPTSVLPEISGDWS-DVTVDVQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA  110

Query  381  PSREELRLMLSEVDRDGDGCISLEGV  458
               EE+ +ML+EVD DG GCIS+E +
Sbjct  111  ---EEIAIMLTEVDGDGRGCISVEAI  133


 Score = 49.7 bits (117),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+ + ELR+AF+ FDTD DG+ISAEEL  VFK I
Sbjct  143  PNPEEELREAFEVFDTDRDGRISAEELLRVFKAI  176



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score = 77.8 bits (190),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = +3

Query  213  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  383
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  384  SREELRLMLSEVDRDGDG  437
            ++EE++ MLSEVDR+GDG
Sbjct  115  TQEEVKSMLSEVDREGDG  132


 Score = 53.1 bits (126),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+C+ EL++ FDFFD DHDGKI+AEELF VF  +
Sbjct  141  PACEPELKETFDFFDADHDGKITAEELFGVFTKL  174



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score = 88.6 bits (218),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 10/89 (11%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + ++EL ALLS+
Sbjct  42   GNLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKELAALLSR  93

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS+EE+ +ML EV  D DGCISLE
Sbjct  94   LSPEPPSQEEVSMMLREV--DADGCISLE  120


 Score = 42.4 bits (98),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E+R+ F+FFD D DG+ISAEEL  VF  I
Sbjct  140  EMREVFEFFDADRDGRISAEELHRVFGVI  168



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score = 87.8 bits (216),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  50   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  105

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
            P+ EE+ +ML EVD DGDG I LE
Sbjct  106  PTEEEIDVMLKEVDCDGDGTIRLE  129


 Score = 42.4 bits (98),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EL++ F+FFD D DGKISAEEL  VF  I
Sbjct  152  ELKETFEFFDADRDGKISAEELLRVFSAI  180



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score = 87.0 bits (214),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYA--ELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
             G  TPTSVLP ++ + +  + S  Y+  ELVQAFKLID+D+DG + +++LEALLS++G 
Sbjct  46   AGTVTPTSVLPEVSGDFAAVDASYPYSYLELVQAFKLIDKDNDGAVSRQDLEALLSRLGP  105

Query  375  EPPSREELRLMLSEVDRDGDGCISLEGV  458
            +P S+EE+ +ML ++DRDGDG I LE +
Sbjct  106  DPLSQEEIDVMLGDLDRDGDGAIRLEAL  133


 Score = 43.1 bits (100),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 4/50 (8%)
 Frame = +1

Query  439  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ALASR    + SA       +ELR+ F+FFD D DG ISAEEL  VF +I
Sbjct  132  ALASR----VVSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASI  177


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +3

Query  249  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  428
            +S  +LS   AEL + F+  D D DG I  EEL  + + +G E  + E+ R M++ VD D
Sbjct  138  VSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDED  197

Query  429  GDGCISL  449
            GDG +  
Sbjct  198  GDGFVCF  204



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score = 77.4 bits (189),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%), Gaps = 5/90 (6%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ---VG  371
            GG  TPTSVLP ++ ++S D  + +++EL +AFKLIDRD+DG + ++ELEALLS+   VG
Sbjct  58   GGSVTPTSVLPEISGDLS-DFSADIHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVG  116

Query  372  AEPPSREELRLMLSEVD-RDGDGCISLEGV  458
            +   S + +  MLSEVD  DG+GCIS+E +
Sbjct  117  SISESEDFVASMLSEVDGGDGEGCISVEAL  146


 Score = 52.4 bits (124),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = +1

Query  439  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            AL SR   V S+A   P+ DSELR+AFDFFDTD DG+I+A+EL + F  I
Sbjct  145  ALMSR---VGSAAACEPAGDSELREAFDFFDTDRDGRITADELHSFFTAI  191



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score = 86.7 bits (213),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
            P+ EE+ +ML EVD DGDG + LE
Sbjct  101  PTEEEIDVMLREVDCDGDGTVRLE  124


 Score = 42.4 bits (98),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EL++ F+FFD D DGKISAEEL  VF  I
Sbjct  142  ELKETFEFFDADRDGKISAEELLRVFSAI  170



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score = 86.7 bits (213),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 59/89 (66%), Gaps = 10/89 (11%)
 Frame = +3

Query  195  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  371
            KP G  +TP SVLP       P      Y ELVQAFKLIDRDDDG + + +L ALLS++ 
Sbjct  51   KPAGPTATPISVLP-------PQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLS  103

Query  372  AEPPSREELRLMLSEVDRDGD--GCISLE  452
             EPPS+EE+ LML EVD D D  GCISLE
Sbjct  104  PEPPSQEEVSLMLKEVDGDNDDGGCISLE  132


 Score = 42.0 bits (97),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F++FD D +GKISAEEL  VF  I
Sbjct  151  ELREVFEYFDADRNGKISAEELHRVFGVI  179



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score = 82.8 bits (203),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            KPG  +TP SVLP  + + S  ++SG    Y++L+QAFKLIDRDDDG + + +L ALLS+
Sbjct  50   KPGPAATPVSVLPENSGDWS--QISGDRDFYSDLIQAFKLIDRDDDGVVSRGDLAALLSR  107

Query  366  VGAEPPSREELRLMLSEVD-RDGDGCISLE  452
            +  +PPS+EE+ LML EVD  +  GCISLE
Sbjct  108  LSPDPPSQEEVSLMLREVDGGEESGCISLE  137


 Score = 45.4 bits (106),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 4/50 (8%)
 Frame = +1

Query  442  LASREFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            LASR   V  S+    S ++E +R+ F+FFD D DGKISAEEL+ VF  I
Sbjct  139  LASR---VAGSSSGEGSVETEEMREVFEFFDADRDGKISAEELYRVFGVI  185



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score = 85.5 bits (210),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
            P+ EE+ +ML EV+ DGDG + LE
Sbjct  101  PTEEEIDVMLKEVNCDGDGTVRLE  124


 Score = 42.4 bits (98),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EL++ F+FFD D DGKISAEEL  VF  I
Sbjct  142  ELKETFEFFDADRDGKISAEELLRVFSAI  170



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score = 81.6 bits (200),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +3

Query  198  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  368
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  369  GAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            GA+PP++EE++ MLSEVDR+GDG I LE +
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEAL  139


 Score = 46.2 bits (108),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            S L++ FDFFD DHDGKI+AEELF VF  +
Sbjct  141  SRLKETFDFFDADHDGKITAEELFGVFTKL  170


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +3

Query  264  LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  443
            L  L + L + F   D D DGKI  EEL  + +++G E  + ++ R M++ VD++GDG +
Sbjct  136  LEALISRLKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFV  195

Query  444  SLEGVQR  464
              E   R
Sbjct  196  CFEDFSR  202



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score = 85.5 bits (210),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 10/89 (11%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS EE+ +ML EV  D DGCISLE
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLE  120


 Score = 42.4 bits (98),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E+R+ F+FFD D DG+ISAEEL  VF  I
Sbjct  140  EMREVFEFFDADRDGRISAEELHRVFGVI  168



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score = 85.1 bits (209),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 10/89 (11%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS EE+ +ML EV  D DGCISLE
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLE  120


 Score = 42.4 bits (98),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E+R+ F+FFD D DG+ISAEEL  VF  I
Sbjct  140  EMREVFEFFDADRDGRISAEELHRVFGVI  168



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score = 77.0 bits (188),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  204  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  383
            G  TPTS+LP ++ + + D  + LY EL QAFKLID D+DG + + ELEALL+++GAEPP
Sbjct  49   GFRTPTSILPQVSGDWT-DISNDLYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPP  107

Query  384  SREELRLMLSEVDR  425
            S EE+ ++L EVD 
Sbjct  108  SSEEMAVILGEVDH  121


 Score = 50.1 bits (118),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 5/48 (10%)
 Frame = +1

Query  439  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
            ALASR    L +A  P   D ELRDAF FFD+D DGKI+A+EL NV+K
Sbjct  126  ALASR----LGTACEPAGND-ELRDAFVFFDSDRDGKITADELLNVYK  168



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score = 84.3 bits (207),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  82   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  137

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
             + EE+ +ML EVD DGDG + LE
Sbjct  138  LTEEEIDVMLKEVDCDGDGTVRLE  161


 Score = 42.4 bits (98),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EL++ F+FFD D DGKISAEEL  VF  I
Sbjct  179  ELKETFEFFDADRDGKISAEELLRVFSAI  207



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score = 77.8 bits (190),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            K GG +TP SVL + + EIS D     +  + +LV+AFK IDRD DGKI + ELE +LS+
Sbjct  48   KEGGATTPRSVLHSHSHEISGDWSDLQADFHFQLVEAFKFIDRDGDGKITRRELENILSR  107

Query  366  VGAEPPS--REELRLMLSEVDRDGDGCISLE  452
            +GA+ PS   + + + L EVDRDGDGCI+L+
Sbjct  108  LGADTPSEEMQMMLMELMEVDRDGDGCINLK  138


 Score = 47.4 bits (111),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +1

Query  451  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +E    S AF P    SELRDAFDFFD   DGKISA+EL  VF  +
Sbjct  138  KETGATSPAFGPYD-GSELRDAFDFFDAGRDGKISADELHRVFTAL  182



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score = 84.3 bits (207),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  K G  +TP SVLP  + +         YAEL+QAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYAELIQAFKLIDRDDDGVVSRGDLAALISR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  98   LSPEPPSQEEVSLMLREVDGGDGGCISLE  126


 Score = 40.8 bits (94),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F+ FD D +GKISAEEL  VF  I
Sbjct  145  ELREVFEIFDVDRNGKISAEELHRVFGVI  173



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score = 82.8 bits (203),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G EP
Sbjct  47   GGSVTPTSILPEVPSPYS-------YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEP  99

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
             + EE+ +M+ EVD DGDG I LE
Sbjct  100  LTEEEINVMIKEVDGDGDGTIRLE  123


 Score = 42.0 bits (97),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G  T+ L      V+S    P    +EL++ F+FFD D DG ISA+EL  VF TI
Sbjct  116  GDGTIRLEELASRVVS--LDPARDSTELKETFEFFDADRDGLISADELLRVFSTI  168



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score = 84.0 bits (206),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLE  126


 Score = 40.8 bits (94),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F+ FD D +GKISAEEL  VF  I
Sbjct  145  ELREVFEIFDVDRNGKISAEELHRVFGVI  173



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score = 84.0 bits (206),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLE  126


 Score = 40.8 bits (94),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F+ FD D +GKISAEEL  VF  I
Sbjct  145  ELREVFEIFDVDRNGKISAEELHRVFGVI  173



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score = 80.1 bits (196),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +3

Query  216  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  395
            PTS+LP    EISP   S  Y E++++F LIDR++DG I K +LE+LLS++G EP + EE
Sbjct  41   PTSILP----EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEE  94

Query  396  LRLMLSEVDRDGDGCISLE  452
            + +M+ EVDRDGDG I LE
Sbjct  95   IDVMIKEVDRDGDGTIRLE  113


 Score = 44.3 bits (103),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G  T+ L      V+S    P    +EL++ F+FFD D DG ISAEEL  VF+TI
Sbjct  106  GDGTIRLEELASRVVS--LDPCRDSTELKETFEFFDADRDGMISAEELLRVFETI  158



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score = 80.1 bits (196),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +3

Query  192  KKPGGESTPTSVLPALNDEISPDEL--SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
             KPG  +TP SVLP ++ + S      S LY+ELVQAFKLIDRDDDG + + EL ALL++
Sbjct  51   HKPGPAATPISVLPEISGDWSQVSAGDSDLYSELVQAFKLIDRDDDGAVSRSELAALLTR  110

Query  366  VGAEPPSREELRLMLSEVD  422
            +  EPPS++E+ +ML E D
Sbjct  111  LSPEPPSQDEVSMMLREAD  129


 Score = 43.9 bits (102),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F+FFD D DG+ISAEEL  VF  I
Sbjct  145  ELREVFEFFDADRDGRISAEELLRVFGVI  173



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score = 79.7 bits (195),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 11/91 (12%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
             +K     +TP SVLP           S  ++EL+QAFKLIDRDDDG + + +L  L+S+
Sbjct  51   NHKPNPSSTTPISVLPWSG--------SDFHSELIQAFKLIDRDDDGVVSRRDLANLISK  102

Query  366  VGAEPPSREELRLMLSEVDRDG--DGCISLE  452
            +  EPPS EE+ LML EVD DG  DGCISLE
Sbjct  103  LSPEPPSHEEVSLMLREVD-DGEEDGCISLE  132


 Score = 43.1 bits (100),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            + E+R+ F++FD D DG+ISAEEL+ VF  I
Sbjct  148  EEEMREVFEYFDVDRDGRISAEELYRVFGVI  178



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score = 80.1 bits (196),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 8/84 (10%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  KPG  +TP SVLP  + +         Y ELVQAFKLIDRD DG + + +L ALLS+
Sbjct  46   GNLKPGPTATPISVLPHNSGD--------FYTELVQAFKLIDRDHDGVVSRGDLAALLSR  97

Query  366  VGAEPPSREELRLMLSEVDRDGDG  437
            +  EPPS+EE+ LML EVD D DG
Sbjct  98   LSPEPPSQEEVSLMLKEVDGDDDG  121


 Score = 42.4 bits (98),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F+FFD D +GKISAEEL  VF  I
Sbjct  146  ELREVFEFFDADRNGKISAEELHRVFGVI  174



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score = 82.4 bits (202),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++ + SP      Y E++ AF+LIDRD+DG + + +L +LLS++G +P
Sbjct  49   GGSVTPTSILPEVSGDPSPYS----YVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDP  104

Query  381  PSREELRLMLSEVDRDGDGCISLE  452
            PS EE+ +ML EVD DG+G I +E
Sbjct  105  PSEEEIDVMLREVDCDGEGTIRIE  128


 Score = 40.0 bits (92),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G  T+ +      V+SS  +  S  +EL++ F+FFD D DG ISAEEL  VF  I
Sbjct  121  GEGTIRIEELASRVVSSDQSRDS--TELKETFEFFDADRDGFISAEELLRVFSAI  173



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score = 77.8 bits (190),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 7/80 (9%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            TPTS+LP ++   S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + +
Sbjct  57   TPTSILPDVSSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTED  109

Query  393  ELRLMLSEVDRDGDGCISLE  452
            E+ +M+ EVD DGDG I LE
Sbjct  110  EISVMIQEVDCDGDGAIRLE  129


 Score = 43.5 bits (101),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 7/50 (14%)
 Frame = +1

Query  442  LASREFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            LASR  S      + PS DS EL++ F+FFD D DG ISAEEL  VF TI
Sbjct  131  LASRLVS------SDPSRDSAELKETFEFFDADRDGLISAEELLRVFSTI  174



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score = 79.0 bits (193),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 7/80 (9%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + E
Sbjct  54   TPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEE  106

Query  393  ELRLMLSEVDRDGDGCISLE  452
            E+ +ML EVD DGDG I LE
Sbjct  107  EINVMLKEVDCDGDGTIRLE  126


 Score = 42.0 bits (97),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G  T+ L      V+S    P    +EL++ F+FFD D DG ISA+EL  VF TI
Sbjct  119  GDGTIRLEELASRVVS--LDPARDSTELKETFEFFDADRDGLISADELLRVFSTI  171



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score = 80.1 bits (196),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 55/89 (62%), Gaps = 9/89 (10%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  96

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  97   LSHEPPSQEEVSLMLREVDGGDGGCISLE  125


 Score = 40.8 bits (94),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F+ FD D +GKISAEEL  VF  I
Sbjct  144  ELREVFEIFDVDRNGKISAEELHRVFGVI  172



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score = 67.0 bits (162),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +3

Query  297  FKLIDRDDDGKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLE  452
            F + DRD DGKI + EL+A+L ++G A+PP+ EE+  M++EVDRDGDGCISLE
Sbjct  82   FAVFDRDGDGKITRHELQAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLE  134


 Score = 53.1 bits (126),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + SAF PP+  ++LR+AF  FD D DGKISAEEL  VF T+
Sbjct  135  EFGAIGSAFGPPA-GADLREAFAVFDADGDGKISAEELLGVFITL  178


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            A+L +AF + D D DGKI  EEL  +   +G E  + E+ R M+  VD DGDG +  E  
Sbjct  149  ADLREAFAVFDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDF  208

Query  459  QR  464
             R
Sbjct  209  VR  210



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score = 66.6 bits (161),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +3

Query  207  ESTPTSVLPA-----LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  371
             STP S+LPA     +        LS   + +   F + DRD DGKI ++ELEA+L  +G
Sbjct  49   HSTPRSILPAGKPPSVAGSGEFWLLSPASSSVSDLFAVFDRDRDGKITRQELEAVLRGLG  108

Query  372  -AEPPSREELRLMLSEVDRDGDGCISLE  452
             A+PP+ EE+  M++EVD DGDGCISLE
Sbjct  109  GADPPTEEEVASMVAEVDLDGDGCISLE  136


 Score = 53.1 bits (126),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + SAF PP+   +LR+AF  FD D DGKISAEEL  VF T+
Sbjct  137  EFGAIGSAFGPPA-GGDLREAFAVFDADGDGKISAEELLGVFVTL  180


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
             +L +AF + D D DGKI  EEL  +   +G +  + E+ R M+ EVD DGDG +  E  
Sbjct  151  GDLREAFAVFDADGDGKISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDF  210

Query  459  QR  464
             R
Sbjct  211  VR  212



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score = 68.2 bits (165),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
             +K   G  TPTSVLP ++ + S      +  +L QAF+LIDRD+DG + +++LEALL+ 
Sbjct  48   NHKPSAGNQTPTSVLPGVSGDWSDVAAVDVRWDLAQAFRLIDRDNDGVVTRQDLEALLTC  107

Query  366  VGAEPPSREELRLMLSEVDRDG  431
            +GA  P  +++ +ML EVD DG
Sbjct  108  LGAS-PCPDDVAVMLGEVDGDG  128


 Score = 51.2 bits (121),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  451  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            R  S + S   P S   EL++AF+ FDTD DG+ISAEEL  VFK I
Sbjct  133  RLMSYVGSGLKPGSDPDELKEAFEVFDTDRDGRISAEELLRVFKAI  178


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  461
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E   
Sbjct  150  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  209

Query  462  R  464
            R
Sbjct  210  R  210



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score = 67.0 bits (162),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 8/89 (9%)
 Frame = +3

Query  210  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  368
            STP SVLP    +            LS   + +   F + DRD DGKI   ELEA+L ++
Sbjct  48   STPRSVLPPPAGKTPSSSGSDDLWLLSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRL  107

Query  369  GA-EPPSREELRLMLSEVDRDGDGCISLE  452
            G  +PP+ EE+  M++EVDRDGDGCISLE
Sbjct  108  GGVDPPTEEEVASMVAEVDRDGDGCISLE  136


 Score = 52.8 bits (125),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + +AF PP+  +ELR+AF  FD + DGKISAEEL  VF T+
Sbjct  137  EFGAIGTAFGPPA-GAELREAFAVFDANGDGKISAEELLGVFSTL  180


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            AEL +AF + D + DGKI  EEL  + S +G E  + E+ R M+  VD DGDG +  +  
Sbjct  151  AELREAFAVFDANGDGKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDF  210

Query  459  QR  464
             R
Sbjct  211  VR  212



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score = 77.4 bits (189),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 58/89 (65%), Gaps = 11/89 (12%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSP  101

Query  375  EPPSREELRLMLSEV---DRDGDGCISLE  452
            EPPS+EE+ LML EV     D  GCISLE
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLE  130


 Score = 42.0 bits (97),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F++FD D +GKISAEEL  VF  I
Sbjct  149  ELREVFEYFDADRNGKISAEELHRVFGVI  177



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score = 77.0 bits (188),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 58/89 (65%), Gaps = 11/89 (12%)
 Frame = +3

Query  195  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSP  101

Query  375  EPPSREELRLMLSEV---DRDGDGCISLE  452
            EPPS+EE+ LML EV     D  GCISLE
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLE  130


 Score = 42.0 bits (97),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELR+ F++FD D +GKISAEEL  VF  I
Sbjct  149  ELREVFEYFDADRNGKISAEELHRVFGVI  177



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 5/95 (5%)
 Frame = +3

Query  186  GYKKP----GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEA  353
            G++ P     G  TPTSVLP  + + S D  +  Y EL QAFK++D+D+DG I + ELEA
Sbjct  52   GHQYPSAATAGFVTPTSVLPQTSGDWS-DFPANFYLELCQAFKMLDKDNDGVISRSELEA  110

Query  354  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            LL +V  +PPSR E+ LMLSEVD DGDG I+LE +
Sbjct  111  LLGKVARQPPSRIEVSLMLSEVDGDGDGYINLETL  145


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
            G   + L +    V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK
Sbjct  136  GDGYINLETLMNQVVGPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFK  188



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score = 69.7 bits (169),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPA---LNDEISPDELSG---LYAEL--------VQAFKLIDRDDD  323
            G+   G  STP SVLPA   L     P   +G   L+  L         + F + D D D
Sbjct  42   GFISSGLHSTPRSVLPASPGLRPAEKPPSAAGSNDLWLFLPASSSSSVSELFAVFDCDGD  101

Query  324  GKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLE  452
            GKI ++ELEA+L ++G A+PP+ EE+  M++EVDRDGDGCISLE
Sbjct  102  GKITRQELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLE  145


 Score = 48.5 bits (114),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + SAF PP+  +ELR+ F  FD D DGKISAEEL  VF  +
Sbjct  146  EFGAIGSAFGPPA-GAELREVFAVFDDDGDGKISAEELQRVFVML  189


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            AEL + F + D D DGKI  EEL+ +   +G +  + E+ R M+  VD DGDG +  E  
Sbjct  160  AELREVFAVFDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVDTDGDGFVCFEDF  219

Query  459  QR  464
             R
Sbjct  220  VR  221



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 69.3 bits (168),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 9/89 (10%)
 Frame = +3

Query  198  PGGESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
             G ++TP SVL A + +    + PDE+S     L+  F + D D DGKI K ELEA+L +
Sbjct  55   TGLQTTPRSVLQAAHGKTPLFLFPDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRR  109

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  + P+ EE+  M++E+DRDGDGCISL+
Sbjct  110  LVPDAPTAEEVASMVAEMDRDGDGCISLD  138


 Score = 48.5 bits (114),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +1

Query  454  EFSVLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF+ L  A A  +   +SELR+AF  FD D DGKISAEEL  VF T+
Sbjct  139  EFAALGPALAASAGGGESELREAFAVFDADGDGKISAEELLGVFATL  185



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score = 75.1 bits (183),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  51   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  108

Query  381  PSREELRLMLSEVDRDG-DGCISLE  452
             + +E+ +M+ EV  +G DG I LE
Sbjct  109  LTEDEINVMIKEVGCEGDDGTIRLE  133


 Score = 42.7 bits (99),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  487  PSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            PS DS E+++ F+FFD D DG ISAEEL  VF TI
Sbjct  145  PSRDSAEMKETFEFFDADRDGLISAEELLRVFSTI  179



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score = 72.4 bits (176),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  53   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  110

Query  381  PSREELRLMLSEV--DRDGDGCISLE  452
             + +E+ +M+ EV  +   DG I LE
Sbjct  111  LTEDEINVMIKEVGCEEGDDGTIRLE  136


 Score = 42.7 bits (99),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  487  PSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            PS DS E+++ F+FFD D DG ISAEEL  VF TI
Sbjct  148  PSRDSAEMKETFEFFDADRDGLISAEELLRVFSTI  182



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score = 72.0 bits (175),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            GG  TPTS+LP ++ + SP      Y E++QAFKLIDRD+DG I + +LE+LLS++G +P
Sbjct  51   GGSVTPTSILPEVSCDTSPPPPYS-YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDP  109

Query  381  PSREELRLMLSEV--DRDGDGCISLE  452
             + +E+ +M+ EV  +   DG I LE
Sbjct  110  LTEDEINVMIKEVGCEEGDDGTIRLE  135


 Score = 43.1 bits (100),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  487  PSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            PS DS EL++ F+FFD D DG ISAEEL  VF TI
Sbjct  147  PSRDSAELKETFEFFDADRDGLISAEELLRVFSTI  181



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 68.2 bits (165),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +3

Query  207  ESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            ++TP SVLP  + +      PDE     A  +  F + D D DGKI K ELEA+L ++  
Sbjct  59   QATPRSVLPPDHGKAPVVFLPDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVP  113

Query  375  EPPSREELRLMLSEVDRDGDGCISLE  452
            +PP+ EE+  M++EVDRDGDGCISL+
Sbjct  114  DPPTAEEVASMVAEVDRDGDGCISLD  139


 Score = 45.4 bits (106),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +SELRDAF  FD D DGKISAEEL  VF T+
Sbjct  155  ESELRDAFAVFDADGDGKISAEELLGVFATL  185



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 71/89 (80%), Gaps = 7/89 (8%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  377
            TPTSVLP L++EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LEA+LS+VG +
Sbjct  44   TPTSVLPTLSNEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGK  102

Query  378  -PPSREELRLMLSEVDRDGDGCISLEGVQ  461
             PP+ EEL L+L E+D++GDGCISLE  +
Sbjct  103  SPPTEEELVLLLDELDKNGDGCISLENFE  131


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 7/60 (12%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAF--APPSCD---SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L +  F  ++SAF   PPS      E+RDAFDFFD DHDGKI+ EELFNVF+ I
Sbjct  121  GDGCISLEN--FETITSAFEPTPPSAAEDAGEMRDAFDFFDEDHDGKITGEELFNVFRMI  178


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD++GDG +  E
Sbjct  150  EMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFE  206



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score = 67.4 bits (163),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 58/86 (67%), Gaps = 6/86 (7%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
             G  TPTSVLP ++ + S D    +  +L QAF+LIDRD+DG + +++LEA+L+++GA  
Sbjct  54   AGSLTPTSVLPGVSGDWS-DVTVDVRWDLAQAFRLIDRDNDGVVSRQDLEAVLTRLGA--  110

Query  381  PSREELRLMLSEVDRDGDGCISLEGV  458
                ++ LMLSEV+    GCI++E +
Sbjct  111  ---SDVALMLSEVEGGAGGCITVEAL  133


 Score = 43.5 bits (101),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EL++AF  FDTD DG+ISAEEL  VF+ I
Sbjct  149  ELKEAFAVFDTDRDGRISAEELLRVFRAI  177


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  461
            EL +AF + D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E   
Sbjct  149  ELKEAFAVFDTDRDGRISAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  208

Query  462  R  464
            R
Sbjct  209  R  209



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 7/90 (8%)
 Frame = +3

Query  210  STPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            STPTSVLP L++EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LEA+LS+VG 
Sbjct  41   STPTSVLPTLSNEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGG  99

Query  375  E-PPSREELRLMLSEVDRDGDGCISLEGVQ  461
            + PPS EEL L+L E+D +GDGCISLE  +
Sbjct  100  KSPPSEEELVLLLDELDENGDGCISLENFE  129


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 7/60 (12%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAF--APPSCDS---ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G   ++L +  F  ++SAF   P S      E+RDAFDFFD DHDGKI+ EELFNVF+ I
Sbjct  119  GDGCISLEN--FETITSAFESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMI  176


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  246  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  425
            E +P   +G   E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD+
Sbjct  136  ESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDK  195

Query  426  DGDGCISLE  452
            +GDG +  +
Sbjct  196  NGDGFVCFD  204



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score = 73.9 bits (180),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  276  YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEG  455
            + EL++AF LID+D+DG + + +LEALL+Q+G  PP+++E+ +ML EVDRDG G IS++ 
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDT  113

Query  456  V  458
            +
Sbjct  114  L  114


 Score = 36.2 bits (82),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVF  579
            +EL++ F+ FD+D +G ISAEEL  VF
Sbjct  132  TELKETFELFDSDRNGLISAEELLRVF  158



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 9/79 (11%)
 Frame = +3

Query  201  GGES-TPTSVLP-----ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  362
            GGE+ TPTSVLP       +D  S  E++G   ELV+AF  ID D+DG + +E+LEALLS
Sbjct  47   GGEARTPTSVLPPQLSGEWSDVASSSEMNG---ELVRAFTYIDGDNDGVLSREDLEALLS  103

Query  363  QVGAEPPSREELRLMLSEV  419
            ++GAEP S +E  LML EV
Sbjct  104  RLGAEPLSADEKALMLREV  122


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  442  LASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L SR  S      A   CD E+R  F+FFD + DG+I+AEEL   F+ +
Sbjct  138  LVSRVGSAGGDEEADAGCDVEMRRTFEFFDRNGDGRITAEELLGAFEAM  186



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score = 62.4 bits (150),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGL--YAELVQAFKLIDRDDDGKIRKEELEALL  359
             +K   G  TPTSVLP ++ E S    + +    +L QA +LIDRD+DG + +++LE+LL
Sbjct  49   NHKPSPGNQTPTSVLPDVSGEWSEVAAAAVDVRWDLAQALRLIDRDNDGVVTRQDLESLL  108

Query  360  SQVGAEPPSREELRLMLSEVDRDG  431
            +++GA  PS  ++ LML EVD DG
Sbjct  109  TRLGAS-PSPGDVALMLGEVDGDG  131


 Score = 47.0 bits (110),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             S + S     S   EL++AF+ FDTD DG+ISAEEL  VFK I
Sbjct  138  MSYVGSGLETGSDPDELKEAFEVFDTDRDGRISAEELLRVFKAI  181


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  461
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E   
Sbjct  153  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  212

Query  462  R  464
            R
Sbjct  213  R  213



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            +EL QAFK+ID+D+DG I + ELEALLS+V  +PPSREE+ LMLSEV  DG GCISL+ +
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTL  94


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  582
            G   ++L +    V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK
Sbjct  85   GVGCISLDTLMTQVVVPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFK  137


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            EL + F + D D DGKI  EEL A   + +G E  + E+ R M++ VD++GDG +  E  
Sbjct  111  ELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMIASVDKNGDGFVCFEDF  170

Query  459  QR  464
             R
Sbjct  171  AR  172



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score = 55.5 bits (132),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = +3

Query  204  GES-TPTSVLPALNDEISPDE--LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            GES TPTSVL              +G   EL +AF LIDRD DG + ++ELEALLS++G 
Sbjct  56   GESLTPTSVLGRGGGGGGGGGGVWAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG-  114

Query  375  EPPSREELRLMLSEVDRDGDG  437
               SR+E+ +MLSEV   G+G
Sbjct  115  ---SRDEVAVMLSEVGCHGEG  132


 Score = 50.1 bits (118),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
             S +  A  P   D+ELR+ F+FFD DHDGKI+AEEL  VF
Sbjct  143  LSRVGPACGPACDDAELRETFEFFDADHDGKITAEELLGVF  183


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            AEL + F+  D D DGKI  EEL  + +  G E  + EE R M+SEVD++GDG +  E  
Sbjct  157  AELRETFEFFDADHDGKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDF  216

Query  459  QR  464
             R
Sbjct  217  TR  218



>ref|XP_010924246.1| PREDICTED: probable calcium-binding protein CML35 [Elaeis guineensis]
Length=320

 Score = 65.5 bits (158),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = +3

Query  210  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  368
            STP SVLP    +            LS   + +   F + +RD DGKI   ELEA+L  +
Sbjct  67   STPCSVLPPPTGKTPSSSRSDDLWLLSPASSSISNLFIIFNRDGDGKIMPHELEAILCHL  126

Query  369  -GAEPPSREELRLMLSEVDRDGDGCISLE  452
             GA PP++EEL  M+ EV+RD +GCISLE
Sbjct  127  HGANPPTKEELASMVVEVNRDDNGCISLE  155


 Score = 37.4 bits (85),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +EL +AF  FD ++DGKIS EEL  +F T+
Sbjct  169  AELWEAFAIFDANNDGKISIEELLRMFNTL  198



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score = 52.8 bits (125),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+C SELRD F+ FD DHDG+I+AEELF+VF  +
Sbjct  96   PTCHSELRDTFEIFDADHDGRITAEELFSVFAAM  129


 Score = 48.9 bits (115),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 21/78 (27%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  44   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  82

Query  393  ELRLMLSEVDRDGDGCIS  446
            E+++M+ E+DR G  C S
Sbjct  83   EIKIMMGEMDRVGPTCHS  100



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score = 52.8 bits (125),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+C SELRD F+ FD DHDG+I+AEELF+VF  +
Sbjct  95   PTCHSELRDTFEIFDADHDGRITAEELFSVFAAM  128


 Score = 48.9 bits (115),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 21/78 (27%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  43   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  81

Query  393  ELRLMLSEVDRDGDGCIS  446
            E+++M+ E+DR G  C S
Sbjct  82   EIKIMMGEMDRVGPTCHS  99



>ref|XP_008443339.1| PREDICTED: probable calcium-binding protein CML35 [Cucumis melo]
Length=233

 Score = 53.1 bits (126),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  487  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P+C SELRD F+ FD DHDG+I+AEELF+VF  +
Sbjct  162  PACHSELRDTFEIFDADHDGRITAEELFSVFTAM  195


 Score = 46.6 bits (109),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  321  DGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  446
            D  + ++EL+ALL  +GAEPPS EE+++M+ E+DR G  C S
Sbjct  125  DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVGPACHS  166


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  270  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
              ++EL   F++ D D DG+I  EEL ++ + +G E  + E+ R M++ VD++GDG +  
Sbjct  163  ACHSELRDTFEIFDADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVDKNGDGFVCF  222

Query  450  EGVQR  464
            +   R
Sbjct  223  DDFAR  227



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score = 49.7 bits (117),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  309  DRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +++ DG+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LE
Sbjct  86   EKEGDGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLE  133


 Score = 45.4 bits (106),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E   L SAF PP    ELR+ F  FD D DG ISAEEL  +F T+
Sbjct  134  EIVALGSAFGPPVV-PELRETFAVFDGDGDGMISAEELLAMFVTL  177



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score = 48.1 bits (113),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +1

Query  451  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +E   L SAF PP    ELR+ F  FD D DGKISAEEL  +F T+
Sbjct  127  QEIVALGSAFGPPVA-PELRETFAVFDVDGDGKISAEELLAMFVTL  171


 Score = 45.4 bits (106),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 9/91 (10%)
 Frame = +3

Query  207  ESTPTSVLP-------ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            +STP SVLP       A +  I   E    ++         +R+ + ++ + ELE +L +
Sbjct  41   QSTPKSVLPPSPRRRVAKSASIGGGE--ECWSSSSTDHSPAEREGEERVTRRELEVVLQR  98

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            +G +PP+ EE+  ML+E DR GDG I L+ +
Sbjct  99   LGPDPPTEEEVAAMLAEADRGGDGSIRLQEI  129



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score = 57.0 bits (136),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFINFK  111


 Score = 36.2 bits (82),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G ISAEEL+ V +++
Sbjct  130  LKDAFSVYDIDGNGSISAEELYEVLRSL  157



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score = 59.7 bits (143),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +3

Query  204  GESTPTSV---LPALNDEISP-DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  371
            G+++PT+     P +N   S  +  S L  EL Q FK  D + DGKI   EL ++L  VG
Sbjct  18   GDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVG  77

Query  372  AEPPSREELRLMLSEVDRDGDGCISLE  452
             +P + EELR+M+ EVD DGDG I L+
Sbjct  78   -QPATEEELRIMIQEVDADGDGFIDLQ  103


 Score = 33.1 bits (74),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D +G I+AEEL +V +++
Sbjct  122  LKDAFKVFDIDKNGYITAEELQDVLQSL  149



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score = 46.6 bits (109),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G  ++ L  +E   L SAF PP    EL+  F  FD D DGKISAEEL  +F T+
Sbjct  120  GEGSIRL--QEIVALGSAFGPPVA-PELQQTFAVFDVDGDGKISAEELLAMFVTL  171


 Score = 45.8 bits (107),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  306  IDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            ++RD + ++ + ELE +L ++G +PP+ EE+  ML+E DR G+G I L+
Sbjct  79   VERDGEERVTRRELEVVLRRLGPDPPTEEEVVAMLAEADRGGEGSIRLQ  127


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  461
            EL Q F + D D DGKI  EEL A+   +G E  + E+ R M+  VD DGDG +  E   
Sbjct  143  ELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVCFEDFV  202

Query  462  R  464
            R
Sbjct  203  R  203



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score = 49.7 bits (117),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +3

Query  207  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  386
            + TP +VLP L         +   +     +   +R+ +G+I + ELE +L ++G +PP+
Sbjct  42   QCTPKTVLPRLPGCHLAAPAAKSASSSSTDYPSAEREGEGRITRRELEVVLRRLGPDPPT  101

Query  387  REELRLMLSEVDRDGDGCISLE  452
             EE+  ML+E DR GDG I LE
Sbjct  102  EEEVVAMLAEADRAGDGSIRLE  123


 Score = 43.1 bits (100),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 26/45 (58%), Gaps = 1/45 (2%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E   L S   PP    ELR+ F  FD D DGKISAEEL  +F T+
Sbjct  124  EIVELGSVVGPPVV-PELRETFAVFDADGDGKISAEELLAMFVTL  167



>ref|XP_003536119.1| PREDICTED: calmodulin-like protein 11-like [Glycine max]
 gb|KHN16197.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score = 54.7 bits (130),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD DG G I  
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMDGSGTIEF  67


 Score = 37.7 bits (86),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + EL++AF  FD D DG IS  EL +V + I
Sbjct  71   LNLMARKMKQSEAEEELKEAFKLFDKDQDGYISPTELLSVMRNI  114



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score = 49.3 bits (116),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            EL   FK  D + DGKI   EL +++  +G  P + EELR M+ EVD DGDG I L
Sbjct  40   ELEHVFKKFDVNGDGKICAAELGSIMGSLG-HPATEEELRTMIQEVDSDGDGFIDL  94


 Score = 41.6 bits (96),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = +1

Query  451  REFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            REF  L++           LRDAF+ FD D +G ISAEEL NV K++
Sbjct  95   REFIELNTNGIGQDEVIENLRDAFEVFDMDKNGSISAEELHNVLKSL  141



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score = 52.4 bits (124),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +3

Query  255  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  434
            P +  G   ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+DGD
Sbjct  29   PADSLGNVDQVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDKDGD  88

Query  435  GCISLE  452
            G I L+
Sbjct  89   GFIDLD  94


 Score = 38.5 bits (88),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (56%), Gaps = 1/43 (2%)
 Frame = +1

Query  463  VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +L      P C + ELRDAFD +D D +G IS  EL  V K +
Sbjct  100  ILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKL  142



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score = 53.1 bits (126),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            EL + F+L D + DGKI   EL+  ++++G  P +  EL +M+ E D DGDG ISL
Sbjct  30   ELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFISL  85


 Score = 37.7 bits (86),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L++AF  FD D DGKISA+EL NV K +
Sbjct  103  LKEAFAVFDEDRDGKISAKELQNVLKGL  130



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score = 55.8 bits (133),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFINFK  178


 Score = 34.7 bits (78),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +1

Query  451  REFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +EF  L++    P      L+DAF  +D D +G IS EEL+ V +++
Sbjct  178  KEFVELNTKGIDPDEALENLKDAFSVYDIDGNGSISVEELYKVLRSL  224



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score = 50.1 bits (118),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 10/72 (14%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL----  449
            EL + F+L D + DGKI   EL  +++++G  P    EL +M+ E D DGDG I+L    
Sbjct  38   ELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEADADGDGFINLAEFK  97

Query  450  ------EGVQRA  467
                  EGVQ A
Sbjct  98   DINRAGEGVQEA  109


 Score = 40.4 bits (93),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +++LR+AF  FD DHDGKISA EL  V K +
Sbjct  108  EADLREAFAVFDEDHDGKISASELRGVLKGL  138



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score = 54.3 bits (129),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q FK  D + DGKI   EL A++S +G +  S EEL  M+SEVD DGDG I+ +
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QASSDEELNSMISEVDSDGDGFINFK  106


 Score = 36.2 bits (82),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G ISAEEL+ V +++
Sbjct  125  LKDAFSVYDIDGNGSISAEELYEVLRSL  152



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score = 56.6 bits (135),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = +3

Query  243  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  422
            D +S D++S    EL +AF +ID+D DG IR EEL A++  +  E P++EE++ M++EVD
Sbjct  3    DALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNEVD  57

Query  423  RDGDGCISLE  452
             DGDG I  E
Sbjct  58   PDGDGTIDFE  67


 Score = 33.5 bits (75),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  490  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +   EL++AF  FD D DG ISA EL NV   +
Sbjct  80   NVSEELKEAFKVFDRDQDGFISANELRNVMMNL  112



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 57.0 bits (136),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +3

Query  189  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  368
            + +P       S  P+ +  +S    + L  EL Q FK  D + DGKI   EL +++  +
Sbjct  7    FNRPKDMIPSASSTPSRSTSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSL  66

Query  369  GAEPPSREELRLMLSEVDRDGDGCISLE  452
            G +P + +EL  M+ EVD DGDGCISL+
Sbjct  67   G-QPATEQELDNMIREVDGDGDGCISLQ  93


 Score = 33.1 bits (74),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D +G I+AEEL  V +++
Sbjct  112  LKDAFAVFDMDGNGSITAEELNTVMRSL  139



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25 [Fragaria vesca 
subsp. vesca]
Length=184

 Score = 50.4 bits (119),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q F   D + DGKI   EL A++  +G  P + +ELR M+ EVD DGDG I + 
Sbjct  36   AELEQVFNKFDVNGDGKISSSELGAIMGSLG-HPATEDELRSMILEVDADGDGFIDIN  92


 Score = 39.3 bits (90),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            LRDAF  +D D +G ISAEELF V K++
Sbjct  111  LRDAFSVYDKDGNGSISAEELFEVLKSL  138



>gb|KHN04934.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score = 53.1 bits (126),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD +G G I  
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMNGSGTIEF  67


 Score = 36.6 bits (83),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + EL++AF+ FD D DG IS  EL +  + I
Sbjct  71   LNLMARKMKQSEAEEELKEAFELFDKDQDGYISPTELLSAMRNI  114



>ref|XP_006351748.1| PREDICTED: calmodulin-5/6/7/8-like [Solanum tuberosum]
Length=147

 Score = 56.6 bits (135),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRMEELASVIQSLH-EHPTREEIQEMINE  55

Query  417  VDRDGDGCISLE  452
            VD DGDG I  E
Sbjct  56   VDPDGDGSIDFE  67


 Score = 33.1 bits (74),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             EL++AF  FD D DG ISA EL NV   +
Sbjct  83   EELKEAFKVFDRDQDGFISANELRNVMMNL  112



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score = 56.2 bits (134),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 5/70 (7%)
 Frame = +3

Query  243  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  422
            D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++EVD
Sbjct  3    DALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSLH-ENPTREEMQEMMNEVD  57

Query  423  RDGDGCISLE  452
             DGDG I  E
Sbjct  58   PDGDGTIDFE  67


 Score = 33.5 bits (75),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             EL++AF  FD D DG ISA EL NV   +
Sbjct  83   EELKEAFKVFDRDQDGFISANELRNVMMNL  112



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score = 53.1 bits (126),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFK  95


 Score = 36.6 bits (83),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G ISAEEL+ V +++
Sbjct  114  LKDAFSVYDIDGNGSISAEELYKVLRSL  141



>ref|XP_008457589.1| PREDICTED: probable calcium-binding protein CML36 [Cucumis melo]
Length=192

 Score = 45.8 bits (107),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +SELR+ F+FFD D DG+I+AEEL  VF++I
Sbjct  124  ESELRETFEFFDADQDGRITAEELHGVFRSI  154


 Score = 43.5 bits (101),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 4/47 (9%)
 Frame = +3

Query  312  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            R+++G + ++ELEA+LS++ +E    EE+ +MLSEVD  GDG I LE
Sbjct  68   RENEGVVTRKELEAILSRIASE----EEVAMMLSEVDSGGDGFIRLE  110



>ref|XP_007144825.1| hypothetical protein PHAVU_007G187200g [Phaseolus vulgaris]
 gb|ESW16819.1| hypothetical protein PHAVU_007G187200g [Phaseolus vulgaris]
Length=149

 Score = 51.6 bits (122),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  270  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
             L  + ++AF L DRD DG I  EEL + +  +    P +EEL++M+SEVD +G+G I  
Sbjct  8    NLIGDFLEAFCLFDRDGDGCITMEELASAIRVLNQNNPRKEELQVMMSEVDMNGNGMIDF  67


 Score = 37.4 bits (85),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + EL++AF  FD D DG IS  EL +V + I
Sbjct  71   LNLMARKMKQSETEEELKEAFRLFDQDQDGYISPTELLSVMRNI  114



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score = 52.8 bits (125),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF LID+D DG I  EEL AL  Q   E P+ EE++ M++E D DGDG +  E
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFE  67


 Score = 36.6 bits (83),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +1

Query  451  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
             EF ++ S+    +   E++DAF  FD D DG ISA EL NV 
Sbjct  67   EEFLIVMSSKMKENVVEEIKDAFKVFDRDQDGFISAIELRNVM  109



>ref|XP_003556466.1| PREDICTED: calmodulin-like protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006606459.1| PREDICTED: calmodulin-like protein 8-like isoform X2 [Glycine 
max]
Length=149

 Score = 53.1 bits (126),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD +G G I  
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMNGSGTIEF  67


 Score = 35.8 bits (81),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + EL++AF  FD D DG IS  EL +  + I
Sbjct  71   LNLMARKMKQSEAEEELKEAFKLFDKDQDGYISPTELLSAMRNI  114



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score = 53.1 bits (126),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFK  95


 Score = 35.8 bits (81),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G ISAEEL+ V +++
Sbjct  114  LKDAFSVYDIDGNGLISAEELYKVLRSL  141



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score = 52.0 bits (123),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            EL Q FK  D + DGKI   EL A++  +G +P   EELR M+ EVD DGDG I L+
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLG-QPSGEEELRKMIKEVDSDGDGFIDLK  99


 Score = 36.6 bits (83),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G ISAEEL+ V +++
Sbjct  118  LKDAFSVYDIDKNGSISAEELYEVLRSL  145



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score = 53.9 bits (128),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 44/86 (51%), Gaps = 6/86 (7%)
 Frame = +3

Query  192  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  371
            +K    S   +  P++N     +E      EL Q FK  D + DGKI   EL A+   +G
Sbjct  4    RKAKASSGAMNSTPSMNSRAQIEE------ELEQVFKKFDVNGDGKISGSELGAIFRSLG  57

Query  372  AEPPSREELRLMLSEVDRDGDGCISL  449
             E  + EEL+ M+ EVD DGDG I L
Sbjct  58   GEAMAEEELKSMIREVDSDGDGFIDL  83


 Score = 34.3 bits (77),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D DG IS EEL  V +++
Sbjct  103  LKDAFQVFDIDGDGSISCEELRQVLESL  130



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score = 53.9 bits (128),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +E  +AF +ID+D DG IR EEL A++  +  E P++EE++ M++EVD DGDG I  E
Sbjct  11   SEFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNEVDPDGDGTIDFE  67


 Score = 33.5 bits (75),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  490  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +   EL++AF  FD D DG ISA EL NV   +
Sbjct  80   NVSEELKEAFKVFDRDQDGFISANELRNVMMNL  112



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 54.3 bits (129),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF +ID+D DG I  EEL +++  +  E P++EE+R M+ EVD DGDG +  E
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLN-EHPTKEEIREMMHEVDADGDGTVDFE  67


 Score = 33.1 bits (74),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  + +     +   EL++AF  FD D DG ISA EL NV   +
Sbjct  68   EFLSIMARKMKENVAEELKEAFKVFDRDQDGFISAIELRNVMMNL  112



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 54.3 bits (129),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF LID+D DG I  EEL +++  +  E P+ EE++ M+SEVD DGDG +  E
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTVDFE  67


 Score = 32.7 bits (73),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 0/42 (0%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
            EF  + +     +   EL++AF  FD D DG ISA EL NV 
Sbjct  68   EFLGIMARKMKENVGEELKEAFKVFDRDQDGFISAIELKNVM  109



>emb|CDW53538.1| Calmodulin [Trichuris trichiura]
Length=188

 Score = 52.0 bits (123),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I  +
Sbjct  21   AEFQEAFNLFDKDGDGKITSQELGVVMRSLG-QRPTESELRDMVNEVDEDGNGTIEFD  77


 Score = 35.0 bits (79),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD D DG ISA EL  V   +
Sbjct  80   LQMMSRKMKDSDSEQELREAFQVFDKDKDGFISASELHYVMTNL  123



>gb|AFK83800.1| calmodulin [Mnemiopsis leidyi]
Length=149

 Score = 45.1 bits (105),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D DG I   EL  ++  +G + P   +L+ M++EVD DG+G I  
Sbjct  11   AEFREAFSLFDKDGDGTITTTELGTVMKSLG-QSPCESDLQDMINEVDADGNGTIDF  66


 Score = 42.0 bits (97),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              +++       CD ELR+AF  FD D +GKIS +EL  V K +
Sbjct  70   LEMMTKHMKEADCDQELREAFKVFDKDGNGKISQQELKLVMKNL  113



>gb|KFD49502.1| hypothetical protein M513_09613 [Trichuris suis]
 gb|KFD65676.1| hypothetical protein M514_09613 [Trichuris suis]
Length=243

 Score = 52.0 bits (123),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I  +
Sbjct  69   AEFQEAFNLFDKDGDGKITSQELGVVMRSLG-QRPTESELRDMVNEVDEDGNGTIEFD  125


 Score = 34.7 bits (78),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD D DG ISA EL  V   +
Sbjct  128  LQMMSRKMKDSDSEQELREAFQVFDKDKDGFISASELHYVMTNL  171



>gb|KDP21392.1| hypothetical protein JCGZ_21863 [Jatropha curcas]
Length=229

 Score = 55.5 bits (132),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF +ID+D DG I  EEL A++  +    P++EE+R M+SEVD DG+G I  +
Sbjct  11   AEFHEAFSMIDKDSDGFITMEELAAIIQSLDG-HPTKEEVREMISEVDFDGNGTIDFQ  67


 Score = 31.2 bits (69),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +1

Query  424  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  567
            G  T+    +EFS +       +   EL++AF  FD + DG ISA E+
Sbjct  60   GNGTIDF--QEFSNIMGRKMKENVAEELKEAFKVFDRNQDGYISANEI  105


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 5/68 (7%)
 Frame = +3

Query  249  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  428
            IS +E+    AE  +AF +ID+D DG I  EEL A++  +    P++EE+R M+SEVD D
Sbjct  100  ISANEI----AEFHEAFSMIDKDSDGFITMEELAAIIQSLDG-HPTKEEVREMISEVDFD  154

Query  429  GDGCISLE  452
            G+G I  +
Sbjct  155  GNGTIDFQ  162



>ref|XP_002671503.1| predicted protein [Naegleria gruberi]
 gb|EFC38759.1| predicted protein [Naegleria gruberi]
Length=156

 Score = 58.2 bits (139),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            L  EL  AF L D+D DGKI  EEL A+L ++G + PS EEL+LM S+VD+D +G I  E
Sbjct  10   LVNELKDAFSLFDQDGDGKISIEELGAVLKKLG-QCPSAEELQLMFSDVDQDNNGTIEFE  68


 Score = 28.5 bits (62),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            E+R+AF  FD ++DG IS EEL ++  ++
Sbjct  86   EIREAFRVFDKNNDGFISYEELKSMMSSL  114


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            E+ +AF++ D+++DG I  EEL++++S +G E  + +EL  M+ + DRDG+G +  E
Sbjct  86   EIREAFRVFDKNNDGFISYEELKSMMSSLG-ETLTDKELNEMIRQADRDGNGVVDFE  141



>ref|XP_011150176.1| PREDICTED: neo-calmodulin-like isoform X3 [Harpegnathos saltator]
Length=244

 Score = 51.2 bits (121),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  160


 Score = 35.0 bits (79),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  164  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  207



>gb|KGG50401.1| calmodulin [Microsporidia sp. UGP3]
Length=170

 Score = 51.6 bits (122),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 5/89 (6%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLS  362
            G+ + G    P S   A+N      +LS    AEL +AF L D+++DG+I  +EL  ++ 
Sbjct  3    GHARHGRHLGPPS---AVNRSTGQHQLSEEQIAELKEAFSLFDKNNDGRITIQELGRVMH  59

Query  363  QVGAEPPSREELRLMLSEVDRDGDGCISL  449
             +G + PS  E+  ML+EVD DGDG I  
Sbjct  60   ALG-QHPSESEISDMLNEVDADGDGTIDF  87


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        ++EL++AFD FD + DG IS+EEL  V K +
Sbjct  91   LTMMARKVKDVDAEAELKEAFDVFDKNGDGFISSEELALVLKNL  134



>ref|XP_002738868.1| PREDICTED: calmodulin-like [Saccoglossus kowalevskii]
Length=149

 Score = 45.1 bits (105),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  446
             E  + F   D+D DG IRK EL++ ++++G    S  EL  +L+E D DGDG I+
Sbjct  11   VEFSKIFVSFDKDGDGHIRKVELKSAMAKIG-HNASEAELASLLAEADTDGDGAIN  65


 Score = 41.2 bits (95),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              +++     P+ D EL  AF  FDT+ DG+IS EE+F V   +
Sbjct  70   LELMAKKLKEPTTDEELTRAFQVFDTNGDGRISQEEMFLVMNNL  113



>ref|XP_011257081.1| PREDICTED: neo-calmodulin-like isoform X3 [Camponotus floridanus]
Length=244

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  160


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  164  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  207



>gb|EFN67816.1| Calmodulin [Camponotus floridanus]
Length=231

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  92   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  147


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  151  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  194



>ref|XP_011066820.1| PREDICTED: neo-calmodulin-like [Acromyrmex echinatior]
Length=244

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  160


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  164  LQMMSKKMKSADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  207



>gb|EZA54087.1| Calmodulin, partial [Cerapachys biroi]
Length=231

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  92   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  147


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  151  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  194



>ref|XP_011150175.1| PREDICTED: calmodulin-A-like isoform X2 [Harpegnathos saltator]
Length=260

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  176


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  180  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  223



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query  243  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  422
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+ML EVD
Sbjct  7    DSSQPTSLTAEMEEVEKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMML-EVD  65

Query  423  RDGDGCISLE  452
             DGDG I L+
Sbjct  66   TDGDGFIDLK  75


 Score = 40.8 bits (94),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  481  APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +P + + +LR+AF+ +D D +GKISA EL +V K I
Sbjct  86   SPNTVNKDLREAFNLYDKDKNGKISAAELHSVMKGI  121


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  461
            +L +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDG ++ E  +
Sbjct  93   DLREAFNLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDDDGDGSVNFEEFK  151

Query  462  R  464
            +
Sbjct  152  K  152



>ref|XP_011339099.1| PREDICTED: neo-calmodulin-like isoform X3 [Cerapachys biroi]
Length=244

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  160


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  164  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  207



>ref|XP_011150174.1| PREDICTED: calmodulin-beta-like isoform X1 [Harpegnathos saltator]
Length=274

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  190


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  194  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  237



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 50.4 bits (119),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +3

Query  240  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  410
            ND IS       SG   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGASGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  411  SEVDRDGDGCISL  449
            +E D+DGDG I +
Sbjct  64   AEFDKDGDGHIDI  76


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELRDAFD +D D +G IS  EL  V K +
Sbjct  90   ELRDAFDLYDLDKNGLISKSELHEVLKRL  118



>ref|XP_011171909.1| PREDICTED: neo-calmodulin-like [Solenopsis invicta]
Length=261

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  177


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  181  LQMMSKKMKSADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  224



>ref|XP_011257079.1| PREDICTED: calmodulin-beta-like isoform X1 [Camponotus floridanus]
Length=274

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  190


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  194  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  237



>ref|XP_010038682.1| PREDICTED: calmodulin-like protein 11 [Eucalyptus grandis]
Length=148

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            A+  +AF LID+D DG I  EEL  ++  +  E P++EE++ M+SEVD  G+G I  
Sbjct  11   ADFREAFCLIDKDSDGMITMEELATVIQSLD-EHPTKEEVQEMISEVDSVGNGTIDF  66


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (4%)
 Frame = +1

Query  421  IGTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +G  T+  A  EF  +       +   ELR+AF  FD D DG ISA EL NV   +
Sbjct  59   VGNGTIDFA--EFLNIMGRKMKENVAEELREAFKVFDRDQDGYISASELRNVMMNL  112



>ref|XP_006014812.1| PREDICTED: calmodulin [Alligator sinensis]
Length=200

 Score = 53.9 bits (128),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 11/88 (13%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G+KKP  ++T ++      D+++ +++    AE  +AF L D+D DG I  +EL  ++  
Sbjct  41   GFKKPKSQATWSA------DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRS  90

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISL  449
            +G + P+  EL+ M++EVD DG+G I  
Sbjct  91   LG-QNPTEAELQDMINEVDADGNGTIDF  117


 Score = 32.3 bits (72),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G ISA EL +V   +
Sbjct  121  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL  164



>ref|XP_011257080.1| PREDICTED: calmodulin-A-like isoform X2 [Camponotus floridanus]
Length=260

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  176


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  180  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  223



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 50.4 bits (119),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  252  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  431
            S D  +G   EL + F   D++ DG+I  +EL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  432  DGCISLE  452
            DG I +E
Sbjct  71   DGHIDIE  77


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELRDAFD +D D +G IS  EL  V K +
Sbjct  90   ELRDAFDLYDLDKNGLISTSELHEVLKRL  118



>ref|XP_003400211.1| PREDICTED: calmodulin-like [Bombus terrestris]
 ref|XP_003494411.1| PREDICTED: calmodulin-like [Bombus impatiens]
Length=275

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  191


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  195  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  238



>ref|XP_008550049.1| PREDICTED: calmodulin-A-like [Microplitis demolitor]
Length=260

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  176


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        ++ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  180  LQMMSKKMKGADGEAELREAFRVFDKNNDGLISSMELRHVMTNL  223



>ref|XP_011339098.1| PREDICTED: calmodulin-A-like isoform X2 [Cerapachys biroi]
Length=260

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  176


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  180  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  223



>ref|XP_003580040.2| PREDICTED: probable calcium-binding protein CML22 [Brachypodium 
distachyon]
Length=265

 Score = 54.3 bits (129),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL + F+L+DR+ DG+I +EELE  L ++G   P  +EL  M++ +D DGDGC+  E
Sbjct  105  AELSRVFQLLDRNGDGRITREELEDCLGKLGIPVPG-DELAAMIARIDADGDGCVDEE  161


 Score = 31.2 bits (69),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            D ++R+AF  FD + DG I+ EEL  V  ++
Sbjct  191  DEDMREAFRVFDANGDGYITVEELGAVLASL  221



>ref|XP_004151276.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 ref|XP_004172820.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 gb|KGN54524.1| hypothetical protein Csa_4G355130 [Cucumis sativus]
Length=192

 Score = 45.1 bits (105),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +SE+R+ F+FFD D DG+I+AEEL  VF++I
Sbjct  124  ESEMRETFEFFDADQDGRITAEELHGVFRSI  154


 Score = 40.8 bits (94),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  312  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            R ++G + ++ELEA+LS++ +E    EE+ +ML EVD  GDG I LE
Sbjct  68   RGNEGVVSRKELEAILSRIASE----EEVAMMLREVDSGGDGFIRLE  110



>ref|XP_011339096.1| PREDICTED: calmodulin-beta-like isoform X1 [Cerapachys biroi]
 ref|XP_011339097.1| PREDICTED: calmodulin-beta-like isoform X1 [Cerapachys biroi]
Length=274

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  190


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  194  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  237



>ref|XP_006558597.1| PREDICTED: calmodulin-like isoform X4 [Apis mellifera]
Length=254

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  115  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  170


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  174  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  217



>ref|XP_006558598.1| PREDICTED: calmodulin-like isoform X5 [Apis mellifera]
Length=245

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  161


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  165  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  208



>gb|KJB50384.1| hypothetical protein B456_008G168100 [Gossypium raimondii]
Length=195

 Score = 50.4 bits (119),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            EL   FK+ D + DGKI   EL +++  +G + PS EE++ M+ E D DGDG I+ E
Sbjct  50   ELEHIFKMFDANGDGKISSSELASIMGSLGQQ-PSDEEVQKMIKEFDADGDGFINFE  105


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G ISAEEL  V K++
Sbjct  124  LKDAFSVYDLDGNGSISAEELHKVLKSL  151



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score = 48.1 bits (113),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            EL Q F+  D + DGKI   EL +++S +G  P + EEL  M+ EVD DGDG I  +
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLG-HPETEEELAKMVREVDSDGDGFIDFD  98


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P      LRDAF  +D D DG I+AEEL  V +++
Sbjct  110  PAEAMENLRDAFSVYDIDGDGSITAEELHKVMRSL  144



>ref|XP_006558596.1| PREDICTED: calmodulin-like isoform X3 [Apis mellifera]
Length=262

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  123  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  178


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  182  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  225



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 50.1 bits (118),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            L+ + S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E
Sbjct  6    LDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAE  65

Query  417  VDRDGDGCISL  449
             D+DGDG I +
Sbjct  66   FDKDGDGHIDI  76


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELRDAFD +D D +G IS  EL  V K +
Sbjct  90   ELRDAFDLYDLDKNGLISTSELHEVLKRL  118



>ref|XP_006616491.1| PREDICTED: calmodulin-like isoform X5 [Apis dorsata]
Length=245

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  161


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  165  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  208



>ref|XP_006616488.1| PREDICTED: calmodulin-like isoform X2 [Apis dorsata]
Length=268

 Score = 51.6 bits (122),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  129  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  184


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  188  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  231



>ref|XP_006616489.1| PREDICTED: calmodulin-like isoform X3 [Apis dorsata]
Length=262

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  123  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  178


 Score = 34.3 bits (77),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  182  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  225



>gb|EPS62655.1| hypothetical protein M569_12136 [Genlisea aurea]
Length=186

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            EL Q FK  D + DGKI  EEL  +++ +G    + EE+R+M+ EVD DGDG I L
Sbjct  35   ELEQVFKKFDANGDGKISGEELGKIIASLG-HSVTDEEIRIMIQEVDSDGDGFIDL  89


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            LR AFD FD D +G ISAEEL  V +++
Sbjct  109  LRRAFDVFDIDRNGAISAEELRQVLRSL  136



>ref|XP_624589.2| PREDICTED: calmodulin-like isoformX2 [Apis mellifera]
Length=276

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  137  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  192


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  196  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  239



>ref|XP_006616490.1| PREDICTED: calmodulin-like isoform X4 [Apis dorsata]
Length=254

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  115  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  170


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  174  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  217



>ref|XP_007910199.1| PREDICTED: calmodulin-A-like [Callorhinchus milii]
Length=191

 Score = 53.5 bits (127),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +3

Query  198  PGGESTPTSVLPALN-DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            PG  ++ +   P LN D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G 
Sbjct  29   PGATASDSHHTPKLNADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-  83

Query  375  EPPSREELRLMLSEVDRDGDGCISL  449
            + P+  EL+ M++EVD DG+G I  
Sbjct  84   QNPTEAELQDMINEVDADGNGTIDF  108


 Score = 32.0 bits (71),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G ISA EL +V   +
Sbjct  112  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL  155



>ref|XP_006616487.1| PREDICTED: calmodulin-like isoform X1 [Apis dorsata]
Length=276

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  137  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  192


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD + DG IS++EL +V   +
Sbjct  196  LQMMSKKMKGADGEDELREAFRVFDKNKDGLISSKELRHVMTNL  239



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score = 43.9 bits (102),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 1/66 (2%)
 Frame = +3

Query  255  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  434
            P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+M+ EVD DGD
Sbjct  11   PASLTAEMEEVKKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMI-EVDTDGD  69

Query  435  GCISLE  452
            G I L+
Sbjct  70   GFIDLK  75


 Score = 41.6 bits (96),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  481  APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +P + + +LRDAF+ +D D +GKISA EL +V K I
Sbjct  86   SPNTVNKDLRDAFNLYDKDKNGKISAAELHSVMKGI  121



>ref|XP_011150177.1| PREDICTED: neo-calmodulin-like isoform X4 [Harpegnathos saltator]
Length=180

 Score = 50.8 bits (120),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  96


 Score = 34.7 bits (78),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  100  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  143



>gb|EGI57712.1| Calmodulin [Acromyrmex echinatior]
Length=186

 Score = 50.4 bits (119),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  96


 Score = 35.0 bits (79),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  100  LQMMSKKMKSADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  143


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEG  455
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EG
Sbjct  115  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEG  171



>ref|XP_007295339.1| calmodulin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD14220.1| calmodulin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
Length=170

 Score = 47.8 bits (112),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            A L +AF L D D+DG I KEE+ A++  +G   P+  E+  M++EVD D  G + LE
Sbjct  32   AALKEAFALFDSDNDGVITKEEMSAVMKSLGLN-PTMSEIEDMINEVDLDQTGTVDLE  88


 Score = 37.4 bits (85),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 3/54 (6%)
 Frame = +1

Query  427  TATVALASREF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKT  585
            T TV L   EF  ++S    P + + E+R AF+ FD D  G IS EEL  + KT
Sbjct  82   TGTVDL--EEFIKMMSIKSKPSNVEDEMRSAFNVFDKDGSGSISVEELGALMKT  133



>ref|XP_009379268.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
 ref|XP_009347046.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=205

 Score = 44.7 bits (104),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  449
            + ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  450  EGVQRA  467
            +    A
Sbjct  108  DEFMNA  113


 Score = 40.4 bits (93),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +1

Query  469  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
            S  F     DSEL DAF  FDTD +GKISA+EL  V 
Sbjct  126  SVGFGNEEEDSELMDAFRIFDTDKNGKISAKELQRVL  162


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +EL+ AF++ D D +GKI  +EL+ +L  +G +  S  E R M+  VDR+GDG +  E
Sbjct  136  SELMDAFRIFDTDKNGKISAKELQRVLFSLGCKECSLRECRQMIKGVDRNGDGAVDFE  193



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = +3

Query  210  STPT-----SVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            S+PT     S   + N  +S         +L   F+  D + DGKI   EL +++  +G 
Sbjct  20   SSPTAAATNSTFFSRNPSVSSRSRLHFTEDLEHVFRKFDVNGDGKISSSELGSIMGSLG-  78

Query  375  EPPSREELRLMLSEVDRDGDGCISLE  452
            +P + EEL  M+ EVD DGDG I+LE
Sbjct  79   QPATEEELNNMIREVDADGDGHINLE  104


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P      L+DAF  FD D +G I+AEEL NV  +I
Sbjct  116  PNEIIENLKDAFSIFDIDGNGSITAEELHNVMVSI  150



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFD  67


 Score = 33.9 bits (76),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +1

Query  463  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
            +L  A A      EL+ AF  FDTD +G ISAEEL+ V 
Sbjct  76   ILGDALAASV--EELKAAFYVFDTDKNGYISAEELYKVM  112


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  417  VDRDGDGCISLEGVQR  464
            VD DGDG ++ E  QR
Sbjct  132  VDSDGDGFVNFEEFQR  147



>ref|XP_006355093.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=194

 Score = 48.5 bits (114),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  252  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  431
            S D  + +  EL Q FK  D + DGKI   EL ++++ +G  P + EEL  M+ EVD DG
Sbjct  36   SIDSRARIEEELEQVFKKFDMNGDGKICSSELGSIMASLG-NPTTEEELVNMIREVDSDG  94

Query  432  DGCISLE  452
            DG I L+
Sbjct  95   DGFIDLQ  101


 Score = 36.6 bits (83),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D +G ISAEEL  V +++
Sbjct  120  LKDAFSVFDMDKNGSISAEELLTVLRSL  147



>gb|AET05414.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=190

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  33   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  91


 Score = 33.1 bits (74),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D +G I+AEEL  V +++
Sbjct  110  LKDAFAVFDMDGNGSITAEELNTVMRSL  137



>dbj|BAM78547.1| GCaMP7a, partial [synthetic construct]
Length=450

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D DG I  +EL  +L  +G + P+  EL+ M++EVD DGDG I  
Sbjct  312  AEFKEAFSLFDKDGDGTITTKELGTVLRSLG-QNPTEAELQDMINEVDADGDGTIDF  367


 Score = 33.5 bits (75),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D DG ISA EL +V   +
Sbjct  371  LTMMARKMKYTDSEEEIREAFRVFDKDGDGYISAAELRHVMTNL  414



>ref|XP_007298032.1| EF-hand, partial [Stereum hirsutum FP-91666 SS1]
 gb|EIM92830.1| EF-hand, partial [Stereum hirsutum FP-91666 SS1]
Length=177

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
             EL +AF L D+D DG I   EL  ++  +G + P+  ELR M+SEVD DG+G +  
Sbjct  1    TELKEAFSLFDKDGDGTINSHELGTVMRSLG-QNPTDAELRDMISEVDADGNGTVDF  56


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        D ELR AF+ FD D  G ISA EL  V +++
Sbjct  60   LTMMARKMGEKDVDEELRAAFEVFDKDGSGTISAAELKQVMQSL  103



>dbj|GAA42135.2| calmodulin-like protein 1 [Clonorchis sinensis]
Length=153

 Score = 43.1 bits (100),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 2/48 (4%)
 Frame = +1

Query  451  REFSVLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            REF  L +    P  S DS+L+ AFDFFD DHDG I+  EL +V +++
Sbjct  68   REFVELMTPVMTPDRSDDSDLKAAFDFFDKDHDGDITTRELKSVLQSL  115


 Score = 42.0 bits (97),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            EL +AF L D+D DG+I  +EL +++ ++   P + +E R +++EVD++ DG I  
Sbjct  13   ELREAFGLFDKDHDGQITLQELRSMM-KLFNRPCTADEAREIMAEVDKNNDGVIDF  67



>ref|XP_011307674.1| PREDICTED: neo-calmodulin-like isoform X3 [Fopius arisanus]
Length=245

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  161


 Score = 33.5 bits (75),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  165  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSMELRHVMTNL  208



>ref|XP_003630938.1| Calcium-binding pollen allergen [Medicago truncatula]
Length=188

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  31   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  89


 Score = 33.1 bits (74),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D +G I+AEEL  V +++
Sbjct  108  LKDAFAVFDMDGNGSITAEELNTVMRSL  135



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +3

Query  240  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  410
            ND IS       +G   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGAAGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  411  SEVDRDGDGCISL  449
            +E D+DGDG I +
Sbjct  64   AEFDKDGDGHIDI  76


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELRDAFD +D D +G IS  EL  V K +
Sbjct  90   ELRDAFDLYDLDKNGLISKSELHEVLKRL  118



>ref|XP_008229213.1| PREDICTED: probable calcium-binding protein CML23 [Prunus mume]
Length=161

 Score = 47.8 bits (112),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  270  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            G   +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  24   GSREQLETIFNKFDKNGDGKISCDELRDVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83


 Score = 37.4 bits (85),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELRDAFD +D D +G ISA EL  V K +
Sbjct  97   ELRDAFDLYDLDKNGLISASELHEVMKRL  125



>ref|XP_009408507.1| PREDICTED: calmodulin-like protein 11 [Musa acuminata subsp. 
malaccensis]
Length=148

 Score = 47.4 bits (111),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D DG I  EEL  ++  +G + PS EEL  M+ EVD DG+G I  
Sbjct  10   SEFQEAFCLFDKDGDGCITLEELGTVIKSLG-QNPSEEELHEMIREVDSDGNGTIEF  65


 Score = 37.4 bits (85),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             +++S      + + EL++AF  FD D +G ISA EL NV   +
Sbjct  69   LNLMSRKVKETNVEEELKEAFKVFDKDQNGYISASELRNVMMNL  112



>gb|EAY97018.1| hypothetical protein OsI_18939 [Oryza sativa Indica Group]
Length=189

 Score = 47.4 bits (111),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AEL Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDL  90


 Score = 37.7 bits (86),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ++ELR+AF  +D D +GKISA EL  V + +
Sbjct  119  EAELREAFRMYDADSNGKISARELHRVLRQL  149


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 1/65 (2%)
 Frame = +3

Query  258  DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG  437
            D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DGDG
Sbjct  113  DQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADGDG  171

Query  438  CISLE  452
            C++ +
Sbjct  172  CVNFD  176



>ref|XP_011307673.1| PREDICTED: calmodulin-A-like isoform X2 [Fopius arisanus]
Length=261

 Score = 51.2 bits (121),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  177


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  181  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSMELRHVMTNL  224



>ref|XP_011257082.1| PREDICTED: neo-calmodulin-like isoform X4 [Camponotus floridanus]
Length=180

 Score = 50.1 bits (118),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  96


 Score = 34.7 bits (78),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  100  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  143



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score = 50.8 bits (120),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFD  67


 Score = 33.9 bits (76),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +1

Query  463  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
            +L  A A      EL+ AF  FDTD +G ISAEEL+ V 
Sbjct  76   ILGDALAASV--EELKAAFYVFDTDKNGYISAEELYKVM  112


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +3

Query  228  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  407
               LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M
Sbjct  69   FVHLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRM  128

Query  408  LSEVDRDGDGCISLEGVQR  464
            +  VD DGDG ++ E  QR
Sbjct  129  IGGVDSDGDGFVNFEEFQR  147



>ref|XP_008216621.1| PREDICTED: calmodulin-A-like [Nasonia vitripennis]
Length=259

 Score = 51.2 bits (121),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  120  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  175


 Score = 33.9 bits (76),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  179  LQMMSKKMKGAEGEDELREAFRVFDKNNDGLISSVELRHVMTNL  222



>ref|XP_008808019.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=148

 Score = 48.9 bits (115),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D DG+I  EEL  ++  +G + P+ EEL+ M+SEVD +G+G I  
Sbjct  10   SEFQEAFCLFDKDGDGRITLEELATVIRSLG-QNPTEEELQDMISEVDANGNGTIEF  65


 Score = 35.8 bits (81),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
              +++        + EL++AF  FD D +G ISA EL NV 
Sbjct  69   LGLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRNVM  109



>ref|XP_011307672.1| PREDICTED: calmodulin-beta-like isoform X1 [Fopius arisanus]
Length=275

 Score = 51.2 bits (121),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  191


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  195  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSMELRHVMTNL  238



>gb|ELU13700.1| hypothetical protein CAPTEDRAFT_169155 [Capitella teleta]
Length=184

 Score = 50.4 bits (119),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            E  +AF L D+D DG I   EL++++  +G + P+REEL  M++EVD DG+G I  
Sbjct  46   EFKEAFALFDKDGDGTITLHELDSVMRGLG-QNPTREELTQMIAEVDSDGNGSIEF  100


 Score = 34.3 bits (77),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = +1

Query  463  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +++S         E+RDAF  FD ++DG++S  EL +V  ++
Sbjct  106  LIASRLKMEDMREEIRDAFGVFDKNNDGRLSTSELKDVLSSV  147



>gb|AHY86314.1| Y-GECO1 [synthetic construct]
Length=421

 Score = 54.3 bits (129),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D DG +  EEL  +L  +G + PS  ELR M++EVD DGDG I  
Sbjct  283  AEFKEAFSLFDKDGDGTMTTEELGTVLRSLG-QNPSEAELRDMINEVDADGDGTIGF  338


 Score = 30.4 bits (67),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 23/44 (52%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G I A EL +V   +
Sbjct  342  LTMMTRKMNDTDSEEEIREAFRVFDKDGNGYIGAAELRHVMTNL  385



>gb|AHY86315.1| Y-GECO1f [synthetic construct]
Length=420

 Score = 54.3 bits (129),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D DG +  EEL  +L  +G + PS  ELR M++EVD DGDG I  
Sbjct  282  AEFKEAFSLFDKDGDGTMTTEELGTVLRSLG-QNPSEAELRDMINEVDADGDGTIGF  337


 Score = 30.4 bits (67),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 23/44 (52%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G I A EL +V   +
Sbjct  341  LTMMTRKMNDTDSEEEIREAFRVFDKDGNGYIGAAELRHVMTNL  384



>ref|XP_001326924.1| calmodulin [Trichomonas vaginalis G3]
 gb|EAY14701.1| calmodulin, putative [Trichomonas vaginalis G3]
Length=153

 Score = 48.1 bits (113),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF + D+D DG+I  +EL  ++  +G + PS  EL+ M++E+D DG+G I  +
Sbjct  15   AEFREAFNIFDKDGDGRITAKELGTVMRSLG-QNPSEAELQDMINEIDLDGNGTIEFD  71


 Score = 36.6 bits (83),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = +1

Query  463  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +++        + E++DAF  FD D DGKI+A EL ++ K +
Sbjct  76   MMNRQMKEGDTEEEIKDAFRVFDKDGDGKITAAELAHIMKNL  117



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score = 48.9 bits (115),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  270  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            G   E+ + F   D++ DGKI ++EL+++LS +G+ PPS +E+  ++S +D+DG+G + L
Sbjct  6    GSMEEMKEVFNKFDKNGDGKISRDELKSILSALGS-PPSSDEVDRIMSMMDKDGNGYVDL  64

Query  450  E  452
            +
Sbjct  65   D  65


 Score = 35.8 bits (81),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            + EL+DAFD +D D +G ISA EL  V K +
Sbjct  86   NKELKDAFDMYDLDKNGLISANELHAVLKRL  116



>ref|XP_010935758.1| PREDICTED: neo-calmodulin-like [Elaeis guineensis]
 ref|XP_010935767.1| PREDICTED: neo-calmodulin-like [Elaeis guineensis]
Length=148

 Score = 49.3 bits (116),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D DG I  EELE ++  +G + P+ +EL  M+ E+D DG+G I  
Sbjct  10   SEFQEAFSLFDKDGDGCITLEELETVIKSLG-QNPTEDELHEMIKEIDADGNGTIEF  65


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
             S+++        + E+++AF  FD D +G ISA EL NV 
Sbjct  69   LSLMARKMKETDAEEEIKEAFKVFDKDQNGYISASELKNVM  109



>gb|ADD38579.1| Calmodulin [Lepeophtheirus salmonis]
Length=153

 Score = 49.3 bits (116),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I  E
Sbjct  12   AEFKEAFLLFDKDGDGTITTKELATVMRSLG-QNPTEAELQEMINEVDADGNGSIEFE  68


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++         S++++AF  FD D DG ISAEEL  V  T+
Sbjct  71   LAMMAKKVKDNESSSDIKEAFRVFDRDGDGYISAEELHQVMSTL  114



>ref|XP_006654163.1| PREDICTED: probable calcium-binding protein CML18-like [Oryza 
brachyantha]
Length=154

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AEL Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L
Sbjct  4    AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDL  59


 Score = 37.7 bits (86),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ++ELR+AF  +D D +GKISA EL  V + +
Sbjct  83   EAELREAFRMYDADSNGKISARELHRVLRQL  113


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  252  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  431
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  75   AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  133

Query  432  DGCISLE  452
            DGC++ +
Sbjct  134  DGCVNFD  140



>gb|EPS64880.1| hypothetical protein M569_09899 [Genlisea aurea]
Length=155

 Score = 49.3 bits (116),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            E  +AF +IDRD DG I  EELE ++  V  E P++E ++ M++ VD DG+G I  +
Sbjct  12   EFREAFAVIDRDSDGFISVEELELVIRSV-IEHPTKEIIQEMMNHVDADGNGTIDFQ  67


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +1

Query  481  APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
               + D ELR+AF  FD D DG IS  EL NV   +
Sbjct  76   TAKANDVELREAFSVFDRDQDGYISTFELMNVMMNL  111



>ref|XP_011498410.1| PREDICTED: neo-calmodulin-like isoform X2 [Ceratosolen solmsi 
marchali]
Length=235

 Score = 51.2 bits (121),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  96   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  151


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  155  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSVELRHVMTNL  198



>ref|XP_003695096.1| PREDICTED: calmodulin-like [Apis florea]
Length=162

 Score = 50.4 bits (119),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 11/77 (14%)
 Frame = +3

Query  249  ISPDELSGLY----------AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  398
            I P  L G +          AE  +AF L D+D+DG I   EL  ++  +G + PS  EL
Sbjct  3    IQPSLLVGFFSEYGLTEDQVAEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETEL  61

Query  399  RLMLSEVDRDGDGCISL  449
            R M++EVD+DG+G I  
Sbjct  62   RDMVNEVDQDGNGTIEF  78


 Score = 34.3 bits (77),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  82   LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  125



>ref|XP_008791135.1| PREDICTED: calmodulin-like protein 8 [Phoenix dactylifera]
Length=148

 Score = 47.8 bits (112),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D DG I  EEL  ++  +G + P+ +EL  M++E+D DG+G I  
Sbjct  10   SEFQEAFSLFDKDGDGCITLEELATVIKSLG-QNPTEDELHEMITEIDADGNGTIEF  65


 Score = 36.6 bits (83),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
             S+++        + EL++AF  FD D +G ISA EL NV 
Sbjct  69   LSLMARKMKETDAEEELKEAFKVFDKDQNGYISASELKNVM  109



>gb|ACO12252.1| Calmodulin [Lepeophtheirus salmonis]
Length=153

 Score = 49.3 bits (116),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I  E
Sbjct  12   AEFKEAFLLFDKDGDGTITTKELATVMRSLG-QNPTEAELQEMINEVDADGNGSIEFE  68


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++         S++++AF  FD D DG ISAEEL  V  T+
Sbjct  71   LAMMAKKVKDNESSSDVKEAFRVFDRDGDGYISAEELHQVMSTL  114



>ref|XP_504759.1| YALI0E34111p [Yarrowia lipolytica]
 emb|CAG80365.1| YALI0E34111p [Yarrowia lipolytica CLIB122]
Length=152

 Score = 49.3 bits (116),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            ++D+++ D++    AE  +AF L D+++DGKI  +EL  ++  +G + PS  EL  M++E
Sbjct  1    MSDQLTEDQV----AEFREAFSLFDKNNDGKITTKELGTVMRSLG-QNPSESELADMINE  55

Query  417  VDRDGDGCISL  449
            VD + DG I  
Sbjct  56   VDANNDGTIDF  66


 Score = 35.0 bits (79),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D++G ISA+EL +V  +I
Sbjct  70   LTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAQELRHVMTSI  113



>gb|AHA51383.1| EF-hand_1 domain-containing protein, partial [Hormiphora californensis]
Length=166

 Score = 45.8 bits (107),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D DG I  +EL  ++  +G + P+  +L+ M++EVD DG+G I  
Sbjct  27   SEFKEAFSLFDKDSDGTITTQELGTVMKSLG-QNPTDGDLQDMINEVDADGNGTIDF  82


 Score = 38.5 bits (88),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        D ELR+AF  FD D +GKIS+EEL  V + +
Sbjct  86   LTMMTKHMKESDNDQELREAFKVFDKDGNGKISSEELKIVMQNL  129


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            EL +AFK+ D+D +GKI  EEL+ ++  +G E  + EE+  M+ E D DGDG +  E
Sbjct  101  ELREAFKVFDKDGNGKISSEELKIVMQNLG-EKLTDEEINEMIREADNDGDGEVDYE  156



>ref|XP_010917630.1| PREDICTED: calmodulin-like protein 11 [Elaeis guineensis]
Length=148

 Score = 47.4 bits (111),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D DG I  EEL  ++  +G + P+ EEL+ M+SEVD +G+G I  
Sbjct  10   SEFQEAFCLFDKDGDGCITLEELATVIRSLG-QNPTEEELQDMISEVDANGNGTIEF  65


 Score = 37.0 bits (84),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
             S+++        + EL++AF  FD D +G ISA EL NV 
Sbjct  69   LSLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRNVM  109



>gb|EKC24243.1| Calmodulin [Crassostrea gigas]
Length=513

 Score = 51.6 bits (122),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = +3

Query  213  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
            T  S+   + DE+S +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  
Sbjct  135  TRISISATMADELSEEQI----AEFKEAFSLFDKDGDGTICSKELGTVMRSLG-QNPTEA  189

Query  393  ELRLMLSEVDRDGDGCISL  449
            EL+ M++EVD DG+G I  
Sbjct  190  ELQDMINEVDADGNGTIDF  208


 Score = 32.7 bits (73),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             +++S        + ELR+AF  FD D +G ISA EL +V   +
Sbjct  212  LTMMSRKMKDTDSEEELREAFRVFDKDGNGFISAAELRHVMTNL  255


 Score = 51.2 bits (121),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  458
            AEL +AF + D+D DG I   EL++++SQ+G E  + E++  M+ E D+DGDG I+ +G+
Sbjct  63   AELREAFAVFDKDGDGFIGATELQSVMSQLG-ENLTLEDVHSMIREADQDGDGRINYKGI  121

Query  459  QR  464
              
Sbjct  122  HN  123


 Score = 29.6 bits (65),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +E ++AF  FD D DG I ++EL  V +++
Sbjct  153  AEFKEAFSLFDKDGDGTICSKELGTVMRSL  182


 Score = 46.2 bits (108),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (55%), Gaps = 3/84 (4%)
 Frame = +3

Query  204  GESTPTSVLP--ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  377
            G   P+ +L   ++N  ++        AE  +AF L D+D DG I  +EL  ++  +G +
Sbjct  283  GSCDPSDILTISSINFNMAEQLTEEQIAEFKEAFSLFDKDGDGTISSKELGTVMRSLG-Q  341

Query  378  PPSREELRLMLSEVDRDGDGCISL  449
             P+  +L+ M++EVD DG+G I  
Sbjct  342  NPTEADLQDMVNEVDADGNGTIDF  365


 Score = 32.7 bits (73),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + ELR+AF  FD D  G ISA EL +V  ++
Sbjct  369  LTMMARKMKDEDSEEELREAFKVFDKDGSGDISAAELRHVMTSL  412


 Score = 43.1 bits (100),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEG  455
            EL +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EG
Sbjct  227  ELREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEG  283


 Score = 31.6 bits (70),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  SELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +E ++AF  FD D DG IS++EL  V +++
Sbjct  310  AEFKEAFSLFDKDGDGTISSKELGTVMRSL  339



>ref|XP_011498409.1| PREDICTED: neo-calmodulin-like isoform X1 [Ceratosolen solmsi 
marchali]
Length=261

 Score = 50.8 bits (120),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  177


 Score = 33.1 bits (74),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  181  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSVELRHVMTNL  224



>ref|XP_007215081.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
 gb|EMJ16280.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
Length=161

 Score = 48.1 bits (113),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  28   QLETIFNKFDKNGDGKISCDELRGVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83


 Score = 35.8 bits (81),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            ELRDAFD +D D +G IS  EL  V K +
Sbjct  97   ELRDAFDLYDLDKNGLISVSELHEVMKRL  125



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score = 50.1 bits (118),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q F   D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I L+
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELHNMIKEVDADGDGYIDLD  92


 Score = 33.9 bits (76),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G I+AEEL  V K++
Sbjct  111  LKDAFSVYDIDGNGSITAEELHEVLKSL  138



>ref|XP_009405944.1| PREDICTED: neo-calmodulin-like [Musa acuminata subsp. malaccensis]
Length=149

 Score = 45.8 bits (107),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 5/67 (7%)
 Frame = +3

Query  249  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  428
            +S D++S    EL +AF L D+D DG I  EEL  ++  +G + P+ +EL+ M+ EVD +
Sbjct  5    LSTDQIS----ELQEAFCLFDKDGDGCITLEELATVIGSLG-QYPTEQELKDMIREVDIN  59

Query  429  GDGCISL  449
            G+G I  
Sbjct  60   GNGTIEF  66


 Score = 38.5 bits (88),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 3/56 (5%)
 Frame = +1

Query  424  GTATVALASREF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G  T+  A  EF ++++        + ELR+AF  FD D +G ISA EL NV   +
Sbjct  60   GNGTIEFA--EFLNLMARKMKETDAEEELREAFKVFDKDQNGYISASELRNVMTNL  113



>ref|NP_001147205.1| calmodulin [Zea mays]
 gb|ACG26073.1| calmodulin [Zea mays]
Length=226

 Score = 54.7 bits (130),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  270  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            G  AEL + F+L D+D DG+I +EEL   L ++G   P  +EL  M++ VD +GDGC+  
Sbjct  64   GESAELARVFELFDKDGDGRITREELAESLRKLGMGVPGDDELASMMARVDANGDGCVDA  123

Query  450  E  452
            E
Sbjct  124  E  124


 Score = 29.3 bits (64),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +R+AF  FD + DG I+A+EL  V  ++
Sbjct  155  MREAFRVFDANGDGYITADELGAVLSSL  182



>ref|XP_003704227.1| PREDICTED: calmodulin-like [Megachile rotundata]
Length=275

 Score = 48.9 bits (115),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  EL  M++EVD+DG+G I  
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELEDMVNEVDQDGNGTIEF  191


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  195  LQMMSKKMKGADGEKELREAFRVFDKNNDGLISSKELRHVMTNL  238



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score = 50.1 bits (118),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLD  92


 Score = 34.3 bits (77),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G I+AEEL  V K++
Sbjct  111  LKDAFSVYDIDGNGSITAEELHEVLKSL  138



>gb|KFO18269.1| Calmodulin [Fukomys damarensis]
Length=179

 Score = 52.4 bits (124),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = +3

Query  216  PTSVLPALNDEISPDELSGL-------YAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  374
            P + LPA   +  P  L+          AE  +AF L D+D DG I  +EL  ++  +G 
Sbjct  13   PRATLPATTTDADPSTLAAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG-  71

Query  375  EPPSREELRLMLSEVDRDGDGCISL  449
            + P+  EL+ M++EVD DG+G I  
Sbjct  72   QNPTEAELQDMINEVDADGNGTIDF  96


 Score = 32.0 bits (71),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G ISA EL +V   +
Sbjct  100  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL  143



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score = 43.1 bits (100),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +1

Query  451  REFSVLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEEL  567
            +EF+   SA A P  S + ELR+AF+ +D +HDGKISA EL
Sbjct  75   QEFAAFCSAEADPYHSAEKELREAFELYDQNHDGKISAAEL  115


 Score = 40.8 bits (94),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE+ + F   D ++DGKI   EL  +L  +G+E  S +E+  M+ E+D D DG I+L+
Sbjct  19   AEVQKVFDRFDTNNDGKISPGELGGVLKALGSE-SSPDEVARMMGEIDTDKDGNINLQ  75



>ref|XP_005483194.1| PREDICTED: calmodulin [Zonotrichia albicollis]
Length=183

 Score = 52.4 bits (124),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 51/88 (58%), Gaps = 10/88 (11%)
 Frame = +3

Query  186  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  365
            G  +P  +ST TS      D+++ +++    AE  +AF L D+D DG I  +EL  ++  
Sbjct  23   GASQPAFDSTGTSA-----DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRS  73

Query  366  VGAEPPSREELRLMLSEVDRDGDGCISL  449
            +G + P+  EL+ M++EVD DG+G I  
Sbjct  74   LG-QNPTEAELQDMINEVDADGNGTIDF  100


 Score = 31.6 bits (70),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G ISA EL +V   +
Sbjct  104  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL  147



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score = 51.6 bits (122),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +3

Query  267  SGLYAELVQAFKLIDRDDDGKIRKEELEALLS---QVGAEPPSREELRLMLSEVDRDGDG  437
            S + A+L Q F+LID D DGKI   EL  +LS    VGA   + EE R+M+ E+DRDGDG
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGA-AAADEEARVMVKEIDRDGDG  119

Query  438  CISLE  452
             + L+
Sbjct  120  RVDLD  124


 Score = 32.3 bits (72),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  478  FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             A  S D +L DAF  FD + DG ISA+EL  V + +
Sbjct  128  VAVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV  164



>gb|EYU40733.1| hypothetical protein MIMGU_mgv1a014669mg [Erythranthe guttata]
Length=182

 Score = 48.5 bits (114),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            EL Q FK  D + DGKI   EL +++  +G  P + EEL+ M+ EVD DGDG I L
Sbjct  46   ELEQVFKKFDVNGDGKISAAELGSIMGSLG-HPATEEELQTMIREVDADGDGFIDL  100


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF+ FD D +G ISAEEL +V +++
Sbjct  120  LKDAFEVFDIDKNGAISAEELQDVLQSL  147



>gb|ACN35459.1| unknown [Zea mays]
 tpg|DAA37171.1| TPA: calmodulin [Zea mays]
Length=222

 Score = 54.7 bits (130),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL + F+L D+D DG+I +EEL   L ++G   P  +EL  M++ VD +GDGC+  E
Sbjct  67   AELARVFELFDKDGDGRITREELAESLRKLGMGVPGDDELASMMARVDANGDGCVDAE  124


 Score = 29.3 bits (64),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +R+AF  FD + DG I+A+EL  V  ++
Sbjct  151  MREAFRVFDANGDGYITADELGAVLSSL  178



>gb|EFA05282.1| hypothetical protein TcasGA2_TC015439 [Tribolium castaneum]
Length=289

 Score = 56.2 bits (134),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = +3

Query  207  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  386
            E+ P + L A + E+S  ++     E  +AF+L D+D DG I KEEL  ++  +G +   
Sbjct  106  ETKPPTRLSARHSEVSKSQMK----EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFAR  160

Query  387  REELRLMLSEVDRDGDGCISLE  452
             EEL+ ML EVD DGDG +S E
Sbjct  161  TEELQQMLQEVDVDGDGNVSFE  182


 Score = 27.7 bits (60),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            + ELRDAF  FD  + G I+A +L  V + +
Sbjct  207  EKELRDAFRVFDKHNRGYITASDLRAVLQCL  237



>ref|XP_008472657.1| PREDICTED: calmodulin-like [Diaphorina citri]
Length=208

 Score = 49.3 bits (116),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E  +AF L D+D+DGK+   EL  ++  +G + P+  ELR M++EVD+DG+G I  
Sbjct  55   SEFKEAFMLFDKDEDGKVTVAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEF  110


 Score = 34.7 bits (78),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + EL++AF  FD D DGK++  EL  V +++
Sbjct  114  LQMMSKKMKGADGEDELKEAFMLFDKDEDGKVTVAELGVVMRSL  157


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            EL +AF L D+D+DGK+   EL  ++  +G + P+  ELR M++EVD+DG+G I  
Sbjct  129  ELKEAFMLFDKDEDGKVTVAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEF  183



>gb|ACG37753.1| calmodulin [Zea mays]
Length=222

 Score = 54.7 bits (130),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL + F+L D+D DG+I +EEL   L ++G   P  +EL  M++ VD +GDGC+  E
Sbjct  67   AELARVFELFDKDGDGRITREELAESLRKLGMGVPGDDELASMMARVDANGDGCVDAE  124


 Score = 29.3 bits (64),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +R+AF  FD + DG I+A+EL  V  ++
Sbjct  151  MREAFRVFDANGDGYITADELGAVLSSL  178



>ref|XP_002734090.1| PREDICTED: calmodulin-like [Saccoglossus kowalevskii]
Length=149

 Score = 46.2 bits (108),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            + +E+S ++L     E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct  1    MAEEVSEEQLK----EFREAFALFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINE  55

Query  417  VDRDGDGCISLE  452
            VD DG+G I  +
Sbjct  56   VDADGNGTIDFQ  67


 Score = 37.7 bits (86),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +1

Query  451  REFSVL-SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +EF+V+ +        + ELR+AF  FD + DG ISAEEL +V K +
Sbjct  67   QEFNVMMAKKMKETDQEEELREAFRVFDKNGDGFISAEELRHVMKNL  113



>ref|XP_004960644.1| PREDICTED: probable calcium-binding protein CML18-like [Setaria 
italica]
Length=179

 Score = 45.4 bits (106),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE+ Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L
Sbjct  30   AEVEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDADRDGFVDL  85


 Score = 38.5 bits (88),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  490  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            + ++ELR+AF  +D DH+G ISA EL  V + +
Sbjct  108  ATEAELREAFRMYDADHNGLISARELHRVLRQL  140



>ref|XP_006443961.1| hypothetical protein CICLE_v10022698mg [Citrus clementina]
 ref|XP_006479630.1| PREDICTED: calmodulin-like [Citrus sinensis]
 gb|ESR57201.1| hypothetical protein CICLE_v10022698mg [Citrus clementina]
 gb|KDO68611.1| hypothetical protein CISIN_1g032008mg [Citrus sinensis]
Length=149

 Score = 49.3 bits (116),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            + D ++ D++    AE  +AF +ID+D DG I  ++L  ++     E P +EE++ M+SE
Sbjct  1    MADALTEDQI----AEFQEAFCMIDKDSDGLITMKDLATVIQSAQDEHPRKEEVQEMISE  56

Query  417  VDRDGDGCISL  449
            VD DG+G I  
Sbjct  57   VDFDGNGSIDF  67


 Score = 34.7 bits (78),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 0/45 (0%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  +       +   EL++AF  FD D DG ISA EL NV   +
Sbjct  69   EFLTIMGRKMKENVSEELKEAFKVFDRDQDGFISAAELRNVMMNL  113


 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  461
            EL +AFK+ DRD DG I   EL  ++  +G E  S EE   M+ E D DGDG +S E   
Sbjct  85   ELKEAFKVFDRDQDGFISAAELRNVMMNLG-ERLSDEETEQMIREADLDGDGLVSFEEFA  143

Query  462  R  464
            R
Sbjct  144  R  144



>gb|KJB08532.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
 gb|KJB08533.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
Length=154

 Score = 48.1 bits (113),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +3

Query  270  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            G   E+ + F   D++ DGKI ++EL+++L+ +G+ P S E  R+M SE+D+DG+G + L
Sbjct  6    GSVEEMKKVFNKFDKNGDGKISRDELKSVLTALGSAPSSGEVDRIM-SEMDKDGNGYVDL  64

Query  450  E  452
            +
Sbjct  65   D  65


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            + EL+DAFD +D D +G ISA EL  V K +
Sbjct  86   NKELKDAFDMYDLDKNGLISANELHAVLKRL  116



>ref|XP_008343178.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=205

 Score = 44.7 bits (104),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  449
            + ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  450  EGVQRA  467
            +    A
Sbjct  108  DEFMNA  113


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  469  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            S  F     D EL DAF  FDTD +GKISA+EL  V  ++
Sbjct  126  SVGFGNEEEDCELMDAFRIFDTDKNGKISAKELQRVLVSL  165


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
             EL+ AF++ D D +GKI  +EL+ +L  +G +  S  E R M+  VDR+GDG +  E
Sbjct  136  CELMDAFRIFDTDKNGKISAKELQRVLVSLGCKECSLRECRQMIKGVDRNGDGAVDFE  193



>gb|ABK21927.1| unknown [Picea sitchensis]
Length=149

 Score = 48.9 bits (115),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L DRD DG I  +EL  ++  +G + P+  E++ M++EVD DG+G I  
Sbjct  11   AEFREAFSLFDRDGDGSITTKELSTVIRSLG-QNPTEAEIQDMINEVDTDGNGTIDF  66


 Score = 34.7 bits (78),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 1/44 (2%)
 Frame = +1

Query  451  REF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
            REF  +++        D ELR+AF  FD D +G ISA EL +V 
Sbjct  67   REFLDLMAHKIKDLDSDEELREAFKVFDKDQNGYISAAELRHVM  110



>emb|CDP19328.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 51.6 bits (122),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF LIDRD DG I   EL A++  +  E P++EE++ M+ EVD DG+G I  E
Sbjct  11   AEFREAFCLIDRDSDGFITIAELAAVIQSLH-ERPTKEEIQEMVHEVDADGNGSIDFE  67


 Score = 32.0 bits (71),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  502  ELRDAFDFFDTDHDGKISAEELFNVF  579
            EL +AF  FD D DG ISA EL NV 
Sbjct  84   ELNEAFKVFDRDQDGFISANELRNVM  109



>ref|XP_003372739.1| EF hand domain containing protein [Trichinella spiralis]
 gb|EFV53117.1| EF hand domain containing protein [Trichinella spiralis]
Length=239

 Score = 51.2 bits (121),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I  +
Sbjct  101  AEFQEAFNLFDKDGDGKITSQELGIVMRSLG-QRPTESELRDMVNEVDEDGNGTIEFD  157


 Score = 32.7 bits (73),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + EL++AF  FD D DG ISA EL  V   +
Sbjct  160  LQMMSRKMKDSDSEQELKEAFQVFDKDKDGFISAAELHYVMTNL  203



>ref|XP_007160425.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
 gb|ESW32419.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
Length=188

 Score = 50.4 bits (119),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +  EL Q FK  D + DGKI   EL +++  +G E  + +E+  M+ EVD DGDGCISL+
Sbjct  32   MAGELEQVFKKFDVNGDGKISASELGSIMRSLGQEA-TEQEVDNMIREVDGDGDGCISLQ  90


 Score = 33.1 bits (74),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  FD D +G I+AEEL  V +++
Sbjct  109  LKDAFSVFDMDGNGLITAEELNTVMRSL  136



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score = 46.2 bits (108),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            +E+ + F   D + DGKI   EL++LL  +G+E  S EE++ M+ E+D+DGDG + L
Sbjct  5    SEIERIFSKFDANGDGKISATELKSLLQALGSE-TSTEEVKKMMEEMDKDGDGFVDL  60


 Score = 37.4 bits (85),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF   S   A  +   EL +AF  +D D +GKISA EL++V K++
Sbjct  65   EFHAGSGGNAGST--KELEEAFRLYDKDGNGKISARELYDVLKSL  107



>ref|XP_004139379.1| PREDICTED: calmodulin-like protein 8-like [Cucumis sativus]
Length=167

 Score = 43.9 bits (102),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 47/83 (57%), Gaps = 4/83 (5%)
 Frame = +3

Query  201  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  380
            G  S+P  +   L+  +S +++    +E  +AF L+D+D DG I   EL   +  +    
Sbjct  6    GNISSPNKLSVLLHYIMSEEQI---ISEFQEAFCLLDKDGDGCITINELATAIRSL-HHN  61

Query  381  PSREELRLMLSEVDRDGDGCISL  449
            P+ EEL++M++EVD +G+G I  
Sbjct  62   PTEEELQIMMNEVDVNGNGYIEF  84


 Score = 39.7 bits (91),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  579
            F++++        + ELR+AF  FD D DGKIS  EL NV 
Sbjct  88   FNLMAKKMKENEAEDELREAFKVFDMDDDGKISPNELKNVM  128



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score = 49.7 bits (117),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+
Sbjct  18   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLD  74


 Score = 33.9 bits (76),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  505  LRDAFDFFDTDHDGKISAEELFNVFKTI  588
            L+DAF  +D D +G I+AEEL  V K++
Sbjct  93   LKDAFSVYDIDGNGSITAEELHEVLKSL  120



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score = 43.1 bits (100),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            E+ + F+  D + DGKI   EL+ +L+ +G +    E  R+ML EVD DGDG I LE
Sbjct  10   EVEKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMML-EVDTDGDGFIDLE  65


 Score = 40.4 bits (93),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = +1

Query  472  SAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            +AF  P   S   +LRDAFD +D D +GKISA EL +V K I
Sbjct  68   AAFHCPVEGSNSKDLRDAFDLYDKDKNGKISASELHSVMKGI  109



>gb|KIW16124.1| calmodulin [Exophiala spinifera]
Length=209

 Score = 50.4 bits (119),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 5/87 (6%)
 Frame = +3

Query  189  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  368
            Y       +  + LP + D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +
Sbjct  45   YHSIATTDSSFARLPNMADSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSL  100

Query  369  GAEPPSREELRLMLSEVDRDGDGCISL  449
            G + PS  EL+ M++EVD D +G I  
Sbjct  101  G-QNPSESELQDMINEVDADNNGTIDF  126


 Score = 33.1 bits (74),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D++G ISA EL +V  +I
Sbjct  130  LTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSI  173



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score = 50.8 bits (120),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +3

Query  267  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  440
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  60

Query  441  ISLE  452
            + L+
Sbjct  61   VDLD  64


 Score = 32.7 bits (73),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  478  FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             A  S D +L DAF  FD + DG ISA+EL  V + +
Sbjct  68   VAVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV  104



>ref|XP_004867158.1| PREDICTED: calmodulin isoform X3 [Heterocephalus glaber]
Length=158

 Score = 51.2 bits (121),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +3

Query  216  PTSVLPALN-DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  392
              S+LPA   D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  
Sbjct  2    TNSLLPAFQADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEA  56

Query  393  ELRLMLSEVDRDGDGCISL  449
            EL+ M++EVD DG+G I  
Sbjct  57   ELQDMINEVDADGNGTIDF  75


 Score = 32.0 bits (71),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G ISA EL +V   +
Sbjct  79   LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL  122



>ref|XP_004308823.1| PREDICTED: calmodulin-5/6/7/8-like [Fragaria vesca subsp. vesca]
Length=195

 Score = 51.2 bits (121),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +3

Query  234  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  413
            ++ D++SPD+ S    E  +AF L D+D DG I  +EL  ++  +G + P+ EEL+ M++
Sbjct  5    SVADQLSPDQKS----EFKEAFGLFDKDGDGSITTKELGTVMRSLG-QNPTEEELQDMIN  59

Query  414  EVDRDGDGCI  443
            EVD DG G +
Sbjct  60   EVDADGSGTV  69


 Score = 32.0 bits (71),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 3/56 (5%)
 Frame = +1

Query  424  GTATVALASREF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            G+ TV    +EF  +++        D +L++AF  FD D +G ISA EL +V   +
Sbjct  65   GSGTVEC--QEFLELMAKKIKGTDSDEQLKEAFRVFDKDQNGFISAAELRHVLTNL  118



>ref|XP_008197240.1| PREDICTED: neo-calmodulin-like isoform X2 [Tribolium castaneum]
Length=260

 Score = 50.1 bits (118),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I  
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEF  176


 Score = 33.1 bits (74),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + EL++AF  FD ++DG IS+ EL +V  ++
Sbjct  180  LQMMSKKLKDADGEEELKEAFRVFDKNNDGLISSNELRHVMTSL  223



>gb|EFZ10130.1| hypothetical protein SINV_07599 [Solenopsis invicta]
Length=167

 Score = 48.9 bits (115),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  267  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  446
            + + +E  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I 
Sbjct  9    NSIISEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIE  67

Query  447  L  449
             
Sbjct  68   F  68


 Score = 34.3 bits (77),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS++EL +V   +
Sbjct  72   LQMMSKKMKSADGEDELREAFRVFDKNNDGLISSKELRHVMTNL  115



>ref|XP_971297.2| PREDICTED: neo-calmodulin-like isoform X3 [Tribolium castaneum]
Length=246

 Score = 50.1 bits (118),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I  
Sbjct  107  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEF  162


 Score = 33.1 bits (74),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + EL++AF  FD ++DG IS+ EL +V  ++
Sbjct  166  LQMMSKKLKDADGEEELKEAFRVFDKNNDGLISSNELRHVMTSL  209



>ref|XP_002721725.1| PREDICTED: calmodulin-like protein 3 [Oryctolagus cuniculus]
Length=149

 Score = 52.4 bits (124),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +3

Query  237  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  416
            + +E+SP+++    AE  QAF   D++ DG I  EEL A++  +G +  S EEL+ +++ 
Sbjct  1    MAEELSPEQV----AEFKQAFSRFDKNGDGTISVEELGAVMQLLG-KKLSEEELKALITR  55

Query  417  VDRDGDGCISLE  452
            VD+DGDG IS +
Sbjct  56   VDKDGDGAISFQ  67


 Score = 30.8 bits (68),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 1/51 (2%)
 Frame = +1

Query  439  ALASREF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            A++ +EF + +         + +LR+AF  FD + DG IS EEL  V   +
Sbjct  63   AISFQEFLAEMVRMMKAGGSEQDLREAFRAFDLNGDGHISVEELKQVMSKL  113



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score = 47.0 bits (110),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  282  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
            +L   F+  D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I+LE
Sbjct  46   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELDNMIREVDADGDGHINLE  101


 Score = 36.2 bits (82),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            P      L+DAF  FD D +G ISAEEL NV  ++
Sbjct  113  PNEILENLKDAFSVFDIDKNGSISAEELHNVMVSL  147



>ref|XP_011498411.1| PREDICTED: neo-calmodulin-like isoform X3 [Ceratosolen solmsi 
marchali]
Length=180

 Score = 49.7 bits (117),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I  
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEF  96


 Score = 33.1 bits (74),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  100  LQMMSKKMKGADGEDELREAFRVFDKNNDGLISSVELRHVMTNL  143



>ref|XP_006402687.1| hypothetical protein EUTSA_v10006367mg [Eutrema salsugineum]
 gb|ESQ44140.1| hypothetical protein EUTSA_v10006367mg [Eutrema salsugineum]
Length=201

 Score = 43.1 bits (100),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  452
             +L + F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + 
Sbjct  52   VDLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPEKDLIQ-MIQKMDANGDGCVDIH  108


 Score = 40.0 bits (92),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +1

Query  454  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            EF  L S+      D ++RDAF+ FD D DG I+ EEL +V  ++
Sbjct  109  EFESLYSSIVEEKVDEDMRDAFNVFDQDGDGYITVEELKSVMASL  153



>ref|XP_004923690.1| PREDICTED: calmodulin-like [Bombyx mori]
Length=240

 Score = 50.4 bits (119),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  279  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  449
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M+ EVD+DG+G I  
Sbjct  101  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVKEVDQDGNGTIEF  156


 Score = 32.7 bits (73),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
              ++S        + ELR+AF  FD ++DG IS+ EL +V   +
Sbjct  160  LQMMSKKMRGADGEDELREAFRVFDKNNDGLISSVELRHVMTNL  203



>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-d380y, Qp(linker 
1), Lp(linker 2)
Length=448

 Score = 50.8 bits (120),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +3

Query  255  PDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  431
            PD+L+    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG
Sbjct  301  PDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADG  359

Query  432  DGCISL  449
            DG I  
Sbjct  360  DGTIDF  365


 Score = 32.0 bits (71),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)
 Frame = +1

Query  457  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
             ++++        + E+R+AF  FD D +G ISA EL +V   +
Sbjct  369  LTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL  412



>ref|XP_966558.2| PREDICTED: neo-calmodulin-like [Tribolium castaneum]
 ref|XP_008194563.1| PREDICTED: neo-calmodulin-like [Tribolium castaneum]
Length=206

 Score = 56.2 bits (134),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = +3

Query  207  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  386
            E+ P + L A + E+S  ++     E  +AF+L D+D DG I KEEL  ++  +G +   
Sbjct  23   ETKPPTRLSARHSEVSKSQMK----EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFAR  77

Query  387  REELRLMLSEVDRDGDGCISLE  452
             EEL+ ML EVD DGDG +S E
Sbjct  78   TEELQQMLQEVDVDGDGNVSFE  99


 Score = 26.9 bits (58),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +1

Query  496  DSELRDAFDFFDTDHDGKISAEELFNVFKTI  588
            + ELRDAF  FD  + G I+A +L  V + +
Sbjct  124  EKELRDAFRVFDKHNRGYITASDLRAVLQCL  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925