BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF015M01

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782722.1|  PREDICTED: non-specific lipid transfer prote...    147   2e-40   Nicotiana sylvestris
ref|XP_009621610.1|  PREDICTED: non-specific lipid transfer prote...    146   5e-40   Nicotiana tomentosiformis
gb|AFK48078.1|  unknown                                                 134   1e-35   Lotus japonicus
ref|XP_006352184.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   1e-35   Solanum tuberosum [potatoes]
ref|XP_002277578.1|  PREDICTED: non-specific lipid transfer prote...    134   2e-35   Vitis vinifera
ref|XP_004239214.1|  PREDICTED: non-specific lipid transfer prote...    133   3e-35   Solanum lycopersicum
emb|CAN67019.1|  hypothetical protein VITISV_027707                     133   6e-35   Vitis vinifera
ref|XP_006368883.1|  hypothetical protein POPTR_0001s13860g             132   2e-34   
ref|XP_010102693.1|  hypothetical protein L484_015489                   131   3e-34   Morus notabilis
gb|KGN51666.1|  hypothetical protein Csa_5G589340                       130   5e-34   Cucumis sativus [cucumbers]
ref|XP_004135333.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   6e-34   
ref|XP_011020739.1|  PREDICTED: non-specific lipid transfer prote...    130   6e-34   Populus euphratica
ref|XP_007163769.1|  hypothetical protein PHAVU_001G262400g             130   6e-34   Phaseolus vulgaris [French bean]
ref|XP_002514908.1|  lipid binding protein, putative                    129   1e-33   Ricinus communis
ref|XP_002303794.2|  GPI-anchored protein precursor                     129   1e-33   
ref|XP_010249032.1|  PREDICTED: non-specific lipid transfer prote...    129   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002890752.1|  hypothetical protein ARALYDRAFT_890328             129   2e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_008446028.1|  PREDICTED: non-specific lipid transfer prote...    129   2e-33   Cucumis melo [Oriental melon]
emb|CDP13346.1|  unnamed protein product                                128   3e-33   Coffea canephora [robusta coffee]
ref|XP_004159693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    128   3e-33   
ref|NP_001265899.1|  uncharacterized protein LOC101506326 precursor     128   3e-33   Cicer arietinum [garbanzo]
ref|XP_008340225.1|  PREDICTED: non-specific lipid transfer prote...    128   4e-33   
ref|XP_010460563.1|  PREDICTED: non-specific lipid transfer prote...    128   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008801676.1|  PREDICTED: non-specific lipid transfer prote...    127   5e-33   Phoenix dactylifera
gb|AAM62634.1|  lipid transfer protein, putative                        128   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174116.1|  glycosylphosphatidylinositol-anchored lipid pro...    127   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499289.1|  PREDICTED: non-specific lipid transfer prote...    127   7e-33   Camelina sativa [gold-of-pleasure]
gb|KHN44444.1|  Putative GPI-anchored protein                           125   4e-32   Glycine soja [wild soybean]
ref|NP_001235887.1|  uncharacterized protein LOC100499777 precursor     125   5e-32   Glycine max [soybeans]
ref|XP_009372275.1|  PREDICTED: non-specific lipid transfer prote...    125   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_009113721.1|  PREDICTED: non-specific lipid transfer prote...    124   7e-32   Brassica rapa
ref|XP_008389894.1|  PREDICTED: non-specific lipid transfer prote...    124   8e-32   
emb|CDY27641.1|  BnaA09g27660D                                          124   8e-32   Brassica napus [oilseed rape]
ref|XP_010540409.1|  PREDICTED: non-specific lipid transfer prote...    124   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_009412766.1|  PREDICTED: non-specific lipid transfer prote...    123   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN24060.1|  Putative GPI-anchored protein                           124   2e-31   Glycine soja [wild soybean]
ref|NP_001235727.1|  uncharacterized protein LOC100305718 precursor     124   2e-31   Glycine max [soybeans]
ref|XP_006305638.1|  hypothetical protein CARUB_v10010343mg             124   2e-31   Capsella rubella
ref|XP_011086802.1|  PREDICTED: non-specific lipid transfer prote...    124   3e-31   Sesamum indicum [beniseed]
ref|XP_007225920.1|  hypothetical protein PRUPE_ppa012022mg             122   4e-31   Prunus persica
emb|CDY60398.1|  BnaCnng36210D                                          122   7e-31   Brassica napus [oilseed rape]
gb|KDP26810.1|  hypothetical protein JCGZ_17968                         122   7e-31   Jatropha curcas
ref|XP_010478148.1|  PREDICTED: non-specific lipid transfer prote...    122   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008222168.1|  PREDICTED: non-specific lipid transfer prote...    122   1e-30   Prunus mume [ume]
ref|XP_003524896.2|  PREDICTED: uncharacterized GPI-anchored prot...    120   2e-30   Glycine max [soybeans]
emb|CDY03956.1|  BnaC07g11810D                                          121   2e-30   
gb|KHN34821.1|  Putative GPI-anchored protein                           120   2e-30   Glycine soja [wild soybean]
gb|EYU33443.1|  hypothetical protein MIMGU_mgv1a014418mg                120   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_010044816.1|  PREDICTED: non-specific lipid transfer prote...    120   4e-30   
ref|XP_004974009.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   6e-30   Setaria italica
gb|KCW86921.1|  hypothetical protein EUGRSUZ_B03498                     120   7e-30   Eucalyptus grandis [rose gum]
ref|XP_003601770.1|  Non-specific lipid-transfer protein                119   7e-30   Medicago truncatula
gb|AFK34697.1|  unknown                                                 119   8e-30   Medicago truncatula
ref|XP_011002127.1|  PREDICTED: non-specific lipid transfer prote...    119   1e-29   Populus euphratica
ref|XP_009109768.1|  PREDICTED: non-specific lipid transfer prote...    118   2e-29   Brassica rapa
ref|XP_002299306.1|  GPI-anchored protein precursor                     119   2e-29   
ref|XP_010549290.1|  PREDICTED: non-specific lipid transfer prote...    118   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_010250696.1|  PREDICTED: non-specific lipid transfer prote...    117   6e-29   Nelumbo nucifera [Indian lotus]
gb|KJB15533.1|  hypothetical protein B456_002G183100                    117   7e-29   Gossypium raimondii
gb|KHG23710.1|  hypothetical protein F383_10500                         117   7e-29   Gossypium arboreum [tree cotton]
gb|AGC08431.1|  lipid transfer protein                                  115   1e-28   Gossypium hirsutum [American cotton]
gb|KFK44671.1|  hypothetical protein AALP_AA1G288600                    115   2e-28   Arabis alpina [alpine rockcress]
emb|CDY11759.1|  BnaC03g58190D                                          115   4e-28   Brassica napus [oilseed rape]
ref|XP_010926816.1|  PREDICTED: non-specific lipid transfer prote...    113   3e-27   
ref|XP_006415714.1|  hypothetical protein EUTSA_v10008820mg             112   3e-27   Eutrema salsugineum [saltwater cress]
gb|KDO81894.1|  hypothetical protein CISIN_1g029795mg                   110   2e-26   Citrus sinensis [apfelsine]
ref|NP_001062343.1|  Os08g0532800                                       110   2e-26   
gb|EAZ07773.1|  hypothetical protein OsI_30026                          110   2e-26   Oryza sativa Indica Group [Indian rice]
gb|AGT16035.1|  lipid transfer protein                                  108   8e-26   Saccharum hybrid cultivar R570
dbj|BAD11656.1|  lipid transfer protein-like                            108   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411202.1|  PREDICTED: non-specific lipid transfer prote...    107   1e-25   
ref|XP_007044002.1|  Glycosylphosphatidylinositol-anchored lipid ...    108   2e-25   
ref|NP_001150532.1|  lipid transfer protein precursor                   107   3e-25   Zea mays [maize]
ref|XP_002444694.1|  hypothetical protein SORBIDRAFT_07g026120          105   2e-24   Sorghum bicolor [broomcorn]
ref|XP_010682757.1|  PREDICTED: non-specific lipid transfer prote...    105   2e-24   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ85750.1|  predicted protein                                      104   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB15532.1|  hypothetical protein B456_002G183100                    103   5e-24   Gossypium raimondii
ref|XP_004310085.1|  PREDICTED: non-specific lipid transfer prote...    103   8e-24   Fragaria vesca subsp. vesca
gb|ACG24900.1|  lipid transfer protein                                  103   8e-24   Zea mays [maize]
ref|NP_001130434.1|  uncharacterized protein LOC100191531 precursor     101   5e-23   Zea mays [maize]
ref|XP_007158680.1|  hypothetical protein PHAVU_002G173300g             101   5e-23   Phaseolus vulgaris [French bean]
ref|XP_006484108.1|  PREDICTED: uncharacterized GPI-anchored prot...  99.8    3e-22   Citrus sinensis [apfelsine]
gb|ABI81469.1|  lipid transfer protein-like protein                   97.4    3e-22   Noccaea caerulescens
tpg|DAA48230.1|  TPA: putative bifunctional inhibitor/LTP/seed st...    100   7e-22   
gb|KJB15530.1|  hypothetical protein B456_002G183100                  96.7    8e-22   Gossypium raimondii
gb|KJB15531.1|  hypothetical protein B456_002G183100                  96.3    2e-21   Gossypium raimondii
emb|CDY15701.1|  BnaA07g08720D                                        95.1    3e-21   Brassica napus [oilseed rape]
gb|ACF78638.1|  unknown                                               94.0    1e-20   Zea mays [maize]
gb|KJB78080.1|  hypothetical protein B456_012G176200                  94.7    2e-20   Gossypium raimondii
ref|XP_008368324.1|  PREDICTED: non-specific lipid transfer prote...  91.3    7e-20   
ref|XP_007044003.1|  Glycosylphosphatidylinositol-anchored lipid ...  89.7    1e-18   
ref|XP_003572451.2|  PREDICTED: non-specific lipid transfer prote...  90.1    2e-18   
ref|XP_006848247.1|  hypothetical protein AMTR_s00013p00038620        89.0    2e-18   Amborella trichopoda
ref|XP_006660326.1|  PREDICTED: protein YLS3-like                     83.6    7e-17   Oryza brachyantha
gb|ACG28264.1|  lipid transfer protein                                80.1    1e-15   Zea mays [maize]
gb|EMT23392.1|  hypothetical protein F775_32194                       79.7    2e-15   
ref|XP_011086771.1|  PREDICTED: protein YLS3-like                     73.6    8e-13   Sesamum indicum [beniseed]
ref|XP_010934234.1|  PREDICTED: protein YLS3-like isoform X1          72.0    3e-12   Elaeis guineensis
gb|ABR16730.1|  unknown                                               71.2    5e-12   Picea sitchensis
ref|XP_011009645.1|  PREDICTED: protein YLS3-like                     70.1    1e-11   Populus euphratica
ref|XP_010088879.1|  hypothetical protein L484_020867                 70.1    1e-11   Morus notabilis
dbj|BAJ95766.1|  predicted protein                                    69.3    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004135899.1|  PREDICTED: uncharacterized GPI-anchored prot...  68.9    3e-11   Cucumis sativus [cucumbers]
gb|KGN58452.1|  hypothetical protein Csa_3G645900                     67.8    4e-11   Cucumis sativus [cucumbers]
ref|XP_004158216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.2    5e-11   
ref|XP_006369483.1|  hypothetical protein POPTR_0001s23850g           67.8    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003561314.1|  PREDICTED: protein YLS3-like isoform X2          66.6    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_004985580.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    2e-10   Setaria italica
ref|XP_007203697.1|  hypothetical protein PRUPE_ppa022009mg           66.2    2e-10   Prunus persica
gb|ABK22783.1|  unknown                                               65.9    3e-10   Picea sitchensis
ref|XP_009397688.1|  PREDICTED: protein YLS3-like                     65.9    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011093401.1|  PREDICTED: protein YLS3-like                     65.9    3e-10   Sesamum indicum [beniseed]
emb|CBI16491.3|  unnamed protein product                              65.5    3e-10   Vitis vinifera
gb|KFK37241.1|  hypothetical protein AALP_AA4G232200                  65.9    3e-10   Arabis alpina [alpine rockcress]
ref|XP_006369482.1|  hypothetical protein POPTR_0001s23850g           65.5    4e-10   
ref|XP_002283442.1|  PREDICTED: protein YLS3-like                     65.5    4e-10   Vitis vinifera
ref|XP_010506351.1|  PREDICTED: protein YLS3-like                     65.5    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010518028.1|  PREDICTED: protein YLS3-like                     65.5    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010917572.1|  PREDICTED: protein YLS3-like                     65.1    5e-10   Elaeis guineensis
gb|EPS62245.1|  non-specific lipid-transfer protein                   64.3    5e-10   Genlisea aurea
gb|KDP32327.1|  hypothetical protein JCGZ_13252                       65.1    6e-10   Jatropha curcas
ref|XP_008803424.1|  PREDICTED: protein YLS3-like                     65.1    6e-10   Phoenix dactylifera
ref|XP_010541739.1|  PREDICTED: protein YLS3-like                     64.7    7e-10   Tarenaya hassleriana [spider flower]
ref|XP_002299127.1|  hypothetical protein POPTR_0001s04590g           64.3    9e-10   Populus trichocarpa [western balsam poplar]
gb|EYU25912.1|  hypothetical protein MIMGU_mgv1a017757mg              64.3    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_007013274.1|  Bifunctional inhibitor/lipid-transfer protei...  64.3    1e-09   
gb|EEC74584.1|  hypothetical protein OsI_10163                        63.9    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006295014.1|  hypothetical protein CARUB_v10024085mg           63.9    2e-09   Capsella rubella
ref|XP_010508309.1|  PREDICTED: protein YLS3-like                     63.9    2e-09   Camelina sativa [gold-of-pleasure]
gb|ABF94168.1|  Protease inhibitor/seed storage/LTP family protei...  63.9    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558736.1|  PREDICTED: protein YLS3-like                     63.9    2e-09   Brachypodium distachyon [annual false brome]
ref|NP_181958.1|  bifunctional inhibitor/lipid-transfer protein/s...  63.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802527.1|  PREDICTED: protein YLS3-like                     62.8    3e-09   Phoenix dactylifera
ref|XP_004241629.2|  PREDICTED: protein YLS3-like                     62.8    4e-09   Solanum lycopersicum
ref|XP_006476107.1|  PREDICTED: protein YLS3-like                     63.2    4e-09   
ref|XP_008242742.1|  PREDICTED: protein YLS3-like                     62.8    4e-09   Prunus mume [ume]
ref|XP_006365420.1|  PREDICTED: uncharacterized GPI-anchored prot...  63.9    4e-09   
ref|XP_006451053.1|  hypothetical protein CICLE_v10010697mg           62.8    4e-09   Citrus clementina [clementine]
ref|XP_009602101.1|  PREDICTED: protein YLS3-like                     62.4    4e-09   Nicotiana tomentosiformis
ref|XP_002515567.1|  lipid binding protein, putative                  62.4    5e-09   Ricinus communis
ref|XP_010934252.1|  PREDICTED: protein YLS3                          62.8    5e-09   Elaeis guineensis
ref|XP_009781023.1|  PREDICTED: protein YLS3-like                     62.4    5e-09   Nicotiana sylvestris
ref|XP_002281585.1|  PREDICTED: protein YLS3                          62.4    5e-09   Vitis vinifera
gb|EEE58386.1|  hypothetical protein OsJ_09548                        62.0    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002881958.1|  protease inhibitor/seed storage/lipid transf...  62.4    7e-09   
gb|EYU39237.1|  hypothetical protein MIMGU_mgv1a014178mg              62.0    7e-09   Erythranthe guttata [common monkey flower]
ref|XP_009418410.1|  PREDICTED: protein YLS3-like                     62.0    8e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008461230.1|  PREDICTED: protein YLS3-like                     61.6    1e-08   Cucumis melo [Oriental melon]
ref|XP_007205970.1|  hypothetical protein PRUPE_ppa012060mg           61.2    1e-08   Prunus persica
ref|XP_008225280.1|  PREDICTED: protein YLS3-like                     61.2    1e-08   Prunus mume [ume]
emb|CDP07663.1|  unnamed protein product                              61.2    1e-08   Coffea canephora [robusta coffee]
ref|XP_006397607.1|  hypothetical protein EUTSA_v10001638mg           61.2    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006439006.1|  hypothetical protein CICLE_v10033694mg           61.2    1e-08   
emb|CBI28121.3|  unnamed protein product                              62.0    2e-08   Vitis vinifera
ref|XP_002468449.1|  hypothetical protein SORBIDRAFT_01g046080        60.8    2e-08   Sorghum bicolor [broomcorn]
ref|XP_006359139.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    2e-08   Solanum tuberosum [potatoes]
ref|XP_009409233.1|  PREDICTED: protein YLS3-like                     60.5    2e-08   
ref|XP_008775497.1|  PREDICTED: protein YLS3-like                     60.5    2e-08   Phoenix dactylifera
ref|XP_010228246.1|  PREDICTED: protein YLS3-like isoform X1          60.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_009394719.1|  PREDICTED: protein YLS3-like                     60.1    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009770685.1|  PREDICTED: protein YLS3-like                     60.1    3e-08   Nicotiana sylvestris
ref|NP_181959.1|  bifunctional inhibitor/lipid-transfer protein/s...  60.1    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025176.1|  PREDICTED: protein YLS3                          59.7    4e-08   Populus euphratica
ref|XP_002459511.1|  hypothetical protein SORBIDRAFT_02g005900        59.7    5e-08   Sorghum bicolor [broomcorn]
gb|ACR37836.1|  unknown                                               59.7    5e-08   Zea mays [maize]
emb|CDP03376.1|  unnamed protein product                              59.7    5e-08   Coffea canephora [robusta coffee]
ref|XP_002881957.1|  protease inhibitor/seed storage/lipid transf...  59.7    5e-08   Arabidopsis lyrata subsp. lyrata
gb|ACG31262.1|  lipid transfer protein                                59.3    6e-08   Zea mays [maize]
emb|CBI16494.3|  unnamed protein product                              58.9    7e-08   Vitis vinifera
ref|XP_011010692.1|  PREDICTED: protein YLS3-like                     59.3    7e-08   Populus euphratica
gb|ACG45950.1|  lipid transfer protein                                59.3    7e-08   Zea mays [maize]
gb|ACG37967.1|  lipid transfer protein                                59.3    7e-08   Zea mays [maize]
ref|XP_004229337.1|  PREDICTED: protein YLS3                          59.3    7e-08   Solanum lycopersicum
ref|XP_002285691.1|  PREDICTED: protein YLS3-like                     58.9    8e-08   Vitis vinifera
ref|XP_008337357.1|  PREDICTED: protein YLS3-like                     58.9    9e-08   
ref|XP_009374052.1|  PREDICTED: protein YLS3-like                     58.9    9e-08   Pyrus x bretschneideri [bai li]
ref|XP_002968703.1|  hypothetical protein SELMODRAFT_38281            57.4    1e-07   
ref|XP_002877294.1|  lipid binding protein                            58.5    1e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006397606.1|  hypothetical protein EUTSA_v10001634mg           58.9    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_001753173.1|  predicted protein                                58.2    1e-07   
ref|XP_004241377.1|  PREDICTED: xylogen-like protein 11               58.2    1e-07   Solanum lycopersicum
gb|AAM66942.1|  lipid-transfer protein-like protein                   58.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189958.1|  non-specific lipid transfer protein GPI-anchored 2  58.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001774074.1|  predicted protein                                60.1    2e-07   
ref|XP_006658373.1|  PREDICTED: protein YLS3-like                     58.2    2e-07   Oryza brachyantha
ref|XP_011088858.1|  PREDICTED: protein YLS3-like                     58.2    2e-07   Sesamum indicum [beniseed]
ref|XP_011089694.1|  PREDICTED: protein YLS3-like                     58.2    2e-07   Sesamum indicum [beniseed]
gb|KHG04910.1|  hypothetical protein F383_07676                       58.2    2e-07   Gossypium arboreum [tree cotton]
ref|XP_008451078.1|  PREDICTED: non-specific lipid transfer prote...  57.4    2e-07   Cucumis melo [Oriental melon]
ref|XP_009364110.1|  PREDICTED: protein YLS3-like                     57.8    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_010915020.1|  PREDICTED: protein YLS3-like                     57.8    3e-07   Elaeis guineensis
ref|XP_010544520.1|  PREDICTED: protein YLS3-like                     57.8    3e-07   Tarenaya hassleriana [spider flower]
gb|EEE66751.1|  hypothetical protein OsJ_23458                        57.8    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001170312.1|  putative bifunctional inhibitor/LTP/seed sto...  57.8    3e-07   Zea mays [maize]
gb|KDO46035.1|  hypothetical protein CISIN_1g029183mg                 57.4    3e-07   Citrus sinensis [apfelsine]
ref|NP_001152188.1|  lipid binding protein precursor                  57.8    3e-07   
ref|XP_006356037.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    3e-07   Solanum tuberosum [potatoes]
ref|XP_004511135.1|  PREDICTED: uncharacterized GPI-anchored prot...  57.4    4e-07   Cicer arietinum [garbanzo]
ref|XP_008378010.1|  PREDICTED: protein YLS3-like                     57.4    4e-07   Malus domestica [apple tree]
ref|XP_009769034.1|  PREDICTED: non-specific lipid-transfer prote...  56.6    4e-07   Nicotiana sylvestris
gb|EEC81687.1|  hypothetical protein OsI_25271                        57.4    4e-07   Oryza sativa Indica Group [Indian rice]
gb|KDP44350.1|  hypothetical protein JCGZ_19217                       57.0    4e-07   Jatropha curcas
gb|KDP20375.1|  hypothetical protein JCGZ_05258                       56.6    6e-07   Jatropha curcas
ref|XP_006482799.1|  PREDICTED: protein YLS3-like                     56.2    6e-07   
ref|XP_010673513.1|  PREDICTED: protein YLS3                          56.6    6e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009791428.1|  PREDICTED: non-specific lipid transfer prote...  55.8    7e-07   Nicotiana sylvestris
ref|XP_006419150.1|  hypothetical protein EUTSA_v10002676mg           56.2    7e-07   
ref|XP_007205989.1|  hypothetical protein PRUPE_ppa012218mg           56.2    8e-07   Prunus persica
ref|XP_009602114.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    9e-07   Nicotiana tomentosiformis
gb|KJB22206.1|  hypothetical protein B456_004G035100                  57.4    9e-07   Gossypium raimondii
gb|ABB90545.1|  lipid transfer protein                                55.8    9e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007052623.1|  Bifunctional inhibitor/lipid-transfer protei...  55.8    1e-06   
gb|EPS60733.1|  hypothetical protein M569_14069                       55.1    1e-06   Genlisea aurea
ref|XP_002512201.1|  lipid binding protein, putative                  55.1    1e-06   
ref|XP_009592817.1|  PREDICTED: protein YLS3-like isoform X2          55.5    1e-06   Nicotiana tomentosiformis
ref|XP_008807342.1|  PREDICTED: non-specific lipid transfer prote...  55.8    1e-06   Phoenix dactylifera
ref|XP_008451079.1|  PREDICTED: non-specific lipid transfer prote...  55.5    1e-06   Cucumis melo [Oriental melon]
ref|XP_010098644.1|  putative GPI-anchored protein                    55.5    1e-06   
ref|XP_008809013.1|  PREDICTED: protein YLS3-like                     55.8    1e-06   
ref|XP_010536250.1|  PREDICTED: non-specific lipid transfer prote...  55.1    1e-06   
ref|XP_011089118.1|  PREDICTED: protein YLS3-like                     55.8    1e-06   Sesamum indicum [beniseed]
ref|XP_004134131.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   Cucumis sativus [cucumbers]
ref|XP_007159392.1|  hypothetical protein PHAVU_002G234400g           55.5    2e-06   Phaseolus vulgaris [French bean]
gb|KEH19312.1|  Lipid transfer protein                                55.1    2e-06   Medicago truncatula
ref|XP_002270671.1|  PREDICTED: protein YLS3                          55.1    2e-06   Vitis vinifera
gb|KJB66104.1|  hypothetical protein B456_010G127100                  55.1    3e-06   Gossypium raimondii
ref|XP_006838654.1|  hypothetical protein AMTR_s00002p00240480        54.7    3e-06   Amborella trichopoda
gb|EMT29098.1|  hypothetical protein F775_26764                       53.9    3e-06   
ref|XP_004228722.1|  PREDICTED: protein YLS3                          54.7    3e-06   Solanum lycopersicum
ref|XP_006419149.1|  hypothetical protein EUTSA_v10002676mg           54.7    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006361136.1|  PREDICTED: xylogen-like protein 11-like          54.7    3e-06   Solanum tuberosum [potatoes]
ref|XP_007015522.1|  Bifunctional inhibitor/lipid-transfer protei...  54.7    3e-06   
ref|XP_002466309.1|  hypothetical protein SORBIDRAFT_01g005410        54.7    3e-06   Sorghum bicolor [broomcorn]
ref|XP_008438652.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-06   Cucumis melo [Oriental melon]
ref|XP_009592816.1|  PREDICTED: protein YLS3-like isoform X1          54.7    3e-06   Nicotiana tomentosiformis
ref|XP_002521629.1|  lipid binding protein, putative                  55.1    3e-06   Ricinus communis
ref|XP_008231395.1|  PREDICTED: protein YLS3-like isoform X2          54.7    4e-06   Prunus mume [ume]
ref|XP_002304871.1|  hypothetical protein POPTR_0003s21390g           54.3    4e-06   
ref|NP_001030803.1|  non-specific lipid transfer protein GPI-anch...  54.3    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504341.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    4e-06   Cicer arietinum [garbanzo]
dbj|BAH56934.1|  AT3G43720                                            54.3    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889436.1|  hypothetical protein ARALYDRAFT_311412           53.9    4e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_007219100.1|  hypothetical protein PRUPE_ppa015466mg           53.5    4e-06   
ref|XP_004306485.1|  PREDICTED: protein YLS3-like                     54.3    5e-06   Fragaria vesca subsp. vesca
ref|XP_004164321.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    5e-06   
ref|XP_002530873.1|  lipid binding protein, putative                  53.5    5e-06   Ricinus communis
gb|AFG47010.1|  hypothetical protein 2_5794_01                        53.1    5e-06   Pinus taeda
ref|XP_009354800.1|  PREDICTED: protein YLS3-like                     53.1    6e-06   Pyrus x bretschneideri [bai li]
gb|KEH43852.1|  Lipid transfer protein                                53.1    6e-06   Medicago truncatula
ref|XP_010101138.1|  putative GPI-anchored protein                    53.5    6e-06   
ref|XP_001781696.1|  predicted protein                                55.5    6e-06   
ref|XP_010425834.1|  PREDICTED: non-specific lipid transfer prote...  53.9    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008384404.1|  PREDICTED: protein YLS3-like                     53.9    7e-06   
emb|CDP17362.1|  unnamed protein product                              53.5    8e-06   Coffea canephora [robusta coffee]
ref|XP_004295130.1|  PREDICTED: non-specific lipid transfer prote...  53.5    9e-06   Fragaria vesca subsp. vesca
ref|XP_008231394.1|  PREDICTED: protein YLS3-like isoform X1          53.5    9e-06   Prunus mume [ume]
ref|XP_009628973.1|  PREDICTED: protein YLS3-like                     53.5    9e-06   Nicotiana tomentosiformis
emb|CDO99083.1|  unnamed protein product                              53.1    9e-06   Coffea canephora [robusta coffee]
gb|EMT07497.1|  hypothetical protein F775_15194                       52.8    1e-05   
emb|CDY64362.1|  BnaAnng19290D                                        53.5    1e-05   Brassica napus [oilseed rape]
ref|XP_010093837.1|  Non-specific lipid-transfer protein-like pro...  53.9    1e-05   Morus notabilis
ref|XP_009766807.1|  PREDICTED: protein YLS3-like                     53.1    1e-05   Nicotiana sylvestris
emb|CAN59826.1|  hypothetical protein VITISV_016657                   54.7    1e-05   Vitis vinifera
gb|ACM78615.1|  non-specific lipid-transfer protein-like protein      53.1    1e-05   Tamarix hispida
ref|XP_009143014.1|  PREDICTED: protein YLS3-like                     53.5    1e-05   Brassica rapa
ref|XP_010038080.1|  PREDICTED: non-specific lipid transfer prote...  52.8    1e-05   Eucalyptus grandis [rose gum]
gb|KCW49882.1|  hypothetical protein EUGRSUZ_K03347                   52.8    1e-05   Eucalyptus grandis [rose gum]
ref|XP_009766802.1|  PREDICTED: non-specific lipid transfer prote...  52.8    1e-05   Nicotiana sylvestris
ref|XP_008230977.1|  PREDICTED: non-specific lipid transfer prote...  52.8    1e-05   Prunus mume [ume]
gb|EAZ28888.1|  hypothetical protein OsJ_12928                        53.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006386057.1|  hypothetical protein POPTR_0003s21390g           52.4    2e-05   
gb|AAS07215.1|  putative protease inhibitor                           52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044958.1|  PREDICTED: protein YLS3-like                     52.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_004144106.1|  PREDICTED: xylogen-like protein 11-like          52.4    2e-05   Cucumis sativus [cucumbers]
emb|CCH50970.1|  T4.9                                                 52.8    2e-05   Malus x robusta [Siberian crab apple]
ref|XP_008351727.1|  PREDICTED: protein YLS3-like                     52.8    2e-05   
gb|AFK42663.1|  unknown                                               52.0    2e-05   Medicago truncatula
ref|XP_009375461.1|  PREDICTED: protein YLS3-like                     52.8    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_008775111.1|  PREDICTED: non-specific lipid transfer prote...  52.0    2e-05   Phoenix dactylifera
gb|EMT07496.1|  Non-specific lipid-transfer protein-like protein      52.4    2e-05   
ref|NP_001051536.1|  Os03g0794000                                     52.4    2e-05   
gb|KHG16607.1|  hypothetical protein F383_20647                       52.0    2e-05   
ref|XP_010243423.1|  PREDICTED: protein YLS3-like                     53.1    2e-05   
gb|AFK38594.1|  unknown                                               52.4    2e-05   
ref|XP_003610781.1|  Non-specific lipid-transfer protein              52.0    2e-05   
ref|XP_006360772.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
ref|XP_010516504.1|  PREDICTED: protein YLS3-like                     52.0    2e-05   
gb|KEH43853.1|  Lipid transfer protein                                52.0    2e-05   
dbj|BAG92716.1|  unnamed protein product                              52.8    2e-05   
ref|XP_002524760.1|  lipid binding protein, putative                  52.0    2e-05   
ref|XP_009369865.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
ref|XP_010045144.1|  PREDICTED: non-specific lipid transfer prote...  52.0    3e-05   
ref|NP_001059125.1|  Os07g0198300                                     52.4    3e-05   
ref|XP_007163836.1|  hypothetical protein PHAVU_001G268300g           52.4    3e-05   
ref|XP_009598307.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
ref|XP_009345870.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
gb|AAV97731.1|  lipid transfer protein                                51.6    3e-05   
ref|XP_007036507.1|  Bifunctional inhibitor/lipid-transfer protei...  52.0    3e-05   
ref|XP_010693844.1|  PREDICTED: protein YLS3 isoform X2               52.0    3e-05   
ref|XP_009598309.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
emb|CDY69589.1|  BnaC04g53090D                                        52.0    3e-05   
ref|XP_006419978.1|  hypothetical protein CICLE_v10006599mg           51.6    3e-05   
ref|XP_011079977.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    3e-05   
gb|KHN44488.1|  Putative GPI-anchored protein                         52.0    3e-05   
gb|AFK42199.1|  unknown                                               52.0    3e-05   
gb|AFK46793.1|  unknown                                               51.6    3e-05   
ref|XP_006340342.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    3e-05   
ref|XP_010503050.1|  PREDICTED: non-specific lipid transfer prote...  52.4    3e-05   
ref|XP_004504343.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    3e-05   
ref|NP_001237564.1|  uncharacterized protein LOC100305590 precursor   51.6    3e-05   
ref|XP_007162452.1|  hypothetical protein PHAVU_001G153500g           51.6    4e-05   
ref|XP_006445830.1|  hypothetical protein CICLE_v10016842mg           51.6    4e-05   
ref|XP_006489422.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    4e-05   
ref|XP_010257571.1|  PREDICTED: protein YLS3                          51.6    4e-05   
ref|XP_006295054.1|  hypothetical protein CARUB_v10024122mg           51.6    4e-05   
ref|XP_009758370.1|  PREDICTED: non-specific lipid transfer prote...  51.2    4e-05   
gb|KDP42907.1|  hypothetical protein JCGZ_23849                       52.4    4e-05   
ref|XP_004955761.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    4e-05   
gb|AAV97732.1|  lipid transfer protein                                51.2    4e-05   
emb|CDY17540.1|  BnaC01g26640D                                        51.6    4e-05   
ref|XP_011082645.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    5e-05   
ref|XP_010693842.1|  PREDICTED: protein YLS3 isoform X1               51.2    5e-05   
ref|XP_004247576.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    5e-05   
gb|KFK38682.1|  hypothetical protein AALP_AA3G147000                  51.2    5e-05   
ref|XP_006419151.1|  hypothetical protein EUTSA_v10002676mg           50.8    5e-05   
ref|XP_004247577.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    5e-05   
dbj|BAJ87912.1|  predicted protein                                    51.2    6e-05   
ref|XP_003557681.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    6e-05   
ref|NP_001059015.1|  Os07g0175600                                     50.8    6e-05   
ref|XP_009609282.1|  PREDICTED: xylogen-like protein 11               51.2    6e-05   
gb|AFK43474.1|  unknown                                               50.4    6e-05   
ref|XP_007143272.1|  hypothetical protein PHAVU_007G058500g           50.8    6e-05   
ref|XP_006360770.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    7e-05   
emb|CCW28756.1|  putative lipid transfer/seed storage/trypsin-alp...  50.4    7e-05   
emb|CDY50373.1|  BnaA01g35710D                                        50.8    7e-05   
ref|XP_006651927.1|  PREDICTED: protein YLS3-like                     51.6    7e-05   
ref|XP_006291877.1|  hypothetical protein CARUB_v10018054mg           51.2    8e-05   
ref|XP_009598308.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    8e-05   
gb|KHG26898.1|  Xylogen-like protein 11                               52.0    8e-05   
ref|XP_006492750.1|  PREDICTED: uncharacterized protein LOC102613530  52.0    8e-05   
ref|XP_004496707.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    8e-05   
ref|XP_004496708.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    8e-05   
gb|AFK48341.1|  unknown                                               50.1    9e-05   
ref|XP_007133468.1|  hypothetical protein PHAVU_011G181000g           50.8    9e-05   
emb|CCW28822.1|  putative lipid transfer/seed storage/trypsin-alp...  50.4    9e-05   
tpg|DAA51863.1|  TPA: putative bifunctional inhibitor/LTP/seed st...  50.4    9e-05   
ref|NP_001235889.1|  uncharacterized protein LOC100500289 precursor   50.4    9e-05   
gb|KJB27570.1|  hypothetical protein B456_005G044100                  49.7    1e-04   
ref|XP_003564265.1|  PREDICTED: protein YLS3-like                     50.8    1e-04   
tpg|DAA51864.1|  TPA: putative bifunctional inhibitor/LTP/seed st...  50.8    1e-04   
ref|XP_009388486.1|  PREDICTED: non-specific lipid transfer prote...  50.1    1e-04   
ref|XP_006292810.1|  hypothetical protein CARUB_v10019061mg           50.8    1e-04   
ref|XP_008350312.1|  PREDICTED: non-specific lipid transfer prote...  50.8    1e-04   
ref|XP_001770529.1|  predicted protein                                48.9    1e-04   
ref|XP_008451096.1|  PREDICTED: protein YLS3-like                     50.4    1e-04   
ref|XP_010938128.1|  PREDICTED: non-specific lipid transfer prote...  50.1    1e-04   
ref|XP_004144111.1|  PREDICTED: uncharacterized GPI-anchored prot...  50.4    1e-04   
ref|XP_004165809.1|  PREDICTED: uncharacterized GPI-anchored prot...  50.4    1e-04   
gb|KFK33859.1|  hypothetical protein AALP_AA5G069300                  50.4    1e-04   
gb|KJB27568.1|  hypothetical protein B456_005G044100                  50.1    1e-04   
ref|XP_002456525.1|  hypothetical protein SORBIDRAFT_03g037810        50.4    1e-04   
ref|XP_009758372.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    1e-04   
ref|XP_007143273.1|  hypothetical protein PHAVU_007G058500g           49.7    1e-04   
ref|XP_004297113.1|  PREDICTED: non-specific lipid transfer prote...  49.7    1e-04   
ref|NP_001241396.1|  uncharacterized protein LOC100801492 precursor   50.1    1e-04   
gb|KJB27573.1|  hypothetical protein B456_005G044100                  50.1    1e-04   
ref|NP_001240276.1|  uncharacterized protein LOC100792950 precursor   50.4    1e-04   
ref|XP_010069341.1|  PREDICTED: protein YLS3-like                     49.7    2e-04   
ref|XP_009758371.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    2e-04   
ref|XP_010508310.1|  PREDICTED: protein YLS3-like                     50.1    2e-04   
ref|XP_008350313.1|  PREDICTED: non-specific lipid transfer prote...  50.1    2e-04   
ref|XP_006655433.1|  PREDICTED: xylogen-like protein 11-like          49.3    2e-04   
gb|AFK37798.1|  unknown                                               50.1    2e-04   
ref|XP_008240321.1|  PREDICTED: protein YLS3                          50.1    2e-04   
gb|ACU15623.1|  unknown                                               50.1    2e-04   
ref|NP_001151689.1|  lipid transfer protein precursor                 49.7    2e-04   
gb|KHN03811.1|  Non-specific lipid-transfer protein-like protein      50.1    2e-04   
ref|XP_011030671.1|  PREDICTED: non-specific lipid transfer prote...  49.7    2e-04   
ref|XP_010542451.1|  PREDICTED: protein YLS3-like isoform X2          50.1    2e-04   
ref|XP_010931469.1|  PREDICTED: non-specific lipid transfer prote...  50.1    2e-04   
ref|XP_002978544.1|  hypothetical protein SELMODRAFT_443870           49.3    2e-04   
gb|KFK38683.1|  hypothetical protein AALP_AA3G147000                  49.7    2e-04   
ref|NP_001274812.1|  non-specific lipid-transfer protein-like pro...  49.3    2e-04   
ref|XP_002530278.1|  lipid binding protein, putative                  49.7    2e-04   
ref|XP_008353284.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    2e-04   
ref|XP_006418264.1|  hypothetical protein EUTSA_v10009479mg           49.3    2e-04   
gb|KDP21431.1|  hypothetical protein JCGZ_21902                       49.3    2e-04   
ref|XP_006838416.1|  hypothetical protein AMTR_s00002p00104040        49.3    2e-04   
ref|NP_001238368.1|  uncharacterized protein LOC100306151 precursor   49.3    3e-04   
ref|XP_010554897.1|  PREDICTED: protein YLS3                          49.3    3e-04   
gb|KHN33512.1|  Non-specific lipid-transfer protein-like protein      48.5    3e-04   
ref|XP_004251232.1|  PREDICTED: non-specific lipid transfer prote...  49.7    3e-04   
ref|XP_009138957.1|  PREDICTED: protein YLS3                          49.3    3e-04   
ref|XP_002885513.1|  predicted protein                                48.9    3e-04   
dbj|BAK05453.1|  predicted protein                                    49.7    3e-04   
emb|CDX88991.1|  BnaA04g01950D                                        48.5    3e-04   
ref|XP_010504811.1|  PREDICTED: protein YLS3-like                     49.3    3e-04   
gb|KDO66317.1|  hypothetical protein CISIN_1g029668mg                 48.9    3e-04   
ref|NP_001185235.1|  Bifunctional inhibitor/lipid-transfer protei...  49.7    3e-04   
ref|XP_006349698.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    3e-04   
ref|XP_006349697.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    3e-04   
ref|XP_006406145.1|  hypothetical protein EUTSA_v10021660mg           48.9    3e-04   
gb|KHN47957.1|  Putative GPI-anchored protein                         49.3    3e-04   
ref|XP_010542450.1|  PREDICTED: protein YLS3-like isoform X1          49.3    3e-04   
gb|AFK46030.1|  unknown                                               48.9    3e-04   
ref|XP_009611497.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    3e-04   
ref|XP_004511391.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    3e-04   
ref|XP_007034803.1|  Non-specific lipid-transfer protein isoform 2    48.1    4e-04   
gb|AAM61728.1|  unknown                                               48.9    4e-04   
ref|NP_973749.1|  bifunctional inhibitor/lipid-transfer protein/s...  48.9    4e-04   
gb|ACJ83901.1|  unknown                                               48.5    4e-04   
ref|XP_006292695.1|  hypothetical protein CARUB_v10018941mg           48.5    4e-04   
ref|XP_010227162.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    4e-04   
dbj|BAK02000.1|  predicted protein                                    48.5    4e-04   
gb|AFK43872.1|  unknown                                               48.5    4e-04   
gb|EYU46138.1|  hypothetical protein MIMGU_mgv1a015992mg              48.1    4e-04   
ref|XP_007034802.1|  Non-specific lipid-transfer protein, putativ...  48.5    4e-04   
ref|XP_009335314.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    4e-04   
ref|XP_010506349.1|  PREDICTED: protein YLS3-like                     48.9    4e-04   
dbj|BAB90402.1|  P0432B10.23                                          48.9    5e-04   
ref|XP_006646424.1|  PREDICTED: xylogen-like protein 11-like          48.9    5e-04   
emb|CDP03652.1|  unnamed protein product                              48.5    5e-04   
gb|AAM63095.1|  unknown                                               48.1    5e-04   
gb|KDP40200.1|  hypothetical protein JCGZ_02198                       48.5    5e-04   
ref|XP_010427760.1|  PREDICTED: protein YLS3-like                     48.5    5e-04   
gb|EMT04740.1|  Non-specific lipid-transfer protein-like protein      48.1    5e-04   
gb|AAN60349.1|  unknown                                               48.1    5e-04   
ref|XP_004247184.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    5e-04   
ref|XP_010518027.1|  PREDICTED: protein YLS3-like                     48.5    5e-04   
ref|XP_006658323.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    5e-04   
ref|NP_001238362.1|  uncharacterized protein LOC100499687 precursor   48.5    5e-04   
ref|XP_006414637.1|  hypothetical protein EUTSA_v10026452mg           48.1    5e-04   
ref|NP_566712.1|  protease inhibitor/seed storage/lipid transfer ...  48.1    6e-04   
ref|XP_010497034.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    6e-04   
ref|XP_004247575.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    6e-04   
gb|AAG51569.1|AC027034_15  unknown protein; 63629-62263               48.5    6e-04   
ref|XP_010532560.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    6e-04   
ref|XP_011026797.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    6e-04   
ref|NP_001147490.1|  lipid binding protein precursor                  48.1    6e-04   
ref|XP_009369867.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    6e-04   
gb|KJB27569.1|  hypothetical protein B456_005G044100                  47.0    7e-04   
ref|XP_010497022.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    7e-04   
gb|KFK39552.1|  hypothetical protein AALP_AA3G258800                  48.1    7e-04   
ref|XP_006657494.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    7e-04   
ref|XP_006352768.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    8e-04   
ref|XP_010511517.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    8e-04   
ref|XP_010507801.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    8e-04   
ref|XP_009618189.1|  PREDICTED: non-specific lipid transfer prote...  47.8    8e-04   
gb|EMT03137.1|  hypothetical protein F775_19441                       48.1    8e-04   
ref|XP_008449799.1|  PREDICTED: protein YLS3                          48.1    8e-04   
ref|NP_001055891.1|  Os05g0489200                                     48.5    8e-04   
ref|XP_009792638.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    9e-04   
ref|XP_006397274.1|  hypothetical protein EUTSA_v10028961mg           48.5    9e-04   
gb|KJB27571.1|  hypothetical protein B456_005G044100                  47.4    9e-04   
ref|XP_010038081.1|  PREDICTED: non-specific lipid transfer prote...  47.8    9e-04   
gb|EMT31079.1|  Non-specific lipid-transfer protein-like protein      47.8    9e-04   
ref|XP_009779779.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    0.001   
ref|XP_004970336.1|  PREDICTED: xylogen-like protein 11-like          48.1    0.001   
ref|XP_003555341.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    0.001   
ref|XP_002314685.2|  hypothetical protein POPTR_0010s09550g           47.8    0.001   



>ref|XP_009782722.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Nicotiana sylvestris]
Length=198

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 91/116 (78%), Gaps = 4/116 (3%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDS-SVTSLGIKE  359
            E  KV  CL+YA G A APSK+CCD+   IK+ DPVCLCY+I+Q+HKG S  + S+GI+E
Sbjct  36   EFQKVAACLTYATGKAPAPSKECCDAAEDIKDEDPVCLCYIIEQIHKGSSPELKSMGIQE  95

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS  527
            D+LL+LPS CKL NAS +NCPKLLN+P+ SPD AIFTNA+T+   SKTP A+P G+
Sbjct  96   DKLLQLPSACKLTNASISNCPKLLNIPSTSPDYAIFTNASTA---SKTPVATPAGA  148



>ref|XP_009621610.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Nicotiana tomentosiformis]
Length=189

 Score =   146 bits (368),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 4/116 (3%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDS-SVTSLGIKE  359
            E  KV  CL+YA G A APSK+CCD+   IK+ DPVCLCY+I+Q+HKG S  + S+GI+E
Sbjct  36   EFQKVAACLTYATGKAPAPSKECCDAAEDIKDEDPVCLCYIIEQIHKGSSPELKSMGIQE  95

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS  527
            D+LL+LPS CKL+NAS +NCPKLLN+P+ SPD AIFTN +T+   SKTP A+P G+
Sbjct  96   DKLLQLPSACKLSNASISNCPKLLNIPSNSPDYAIFTNTSTA---SKTPVATPAGA  148



>gb|AFK48078.1| unknown [Lotus japonicus]
Length=179

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 88/131 (67%), Gaps = 8/131 (6%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G    PSK+CCDS + IK+TDP CLCY+IQQ HKG +   S+GI+EDRLL
Sbjct  35   KVIPCLGFATGKEATPSKQCCDSATVIKDTDPECLCYIIQQTHKGSAESKSMGIREDRLL  94

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LPS C++ NAS +NCPKLL L   SPDAAIFTN     A+  TP +S    T+ P +  
Sbjct  95   QLPSACQVKNASISNCPKLLGLSPSSPDAAIFTN-----ASKLTPPSSANTETATPQSPN  149

Query  552  GGLWWVVQARP  584
            G    VV+A P
Sbjct  150  GS---VVRAPP  157



>ref|XP_006352184.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Solanum tuberosum]
Length=197

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDS-SVTSLGIKE  359
            E  KV  CL+YA G A +PSK+CCD+   IK+ DPVCLCY+I+Q+HKG S  + S+GI+E
Sbjct  34   EFQKVAACLTYATGKAPSPSKECCDAAEDIKDHDPVCLCYIIEQIHKGSSPQLKSMGIQE  93

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT  482
            D+LL+LPS CKL NAS +NCPKLLN+P  SPD AIF+NAT+
Sbjct  94   DKLLQLPSACKLTNASISNCPKLLNIPPTSPDYAIFSNATS  134



>ref|XP_002277578.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Vitis vinifera]
Length=201

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  KV +CLS+A G A  P+K CC +VS I+E+ PVCLCY IQQ H G + V SLGI+E 
Sbjct  42   EFTKVSECLSFATGKAATPTKDCCSAVSEIRESKPVCLCYFIQQTHNGSAEVKSLGIQEA  101

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS  527
            +LL+LPS+CKLANAS ++CPKLLN+ A SPD +IFT+ +TS A + T   +  G+
Sbjct  102  KLLQLPSDCKLANASLSDCPKLLNISASSPDYSIFTSNSTSTAPASTSTGTSSGA  156



>ref|XP_004239214.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Solanum lycopersicum]
Length=186

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDS-SVTSLGIKE  359
            E  KV  CL+YA G A +PSK+CCD+   IK+ DPVCLCY+I+Q+HKG S  + S+GI+E
Sbjct  35   EFQKVAACLTYATGKAPSPSKECCDAAEDIKDHDPVCLCYIIEQIHKGSSPQLKSMGIQE  94

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT  482
            ++LL+LPS CKL NA+ +NCPKLLN+P  SPD AIFTNAT+
Sbjct  95   EKLLQLPSACKLTNATISNCPKLLNIPPTSPDYAIFTNATS  135



>emb|CAN67019.1| hypothetical protein VITISV_027707 [Vitis vinifera]
Length=201

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  KV +CLS+A G A  P+K CC +VS I+++ PVCLCY IQQ H G   V SLGI+E 
Sbjct  42   EFTKVSECLSFATGKAATPTKDCCSAVSEIRQSKPVCLCYFIQQTHNGSEQVKSLGIQEA  101

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA  542
            +LL+LPS+CKLANAS ++CPKLLN+ A SPD +IFT+ +TS A + T   +  G+    +
Sbjct  102  KLLQLPSDCKLANASLSDCPKLLNISASSPDYSIFTSNSTSTAPASTSTGTSSGAKDDES  161

Query  543  TA  548
             A
Sbjct  162  NA  163



>ref|XP_006368883.1| hypothetical protein POPTR_0001s13860g [Populus trichocarpa]
 gb|ERP65452.1| hypothetical protein POPTR_0001s13860g [Populus trichocarpa]
Length=191

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 85/131 (65%), Gaps = 8/131 (6%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KVM CLSYA G A+ P K CC +V  IK+++P CLCY +QQ H   S   SLG++E +LL
Sbjct  40   KVMGCLSYATGKANTPPKDCCSAVQDIKDSEPKCLCYTMQQAHNASSQFKSLGVQEAKLL  99

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LP+ C+L NAS + CPKLL L  GS DAAIFTNA+    TS TP  S G   SQP  AG
Sbjct  100  QLPTACQLQNASLSFCPKLLGLSPGSADAAIFTNAS----TSATPAVSTG--KSQPEQAG  153

Query  552  GGLWWVVQARP  584
            G     +Q RP
Sbjct  154  GS--SRIQLRP  162



>ref|XP_010102693.1| hypothetical protein L484_015489 [Morus notabilis]
 gb|EXB93945.1| hypothetical protein L484_015489 [Morus notabilis]
Length=188

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+  CL+YA G A  P+K CCD V  IKE++P CLC ++QQ HKG+  + ++GI+E +LL
Sbjct  40   KLAVCLTYATGKAAVPTKDCCDLVKGIKESEPECLCLIMQQTHKGNDQIKNMGIQESKLL  99

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHA--TSKTPGASPGGSTSQPAT  545
             LP+ C L NA+   CPKLL LPA SPDAAIFTNA+T+ A  T+K  GAS    TS+ ++
Sbjct  100  SLPTACALKNATLAECPKLLGLPANSPDAAIFTNASTASATPTAKGTGASQ-SQTSKDSS  158

Query  546  AGGGLWWVVQARPA  587
            +G  L   + + PA
Sbjct  159  SGARLGTHLASLPA  172



>gb|KGN51666.1| hypothetical protein Csa_5G589340 [Cucumis sativus]
Length=189

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ C +YA G A AP+++CCDS+  IKE+ P CLC+ IQQ H G+  + SLGI+E +LL
Sbjct  42   KVVSCFAYATGKAAAPTEECCDSIEDIKESKPKCLCFFIQQTHNGNQQIKSLGIQEIKLL  101

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT--SHATSKTPGASPGGSTSQPAT  545
            +LPS C L N+S + CPKLL LPA SPDAAIF+N+T+  + A++ T   SP G+      
Sbjct  102  QLPSVCHLKNSSVSYCPKLLGLPANSPDAAIFSNSTSPATPASATTTRTSPDGNAGSKTV  161

Query  546  AGGGLWWVVQA  578
            A   +  +V A
Sbjct  162  ANSPVGLMVVA  172



>ref|XP_004135333.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
Length=189

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ C +YA G A AP+++CCDS+  IKE+ P CLC+ IQQ H G+  + SLGI+E +LL
Sbjct  42   KVVSCFAYATGKAAAPTEECCDSIEGIKESKPKCLCFFIQQTHNGNQQIKSLGIQEIKLL  101

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT--SHATSKTPGASPGGSTSQPAT  545
            +LPS C L N+S + CPKLL LPA SPDAAIF+N+T+  + A++ T   SP G+      
Sbjct  102  QLPSVCHLKNSSVSYCPKLLGLPANSPDAAIFSNSTSPATPASATTTRTSPDGNAGSKTV  161

Query  546  AGGGLWWVVQA  578
            A   +  +V A
Sbjct  162  ANSPVGLMVVA  172



>ref|XP_011020739.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Populus euphratica]
 ref|XP_011020740.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Populus euphratica]
Length=191

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 89/140 (64%), Gaps = 15/140 (11%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KVM CLSYA G A+ P+K CC SV +IKE+DP CLC+++QQ   G + + +LGI+E +LL
Sbjct  40   KVMGCLSYATGKANTPTKDCCLSVQNIKESDPKCLCFIMQQTSNGSAQIKNLGIQEAKLL  99

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LP+ C+L NAS + CPKLL +   SPDAAIFTNA+    T+  P AS    TSQ   AG
Sbjct  100  QLPTACQLQNASLSFCPKLLGISPSSPDAAIFTNAS----TTAIPAASTSTGTSQSEKAG  155

Query  552  -----------GGLWWVVQA  578
                        GL+ +V A
Sbjct  156  DSSGFRHRTHLAGLFVIVAA  175



>ref|XP_007163769.1| hypothetical protein PHAVU_001G262400g [Phaseolus vulgaris]
 gb|ESW35763.1| hypothetical protein PHAVU_001G262400g [Phaseolus vulgaris]
Length=189

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G   AP K+CCD+ +SIKE++P CLC+VIQQ HKG   + SLGI+ED+LL
Sbjct  44   KVIPCLDFASGKEAAPKKECCDATASIKESNPECLCFVIQQTHKGSPQIKSLGIQEDKLL  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNAT-TSHATSKTPGASPGGSTSQPATA  548
            +LPS CK+ NA+ T+CPKLL L   SPDAAIFTN++  + ATS T   +P    SQ A+ 
Sbjct  104  QLPSLCKVKNATITDCPKLLGLSPSSPDAAIFTNSSKVTPATSSTQSTTP---QSQNASY  160

Query  549  GGGL  560
            G  +
Sbjct  161  GSAV  164



>ref|XP_002514908.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF47462.1| lipid binding protein, putative [Ricinus communis]
Length=184

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  KVM CL YA G  D P K CC +V  +K++DP CLC+++QQ H G + + SLGI+E 
Sbjct  34   EVQKVMPCLDYAKGKIDTPPKGCCSAVKDMKDSDPKCLCFIMQQTHNGSAEIKSLGIQEA  93

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSH--ATSKTPGAS-------  515
            +LL+LPS C+L NAS + CPKLL +P  SPDAAIFTNAT++   A + TPG S       
Sbjct  94   KLLQLPSACQLQNASISFCPKLLGIPPNSPDAAIFTNATSTSTPAATATPGTSAPDTSNN  153

Query  516  --PGGSTSQP--ATAGGGLWWVVQA  578
              P G+  +P  A A     ++  A
Sbjct  154  DRPNGTMHRPYLAIATAIFIYIFTA  178



>ref|XP_002303794.2| GPI-anchored protein precursor [Populus trichocarpa]
 gb|EEE78773.2| GPI-anchored protein precursor [Populus trichocarpa]
Length=191

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 90/140 (64%), Gaps = 15/140 (11%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+M CLSYA G A+ P+K CC SV +IKE+DP CLC+++QQ   G + + +LGI+E +LL
Sbjct  40   KLMGCLSYASGKANTPTKDCCLSVQNIKESDPKCLCFIMQQTSNGSAPIKNLGIQEAKLL  99

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LP+ C+L NAS + CPKLL +   SPDAAIFTNA+    T+ TP AS    TSQ   AG
Sbjct  100  QLPTACQLQNASLSFCPKLLGISPSSPDAAIFTNAS----TTATPAASTSTGTSQSEKAG  155

Query  552  -----------GGLWWVVQA  578
                        GL+ +V A
Sbjct  156  DSSGFQHRPHLAGLFMIVAA  175



>ref|XP_010249032.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Nelumbo nucifera]
Length=197

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            V +CL Y+ G A++P+K CC+SV+ I++ +PVCLC++IQQ HKG +S   LG+KEDRLL+
Sbjct  39   VTNCLDYSSGKAESPNKDCCNSVTKIRDQNPVCLCFIIQQTHKGTNSFKQLGLKEDRLLQ  98

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            LP+ CKLANAS + CPKLL+LP  SPDAAIF
Sbjct  99   LPTACKLANASVSECPKLLDLPPNSPDAAIF  129



>ref|XP_002890752.1| hypothetical protein ARALYDRAFT_890328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67011.1| hypothetical protein ARALYDRAFT_890328 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++ED+L+
Sbjct  43   KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C+L NAS TNCPKLL L   SPDAA+FT+  T   TS TP A  G S + PAT+
Sbjct  103  QLPTACQLHNASITNCPKLLGLSPSSPDAAVFTSNAT---TSTTPVAPAGKSPATPATS  158



>ref|XP_008446028.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Cucumis melo]
Length=193

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 4/130 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ C +YA G A AP+++CCDS+  IKE+ P CLC+ IQQ H G+  + SLGI+E +LL
Sbjct  46   KVVSCFAYATGKAAAPTEECCDSIEGIKESKPKCLCFFIQQTHNGNQQIKSLGIQEIKLL  105

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT--SHATSKTPGASPGGSTSQPAT  545
            +LPS C L N+S + CPKLL LPA SPDAAIF+N T+  + A++ T   SP G+      
Sbjct  106  QLPSVCHLKNSSVSYCPKLLGLPANSPDAAIFSNLTSPATPASATTTRTSPDGNAGTKTV  165

Query  546  AGG--GLWWV  569
            A    GL  V
Sbjct  166  ANSPVGLMAV  175



>emb|CDP13346.1| unnamed protein product [Coffea canephora]
Length=188

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 87/137 (64%), Gaps = 7/137 (5%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKG-DSSVTSLGIKE  359
            E PK+  CL++A G  D P+K+CC SVS +K  +PVCLCY+IQQ+H G D  + S+GI+E
Sbjct  32   EFPKLSTCLTFATGKQDTPTKECCTSVSDLKNKNPVCLCYIIQQIHSGSDPQIKSMGIQE  91

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHAT------SKTPGASPG  521
             RLL+LPS CKL NAST+ CPKLL+L   SPDAAIF N+T S         + TP     
Sbjct  92   ARLLQLPSACKLTNASTSECPKLLHLSPSSPDAAIFANSTASTTPSTATPDTSTPTKPNA  151

Query  522  GSTSQPATAGGGLWWVV  572
               + P  AG  L  VV
Sbjct  152  AFKNGPQLAGPALAIVV  168



>ref|XP_004159693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized GPI-anchored 
protein At1g27950-like [Cucumis sativus]
Length=189

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ C +YA G A AP+++CCDS+   KE+ P CLC+ IQQ H G+  + SLGI+E +LL
Sbjct  42   KVVSCFAYATGKAAAPTEECCDSIEXYKESKPKCLCFFIQQTHNGNQQIKSLGIQEIKLL  101

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT--SHATSKTPGASPGGSTSQPAT  545
            +LPS C L N+S + CPKLL LPA SPDAAIF+N+T+  + A++ T   SP G+      
Sbjct  102  QLPSVCHLKNSSVSYCPKLLGLPANSPDAAIFSNSTSPATPASATTTRTSPDGNAGSKTV  161

Query  546  AGGGLWWVVQA  578
            A   +  +V A
Sbjct  162  ANSPVGLMVVA  172



>ref|NP_001265899.1| uncharacterized protein LOC101506326 precursor [Cicer arietinum]
 emb|CAG14984.1| putative lipid transfer protein GPI-anchored [Cicer arietinum]
Length=185

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G A  P K+CCD+ +SIKETDP CLCY+IQQ HKG     SLGI+ED+LL
Sbjct  34   KVIPCLDFATGKALTPKKECCDAANSIKETDPECLCYIIQQTHKGSPESKSLGIQEDKLL  93

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            +LP+ CK+ NA+ T+CPKLL L   SPDAAIF N     A+  +P ++P  S  Q +T
Sbjct  94   QLPTVCKVKNANLTDCPKLLGLSPSSPDAAIFKN-----ASKLSPPSTPSASADQTST  146



>ref|XP_008340225.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Malus domestica]
Length=187

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CLSYA G A+ P+K+CCDSV  I++T P CLCYV+QQ + G   +  +G++  +LL
Sbjct  39   KVAVCLSYATGKAETPTKECCDSVKGIRDTQPECLCYVMQQANSGSEEIKKMGVQVAKLL  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            KLP+ C L NA+ ++CPKLL +PAGSP+AA+FTN  +S A   TP    GG  S P  A
Sbjct  99   KLPTACSLKNATASDCPKLLGIPAGSPEAAVFTNNASSTA---TPTTGSGGQQSAPEKA  154



>ref|XP_010460563.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Camelina sativa]
Length=198

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLCYVIQQ   G  ++  LG++ED+L+
Sbjct  44   KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCYVIQQAKTGGQALKDLGVQEDKLI  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            +LP+ C++ NAS  NCPKLL L   SPDAA+FTN    +ATS T   +PGG +  PAT
Sbjct  104  QLPTSCQIQNASIANCPKLLGLSPSSPDAAVFTN----NATSSTAPVAPGGKS--PAT  155



>ref|XP_008801676.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Phoenix dactylifera]
Length=172

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  K+  CL +A   A++PS +CC SV+ I+  D VCLCY+IQQ H G S++ SLG++ +
Sbjct  35   EFQKLTGCLDFATAKANSPSSQCCGSVTDIRNKDAVCLCYIIQQTHAGSSTIKSLGLQFN  94

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASP--GGSTSQ  536
            RLL+LP  CKLANAS TNCPKLLN+   SPD +IF    T+ ATS +P A+P  GG   Q
Sbjct  95   RLLQLPEACKLANASVTNCPKLLNISPSSPDYSIFNG--TTKATSASPNATPASGGIMHQ  152



>gb|AAM62634.1| lipid transfer protein, putative [Arabidopsis thaliana]
Length=193

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++ED+L+
Sbjct  41   KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLI  100

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C+L NAS TNCPKLL +   SPDAA+FTN  T+     TP A  G S + PAT+
Sbjct  101  QLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATT-----TPVAPAGKSPATPATS  154



>ref|NP_174116.1| glycosylphosphatidylinositol-anchored lipid protein transfer 
1 [Arabidopsis thaliana]
 sp|Q9C7F7.1|LTPG1_ARATH RecName: Full=Non-specific lipid transfer protein GPI-anchored 
1; Short=AtLTPG-1; Short=Protein LTP-GPI-ANCHORED 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51485.1|AC069471_16 lipid transfer protein, putative [Arabidopsis thaliana]
 gb|AAM12955.1| lipid transfer protein, putative [Arabidopsis thaliana]
 gb|AAM91112.1| lipid transfer protein, putative [Arabidopsis thaliana]
 gb|AEE30894.1| glycosylphosphatidylinositol-anchored lipid protein transfer 
1 [Arabidopsis thaliana]
Length=193

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++ED+L+
Sbjct  41   KVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLI  100

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C+L NAS TNCPKLL +   SPDAA+FTN  T+     TP A  G S + PAT+
Sbjct  101  QLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATT-----TPVAPAGKSPATPATS  154



>ref|XP_010499289.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Camelina sativa]
Length=198

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLCYVIQQ   G  ++  LG++ED+L+
Sbjct  44   KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCYVIQQAKTGGQALKDLGVQEDKLI  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C++ NAS  NCPKLL L   SPDAA+FTN  TS   S  P A  G S + PAT+
Sbjct  104  QLPTSCQIHNASIANCPKLLGLSPSSPDAAVFTNNATS---STAPVAPAGKSPATPATS  159



>gb|KHN44444.1| Putative GPI-anchored protein [Glycine soja]
Length=193

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G  + P K+CCD+ +SIKE++P CLCY+I++ HKG   V SLGI+E +LL
Sbjct  39   KVIPCLDFAKGKEETPKKQCCDAATSIKESNPECLCYIIEETHKGSPQVKSLGIQEAKLL  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            +LPS C + NAS TNCPKLL L   SPDAAIFT+      +SKT  ++P  S SQ  T
Sbjct  99   QLPSVCNVKNASITNCPKLLGLSPSSPDAAIFTS-----NSSKTTPSAPATSNSQTTT  151



>ref|NP_001235887.1| uncharacterized protein LOC100499777 precursor [Glycine max]
 gb|ACU13575.1| unknown [Glycine max]
Length=191

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G  + P K+CCD+ +SIKE++P CLCY+I++ HKG   V SLGI+E +LL
Sbjct  37   KVIPCLDFAKGKEETPKKQCCDAATSIKESNPECLCYIIEETHKGSPQVKSLGIQEAKLL  96

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            +LPS C + NAS TNCPKLL L   SPDAAIFT+      +SKT  ++P  S SQ  T
Sbjct  97   QLPSVCNVKNASITNCPKLLGLSPSSPDAAIFTS-----NSSKTTPSAPATSNSQTTT  149



>ref|XP_009372275.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Pyrus x bretschneideri]
Length=186

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL+YA G A+ P+K+CCDSV  I+ET P CLCYV+QQ + G   +  +G++  +LL
Sbjct  39   KVAVCLNYATGKAEMPTKECCDSVKGIRETQPECLCYVMQQANSGSEEIKKMGVQVAKLL  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT  503
            +LP+ C L NA+ ++CPKLL +PAGSP+AA+FTN  +S AT  T
Sbjct  99   QLPTACSLKNATVSDCPKLLGIPAGSPEAAVFTNNASSTATPTT  142



>ref|XP_009113721.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Brassica rapa]
Length=189

 Score =   124 bits (312),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD++  IKE DP CLCYVIQQ   G  ++  LG++E +L+
Sbjct  43   KVTLCLDFATGKAPTPSKKCCDAIEDIKEKDPKCLCYVIQQAKTGGQALKDLGVQEAKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C+L NAS +NCPKLL +   SPDAA+F    TS+AT+ TP A  G S + PAT+
Sbjct  103  QLPTACQLRNASISNCPKLLGISPSSPDAAVF----TSNATTITPEAPAGKSPATPATS  157



>ref|XP_008389894.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Malus domestica]
Length=183

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL+YA G AD P+K+CCDSV  I+ET P CLCYVIQQ + G   +  LGI+  +L+
Sbjct  39   KVAVCLNYATGKADTPTKECCDSVKGIRETQPECLCYVIQQANNGSEEIKKLGIQVAKLV  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LP+ C L NA+ ++CPKLL + AGSP+AAIF N  +S A   TP     G  S P   G
Sbjct  99   QLPTACSLKNATASDCPKLLGIAAGSPEAAIFNNNASSTA---TPTTGAAGQQSAPVKDG  155



>emb|CDY27641.1| BnaA09g27660D [Brassica napus]
Length=194

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD++  IKE DP CLCYVIQQ   G  ++  LG++E +L+
Sbjct  43   KVTLCLDFATGKAPTPSKKCCDAIEDIKERDPKCLCYVIQQAKTGGQALKDLGVQEAKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C+L NAS +NCPKLL +   SPDAA+F    TS+AT+ TP A  G S + PAT+
Sbjct  103  QLPTACQLHNASISNCPKLLGISPSSPDAAVF----TSNATTITPEAPAGKSPATPATS  157



>ref|XP_010540409.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010540410.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
isoform X2 [Tarenaya hassleriana]
Length=194

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KVM CL +A G    P+K+CCDSV  IK+ DP CLC++IQQ   G  ++  LG++ED+LL
Sbjct  48   KVMLCLDFARGKVATPTKQCCDSVGGIKDKDPKCLCFIIQQTRTGGEALKQLGVQEDKLL  107

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LPS C+L NAS ++CP+LL L   SPDAAIF+   TS   S TP  +   STS PAT+
Sbjct  108  QLPSACQLRNASISDCPRLLGLAPNSPDAAIFSGNATS---SSTPAGNSPWSTSTPATS  163



>ref|XP_009412766.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Musa acuminata subsp. malaccensis]
Length=179

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K++ C  YA G+ + P+  CC SV  I+ + PVCLCYVIQQ H G S+  SLG+K DRL+
Sbjct  42   KLLPCQDYASGSKEEPTSDCCSSVKDIRGSQPVCLCYVIQQTHSGSSAFKSLGLKVDRLV  101

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
            +LP+ CKLAN+S ++CPKLLNL   SPD +IFTN TT++ TS
Sbjct  102  QLPTACKLANSSVSDCPKLLNLSRSSPDYSIFTNITTANTTS  143



>gb|KHN24060.1| Putative GPI-anchored protein [Glycine soja]
Length=193

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL++A G  + P K+CCD+ ++IKE++P CLCY+IQ+ HKG   V SLGI+E +LL
Sbjct  39   KVIPCLNFATGKEEMPKKECCDAATAIKESNPECLCYIIQETHKGSPQVKSLGIQEAKLL  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA  512
            +LPS C + NAS TNCPKLL L   SPDAAIF    TS+++  TP A
Sbjct  99   QLPSVCNVKNASITNCPKLLGLSPSSPDAAIF----TSNSSKTTPSA  141



>ref|NP_001235727.1| uncharacterized protein LOC100305718 precursor [Glycine max]
 gb|ACU13547.1| unknown [Glycine max]
Length=193

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL++A G  + P K+CCD+ ++IKE++P CLCY+IQ+ HKG   V SLGI+E +LL
Sbjct  39   KVIPCLNFATGKEEMPKKECCDAATAIKESNPECLCYIIQETHKGSPQVKSLGIQEAKLL  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA  512
            +LPS C + NAS TNCPKLL L   SPDAAIF    TS+++  TP A
Sbjct  99   QLPSVCNVKNASITNCPKLLGLSPSSPDAAIF----TSNSSKTTPSA  141



>ref|XP_006305638.1| hypothetical protein CARUB_v10010343mg [Capsella rubella]
 gb|EOA38536.1| hypothetical protein CARUB_v10010343mg [Capsella rubella]
Length=197

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++ED+L+
Sbjct  43   KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C++ NAS +NCPKLL L   SPDAA+FT+  T   TS +P A  G +   PAT+
Sbjct  103  QLPTSCQIHNASISNCPKLLGLSPSSPDAAVFTSNAT---TSTSPVAPAGKTPVTPATS  158



>ref|XP_011086802.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Sesamum indicum]
Length=237

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKG-DSSVTSLGIKE  359
            E  KV  CL +    A  P+K+CCDSV+ +K+T+P C+CY+IQQ+H G +++V S+G++E
Sbjct  84   EFTKVTQCLPFVTAKAAVPTKECCDSVTDLKDTNPACICYIIQQIHNGSNAAVKSMGVQE  143

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN  473
             RLL+L S CKLANAS + CPKLL+LP  SPDAAIFTN
Sbjct  144  SRLLQLQSACKLANASVSECPKLLHLPPNSPDAAIFTN  181



>ref|XP_007225920.1| hypothetical protein PRUPE_ppa012022mg [Prunus persica]
 gb|EMJ27119.1| hypothetical protein PRUPE_ppa012022mg [Prunus persica]
Length=187

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CLSYA G A+ P+K+CC+SV  IK+++P CLCYV+QQ + G   +  +GI+  +LL
Sbjct  36   KVAVCLSYATGKAETPTKECCESVKGIKDSEPECLCYVMQQANSGSDEIKKMGIQVAKLL  95

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LP+ C L NAS ++CPKLL +PAGSP+AAIF N    +A++ TP A  G   S P  AG
Sbjct  96   QLPTACSLKNASASDCPKLLGIPAGSPEAAIFNN----NASTATPSAPAG--KSAPTKAG  149



>emb|CDY60398.1| BnaCnng36210D [Brassica napus]
Length=194

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 4/119 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD++  IKE DP CLCYVIQQ   G  ++  LG++E +L+
Sbjct  43   KVTLCLDFATGKAPTPSKKCCDAIEDIKEKDPKCLCYVIQQAKTGGQALKDLGVQEVKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C+L NAS +NCP LL +   SPDAA+F    TS+AT+ TP A  G S + PAT+
Sbjct  103  QLPTACQLHNASISNCPNLLGISPSSPDAAVF----TSNATTITPEAPAGKSPATPATS  157



>gb|KDP26810.1| hypothetical protein JCGZ_17968 [Jatropha curcas]
Length=178

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL+YA G A+ P+K CC SV  +KE+DP CLC++IQQ H G + + SLGI+E +LL
Sbjct  32   KVTPCLNYATGKANTPTKDCCGSVKELKESDPKCLCFMIQQTHNGSAQIKSLGIQETKLL  91

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN  473
            +LPS C+L NAS + CPKLL L   SPDAAIFTN
Sbjct  92   QLPSACQLQNASISFCPKLLGLSPSSPDAAIFTN  125



>ref|XP_010478148.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Camelina sativa]
Length=198

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLCYV+QQ   G  ++  LG++ED+L+
Sbjct  44   KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCYVMQQAKTGGQALKDLGVQEDKLI  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGG-STSQPATA  548
            +LP+ C+L NAS  NCPKLL +   SP+AA F N    +ATS T   +PGG S + PAT+
Sbjct  104  QLPTSCQLHNASIANCPKLLGISPSSPEAAAFAN----NATSSTAPVAPGGKSPATPATS  159



>ref|XP_008222168.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Prunus mume]
Length=188

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL+YA G A+ P+K+CC+SV  I++++P CLCYV+QQ + G   +  +GI+  +LL
Sbjct  36   KVAVCLNYATGKAETPTKECCESVKGIRDSEPECLCYVMQQANSGSDEIKKMGIQVAKLL  95

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTP  506
            +LP+ C L NAS ++CPKLL +PAGSP+AAIF N  +S AT   P
Sbjct  96   QLPTACSLKNASASDCPKLLGIPAGSPEAAIFNNNASSTATPSAP  140



>ref|XP_003524896.2| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Glycine max]
Length=179

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL++A G A  P+K CC++ S IK++DP CLC+ IQQ HKG   V ++GI+E RLL
Sbjct  42   KVLPCLNFATGQAAVPTKDCCEATSEIKKSDPECLCFAIQQTHKGSPEVKNMGIQEARLL  101

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT  503
            +LPS C L NASTTNCPKLL L   S DAAIF N +    ++ T
Sbjct  102  QLPSACNLKNASTTNCPKLLGLSPNSADAAIFRNGSLKTNSAST  145



>emb|CDY03956.1| BnaC07g11810D [Brassica napus]
Length=195

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD++   KE DP CLCYVIQQ   G  ++  LG++ED+L+
Sbjct  43   KVTLCLDFATGKAPNPSKKCCDAIEDTKERDPKCLCYVIQQAKTGGQALKDLGVQEDKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGST  530
            +LP+ C+L NAS +NCPKLL +   SPDAA+FTN    +ATS T   +P G +
Sbjct  103  QLPTSCQLHNASISNCPKLLGISPSSPDAAVFTN----NATSTTTPVAPAGKS  151



>gb|KHN34821.1| Putative GPI-anchored protein [Glycine soja]
Length=172

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL++A G A  P+K CC++ S IK++DP CLC+ IQQ HKG   V ++GI+E RLL
Sbjct  35   KVLPCLNFATGQAAVPTKDCCEATSEIKKSDPECLCFAIQQTHKGSPEVKNMGIQEARLL  94

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT  503
            +LPS C L NASTTNCPKLL L   S DAAIF N +    ++ T
Sbjct  95   QLPSACNLKNASTTNCPKLLGLSPNSADAAIFRNGSLKTNSAST  138



>gb|EYU33443.1| hypothetical protein MIMGU_mgv1a014418mg [Erythranthe guttata]
Length=190

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKG-DSSVTSLGIKE  359
            E  KV  CL +    A APSK CC SV  +KE+DP CLCY+IQQ+H G +++V S+G++E
Sbjct  31   EFTKVTPCLPFVTAKAAAPSKDCCSSVEDLKESDPACLCYIIQQIHNGTNAAVKSMGVQE  90

Query  360  DRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
             RLL+LPS CKLANAS   CPKLL+LP  S DAAIF
Sbjct  91   SRLLQLPSSCKLANASVAECPKLLHLPPNSSDAAIF  126



>ref|XP_010044816.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Eucalyptus grandis]
Length=200

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDS-SVTSLGIKEDRL  368
            KV  CL +  G   APSK+CC SV  I+E+DP CLC+ I+Q+H G S  + S+ I+E RL
Sbjct  48   KVTSCLDFVQGKGAAPSKQCCGSVGEIRESDPACLCFFIEQIHNGSSPMIKSMNIQESRL  107

Query  369  LKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS  485
            L+LPS C L N+S ++CPKLL +P  SPDAAIFTNA++S
Sbjct  108  LQLPSACNLKNSSVSDCPKLLGIPPSSPDAAIFTNASSS  146



>ref|XP_004974009.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Setaria italica]
Length=182

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DCL YA G A +PS  CC   +  +++ P CLCY+IQQVH G + V SLG+K DRL+
Sbjct  44   KLTDCLDYATGHAGSPSSTCCADAADTQKSRPQCLCYIIQQVHNGRNEVQSLGLKFDRLM  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             LP+ CKLANA+ T C  LLNL  GSPD A+F NA  SH T      S GG+ +  +TAG
Sbjct  104  ALPAACKLANANVTLCINLLNLKPGSPDYALFANA--SHITP-----SAGGTPASDSTAG  156

Query  552  GGL  560
             G 
Sbjct  157  SGF  159



>gb|KCW86921.1| hypothetical protein EUGRSUZ_B03498 [Eucalyptus grandis]
Length=240

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDS-SVTSLGIKEDRL  368
            KV  CL +  G   APSK+CC SV  I+E+DP CLC+ I+Q+H G S  + S+ I+E RL
Sbjct  88   KVTSCLDFVQGKGAAPSKQCCGSVGEIRESDPACLCFFIEQIHNGSSPMIKSMNIQESRL  147

Query  369  LKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS  485
            L+LPS C L N+S ++CPKLL +P  SPDAAIFTNA++S
Sbjct  148  LQLPSACNLKNSSVSDCPKLLGIPPSSPDAAIFTNASSS  186



>ref|XP_003601770.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES72021.1| lipid transfer protein [Medicago truncatula]
Length=192

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G A  P K+CCD+ +SIK TDP CLCY+IQQ HKG     S+GI+ED+LL
Sbjct  38   KVIPCLDFATGKAPTPKKECCDAANSIKATDPECLCYIIQQTHKGSPESKSMGIQEDKLL  97

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSH  488
            +LP+ C +  A+ ++CPKLL L A SPDAAIF NA+ ++
Sbjct  98   QLPTVCHVNGANISDCPKLLGLSANSPDAAIFKNASKAN  136



>gb|AFK34697.1| unknown [Medicago truncatula]
Length=192

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL +A G A  P K+CCD+ +SIK TDP CLCY+IQQ HKG     S+GI+ED+LL
Sbjct  38   KVIPCLDFATGKAPTPKKECCDAANSIKATDPECLCYIIQQTHKGSPESKSMGIQEDKLL  97

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSH  488
            +LP+ C +  A+ ++CPKLL L A SPDAAIF NA+ ++
Sbjct  98   QLPTVCHVNGANISDCPKLLGLSANSPDAAIFKNASKAN  136



>ref|XP_011002127.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Populus euphratica]
Length=188

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 83/135 (61%), Gaps = 8/135 (6%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KVM CL+YA G A+ P+K CC +V  IK+++P CLC+++QQ H G +   +LGI+E +LL
Sbjct  40   KVMGCLNYATGKANTPTKDCCSAVQGIKDSEPKCLCFIMQQAHNGSAQFKNLGIQEAKLL  99

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN------ATTSHATSKTPGASPGGSTS  533
            +LP+ C+L NAS + CPKLL L  GS  AAIFTN         S  T K+ G    G   
Sbjct  100  QLPTVCQLQNASLSFCPKLLGLSPGSAAAAIFTNASTSATTAASTGTGKSQGGDSSGIQQ  159

Query  534  QPATAGGGLWWVVQA  578
            +P  A  GL  +V A
Sbjct  160  RPTLA--GLLMIVAA  172



>ref|XP_009109768.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Brassica rapa]
 emb|CDX90115.1| BnaA08g18690D [Brassica napus]
Length=195

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL +A G A  PSKKCCD++  IKE DP CLC+VIQQ   G  ++  LG++E +L++LP+
Sbjct  47   CLDFASGKAPNPSKKCCDAIEDIKEKDPKCLCFVIQQAKSGGQTLKDLGVQEAKLIQLPT  106

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGST-SQPATA  548
             C+L NAS +NCPKLL +   SP AAIF    TS+ATS T  A+PGG++ + PAT+
Sbjct  107  SCQLHNASISNCPKLLGISPSSPAAAIF----TSNATSTTTPAAPGGTSPATPATS  158



>ref|XP_002299306.1| GPI-anchored protein precursor [Populus trichocarpa]
 gb|EEE84111.1| GPI-anchored protein precursor [Populus trichocarpa]
Length=247

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 85/151 (56%), Gaps = 28/151 (19%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KVM CLSYA G A+ P K CC +V  IK+++P CLCY +QQ H   S   SLG++E +LL
Sbjct  40   KVMGCLSYATGKANTPPKDCCSAVQDIKDSEPKCLCYTMQQAHNASSQFKSLGVQEAKLL  99

Query  372  KLPSECKLANASTTNCPK--------------------LLNLPAGSPDAAIFTNATTSHA  491
            +LP+ C+L NAS + CPK                    LL L  GS DAAIFTNA+    
Sbjct  100  QLPTACQLQNASLSFCPKTAIDVNRSLMLDLWLEKHPELLGLSPGSADAAIFTNAS----  155

Query  492  TSKTPGASPGGSTSQPATAGGGLWWVVQARP  584
            TS TP  S G   SQP  AGG     +Q RP
Sbjct  156  TSATPAVSTG--KSQPEQAGGS--SRIQLRP  182



>ref|XP_010549290.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Tarenaya hassleriana]
Length=189

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KVM CL +A G  + P+K+CCDSV  IKE DP CLC +IQQV  G  S+  LGI++D+LL
Sbjct  44   KVMLCLDFASGKVEKPTKQCCDSVEGIKEKDPKCLCVIIQQVKAGGDSLKQLGIQQDKLL  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFT-NATTS  485
            +LPS C+L NAS ++CP+LL +   SP+A+IF+ NAT+S
Sbjct  104  QLPSSCQLRNASISDCPRLLGMAPNSPEASIFSGNATSS  142



>ref|XP_010250696.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Nelumbo nucifera]
Length=198

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+  CL Y+ G A+ P+K+CC SV+S+++  PVCLC++IQQ H G   V  LG+KEDRLL
Sbjct  47   KLSPCLDYSTGKAELPTKECCTSVTSMRDQHPVCLCFLIQQTHNGRPEVKQLGLKEDRLL  106

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            K+   CKL NAS + CP+LLNLP  SPD AIF
Sbjct  107  KISGTCKLTNASISECPRLLNLPRDSPDNAIF  138



>gb|KJB15533.1| hypothetical protein B456_002G183100 [Gossypium raimondii]
Length=188

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CLS+A G  + PSK+CC SVSSIKE +P CLCY++QQ    G  ++ SLG+++D+LL
Sbjct  37   VMTCLSFAQGKMEKPSKECCSSVSSIKEEEPKCLCYILQQTQASGAQNLKSLGVQQDKLL  96

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            +LPS C+L NAS T+CPKLL L   SPDAAIF
Sbjct  97   QLPSACQLKNASVTDCPKLLGLAPNSPDAAIF  128



>gb|KHG23710.1| hypothetical protein F383_10500 [Gossypium arboreum]
Length=188

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CLS+A G  + PSK+CC SVSSIKE +P CLCY++QQ    G  ++ SLG+++D+LL
Sbjct  37   VMTCLSFAQGKMEKPSKECCSSVSSIKEEEPKCLCYILQQTQASGAQNLKSLGVQQDKLL  96

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            +LPS C+L NAS T+CPKLL L   SPDAAIF
Sbjct  97   QLPSACQLKNASVTDCPKLLGLAPNSPDAAIF  128



>gb|AGC08431.1| lipid transfer protein [Gossypium hirsutum]
Length=157

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +3

Query  198  MDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLLK  374
            M CLS+A G A +PSK+CC+SV+ IKE  P CLCY++QQ    G  ++ SLG++ED+L +
Sbjct  1    MTCLSFAQGKAASPSKECCNSVAGIKENKPKCLCYILQQTQTSGAQNLKSLGVQEDKLFQ  60

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIFTN  473
            LPS C+L NAS ++CPKLL L   SPDAAIFTN
Sbjct  61   LPSACQLKNASVSDCPKLLGLSPSSPDAAIFTN  93



>gb|KFK44671.1| hypothetical protein AALP_AA1G288600 [Arabis alpina]
Length=194

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSK+CCD++   KE DP CLC+VIQQ   G  ++  LG++E +L+
Sbjct  43   KVTLCLDFATGKAPKPSKQCCDAIEETKERDPKCLCFVIQQAKTGGQALKDLGVQEAKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LPS C+L NAS ++CPKLL +   SPDAA+F    TS+ T+ T  A  G S + PAT+ 
Sbjct  103  QLPSACELKNASISDCPKLLGISPSSPDAAVF----TSNVTAPTTAAPTGKSPATPATSA  158



>emb|CDY11759.1| BnaC03g58190D [Brassica napus]
Length=195

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL +A G A  PSKKCCD++  IKE DP CLC+VIQQ   G  ++  LG++E +L++LP+
Sbjct  47   CLDFASGKAPNPSKKCCDAIEDIKEKDPKCLCFVIQQAKSGGQTLKDLGVQEAKLIQLPT  106

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGST-SQPATA  548
             C+L NAS +NCPKLL +   SPDAAIF    TS+AT+ T   +PGG++ + PAT+
Sbjct  107  SCQLHNASISNCPKLLGISPSSPDAAIF----TSNATTTTTPVAPGGTSPATPATS  158



>ref|XP_010926816.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Elaeis guineensis]
Length=197

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  K+  CL +A    D P+ +CC SV+ I+  D  CLCY+IQQ H G S++ SLG++ D
Sbjct  35   EFQKLTGCLDFAAAKTDTPTSQCCSSVTDIRNKDAACLCYIIQQTHAGSSTIKSLGLQFD  94

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            RLL+LP  CKLANAS ++CPKLLN+   SPD +IF
Sbjct  95   RLLQLPQACKLANASVSDCPKLLNISPSSPDYSIF  129



>ref|XP_006415714.1| hypothetical protein EUTSA_v10008820mg [Eutrema salsugineum]
 gb|ESQ34067.1| hypothetical protein EUTSA_v10008820mg [Eutrema salsugineum]
Length=198

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++E +L+
Sbjct  43   KVTLCLDFATGKAPNPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEGKLI  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN  473
            +LP+ C+L NAS +NCPKLL +   SPDAA+F +
Sbjct  103  QLPTSCQLHNASISNCPKLLGISPSSPDAAVFNS  136



>gb|KDO81894.1| hypothetical protein CISIN_1g029795mg [Citrus sinensis]
Length=187

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSS-VTSLGIKEDRL  368
            K M CL +A G    PSK+CC +V  IK+ DP CLCY+I++ + G+   V +LG++  +L
Sbjct  38   KTMACLDFARGKITTPSKECCSAVKGIKDDDPKCLCYIIKEANGGEGDMVKNLGVQVPKL  97

Query  369  LKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS  515
            L+LPS C+L NAST+ CPKLL L   SPDAAIFTN T+S AT  TP A+
Sbjct  98   LQLPSACQLKNASTSLCPKLLGLSPSSPDAAIFTN-TSSSATPTTPAAA  145



>ref|NP_001062343.1| Os08g0532800 [Oryza sativa Japonica Group]
 dbj|BAD11655.1| lipid transfer protein-like [Oryza sativa Japonica Group]
 dbj|BAF24257.1| Os08g0532800 [Oryza sativa Japonica Group]
 gb|EAZ43459.1| hypothetical protein OsJ_28065 [Oryza sativa Japonica Group]
 dbj|BAG87798.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=179

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G  +APS  CC  +S+ ++  P CLCY+IQQVH G + V SLG++ DRLL
Sbjct  38   KLTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLL  97

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
             +P+ CKL NA+ + C  LL+L   SPD A+F NA+ + AT+
Sbjct  98   AMPTACKLPNANVSLCINLLHLTPSSPDYAVFANASKAAATT  139



>gb|EAZ07773.1| hypothetical protein OsI_30026 [Oryza sativa Indica Group]
Length=180

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G  +APS  CC  +S+ ++  P CLCY+IQQVH G + V SLG++ DRLL
Sbjct  39   KLTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLL  98

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
             +P+ CKL NA+ + C  LL+L   SPD A+F NA+ + AT+
Sbjct  99   AMPTACKLPNANVSLCINLLHLTPSSPDYAVFANASKAAATT  140



>gb|AGT16035.1| lipid transfer protein [Saccharum hybrid cultivar R570]
Length=181

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 74/123 (60%), Gaps = 9/123 (7%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC  V   ++  P CLCY+IQQVH G + V SLG++ DRL+
Sbjct  45   KLTDCMDYATGHAASPSSTCCGDVGDTEKARPECLCYIIQQVHTGRNQVQSLGLRFDRLI  104

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             LP+ C L NA+ + C  LLNL  GSPD A+F N     A+  TP A+P   +    T+G
Sbjct  105  ALPAACNLPNANVSLCINLLNLKPGSPDYALFAN-----ASKITPSANPASDS----TSG  155

Query  552  GGL  560
             G 
Sbjct  156  SGF  158



>dbj|BAD11656.1| lipid transfer protein-like [Oryza sativa Japonica Group]
 dbj|BAG87895.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96545.1| unnamed protein product [Oryza sativa Japonica Group]
Length=178

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G  +APS  CC  +S+ ++  P CLCY+IQQVH G + V SLG++ DRLL
Sbjct  38   KLTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLL  97

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHAT  494
             +P+ CKL NA+ + C  LL+L   SPD A+F NA+ +  T
Sbjct  98   AMPTACKLPNANVSLCINLLHLTPSSPDYAVFANASKAATT  138



>ref|XP_009411202.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Musa acuminata subsp. malaccensis]
Length=145

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  KV  C+ YA   A APS  CC +V+ I+  D VCLCY+IQQ H G S++ SLG++ D
Sbjct  36   EFTKVTSCMDYATAKASAPSSSCCSAVTDIRNADAVCLCYIIQQTHGGSSTIKSLGLQFD  95

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNAT  479
            RLL+LP  CKLAN S +NCPKLL L   SPD AIF NAT
Sbjct  96   RLLQLPDACKLANTSVSNCPKLLKLSPSSPDYAIFMNAT  134



>ref|XP_007044002.1| Glycosylphosphatidylinositol-anchored lipid protein transfer 
1, putative isoform 1 [Theobroma cacao]
 gb|EOX99833.1| Glycosylphosphatidylinositol-anchored lipid protein transfer 
1, putative isoform 1 [Theobroma cacao]
Length=240

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CL++A G    P+K+CC SVS+IKE +P CLCY++QQ    G  ++ SLG++E +LL
Sbjct  94   VMTCLNFAQGKVATPTKECCSSVSTIKENEPKCLCYLLQQTQTSGAQNLKSLGVQEAKLL  153

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            +LPS C+L NAS ++CPKLL L   SPDAAIF
Sbjct  154  QLPSACQLKNASVSDCPKLLGLSPNSPDAAIF  185



>ref|NP_001150532.1| lipid transfer protein precursor [Zea mays]
 gb|ACG39430.1| lipid transfer protein [Zea mays]
 gb|AFW61588.1| putative bifunctional inhibitor/LTP/seed storage protein family 
[Zea mays]
Length=185

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 69/114 (61%), Gaps = 3/114 (3%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC      ++  P CLCY+IQQVH G   V SLG++ DRLL
Sbjct  46   KLTDCMDYATGHAASPSSTCCGDAGGTQKARPECLCYIIQQVHAGRDQVQSLGLRFDRLL  105

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTS  533
             LP+ C L NA+ + C  LLNL  GSPD A+F NA+     + + G SP   T+
Sbjct  106  ALPAACSLPNANVSLCINLLNLKPGSPDYALFANASK---ITPSAGGSPASDTA  156



>ref|XP_002444694.1| hypothetical protein SORBIDRAFT_07g026120 [Sorghum bicolor]
 gb|EES14189.1| hypothetical protein SORBIDRAFT_07g026120 [Sorghum bicolor]
Length=180

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 72/123 (59%), Gaps = 9/123 (7%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC      ++  P CLCY+IQQVH G + V SLG++ DRL+
Sbjct  44   KLTDCMDYATGHAASPSSTCCGDAGDTEKARPECLCYIIQQVHTGRNQVQSLGLRFDRLI  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             LP+ C L N++ + C  LLNL  GSPD A+F N     A+  TP  +P   +    TAG
Sbjct  104  ALPAACNLPNSNVSLCINLLNLKPGSPDYALFAN-----ASKITPSTNPASDS----TAG  154

Query  552  GGL  560
             G 
Sbjct  155  SGF  157



>ref|XP_010682757.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Beta vulgaris subsp. vulgaris]
Length=187

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            +++ CL++A G    P+K+CC SV+S+KE  PVCLC+ I Q H G   + SLGI+E +LL
Sbjct  42   QLISCLNFAKGDVPTPTKECCTSVTSMKEKQPVCLCFFIGQAHNGSEQIKSLGIQEAKLL  101

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            +LPS C + NAS T+CP+LL +   SP A+IF
Sbjct  102  QLPSSCHINNASATDCPRLLGISPTSPAASIF  133



>dbj|BAJ85750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 68/124 (55%), Gaps = 0/124 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G  D PS KCC+  +  +   P CLC +IQQVH G   V  LG++ DRLL
Sbjct  37   KLSDCMDYATGHEDTPSAKCCEDTADTQRARPECLCNIIQQVHSGSHGVQQLGLRFDRLL  96

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
              P+ CKLANA+ + C  LL+L   SPD A+F NA+    ++  P          P   G
Sbjct  97   AQPAACKLANANVSLCINLLHLTPSSPDYALFANASKITPSTAAPARDTADGFKVPTGLG  156

Query  552  GGLW  563
             G+ 
Sbjct  157  YGIM  160



>gb|KJB15532.1| hypothetical protein B456_002G183100 [Gossypium raimondii]
Length=183

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 6/92 (7%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CLS+A G  + PSK+CC SVSSIKE +P CLCY++QQ    G  ++ SLG+++D+LL
Sbjct  37   VMTCLSFAQGKMEKPSKECCSSVSSIKEEEPKCLCYILQQTQASGAQNLKSLGVQQDKLL  96

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            +LPS C+L NAS T+CP        SPDAAIF
Sbjct  97   QLPSACQLKNASVTDCPT-----PNSPDAAIF  123



>ref|XP_004310085.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Fragaria vesca subsp. vesca]
Length=195

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL+YA G A  P+K+CC+SV  +KET+P CLCYVIQQ + G   +  +GI+  +LL
Sbjct  38   KVAVCLTYATGKAATPTKECCESVKGLKETEPECLCYVIQQANSGSEEIKKMGIQVAKLL  97

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            +LPS C L NAS +NCP LL L   SPDAAIF
Sbjct  98   QLPSACSLKNASASNCPALLGLAPNSPDAAIF  129



>gb|ACG24900.1| lipid transfer protein [Zea mays]
Length=181

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC      ++  P CLCY+IQQVH G + V SLG++ DRL+
Sbjct  43   KLTDCMDYATGHAASPSSTCCGDAGDTEKARPECLCYIIQQVHTGRNQVQSLGLRFDRLM  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             LP+ C L N++ + C  LLNL  GS D A+F N     A+  TP  S GG+ +  + AG
Sbjct  103  ALPAACNLPNSNVSLCITLLNLKPGSADYALFAN-----ASKITP--SAGGNPASDSAAG  155

Query  552  GGL  560
             G+
Sbjct  156  SGV  158



>ref|NP_001130434.1| uncharacterized protein LOC100191531 precursor [Zea mays]
 gb|ACG39432.1| lipid transfer protein [Zea mays]
 tpg|DAA48231.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=181

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC      ++  P CLCY+IQQ H G + V SLG++ DRL+
Sbjct  43   KLTDCMDYATGHAASPSSTCCGDAGDTEKARPECLCYIIQQTHTGRNQVQSLGLRFDRLM  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             LP+ C L N++ + C  LLNL  GS D A+F N     A+  TP  S GG+ +  + AG
Sbjct  103  ALPAACNLPNSNVSLCITLLNLKPGSADYALFAN-----ASKITP--SAGGNPASDSAAG  155

Query  552  GGL  560
             G+
Sbjct  156  SGV  158



>ref|XP_007158680.1| hypothetical protein PHAVU_002G173300g [Phaseolus vulgaris]
 gb|ESW30674.1| hypothetical protein PHAVU_002G173300g [Phaseolus vulgaris]
Length=180

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 72/123 (59%), Gaps = 12/123 (10%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV+ CL++A G A  P+K+CC++   IK++DP CLC+ IQQ HKG     S+GI+E RLL
Sbjct  34   KVIPCLNFATGQAAVPTKECCEATLEIKKSDPKCLCFAIQQTHKGIPEAKSMGIQEGRLL  93

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
            +LPS C L NASTTNCP             IF N +    +S T G +   S +  A+ G
Sbjct  94   QLPSACNLKNASTTNCP------------TIFRNGSLKINSSSTLGTAIPLSDTHKASFG  141

Query  552  GGL  560
              L
Sbjct  142  TML  144



>ref|XP_006484108.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Citrus sinensis]
Length=187

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSS-VTSLGIKEDRL  368
            K M CL +A G    PSK+CC +V  IK+ DP CLCY+I++ + G+   V +LG++  +L
Sbjct  38   KTMACLDFARGKITTPSKECCSAVKGIKDDDPKCLCYIIKEANGGEGDMVKNLGVQVPKL  97

Query  369  LKLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            L+LPS C+L NAST+ CPKLL L   SPDAAIF
Sbjct  98   LQLPSACQLKNASTSLCPKLLGLSPSSPDAAIF  130



>gb|ABI81469.1| lipid transfer protein-like protein [Noccaea caerulescens]
Length=115

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +3

Query  273  KETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTNCPKLLNLPAGSP  452
            KE DP CLC+VIQQ   G  ++  LG++E +L++LP+ C+L NAS +NCPKLL +   SP
Sbjct  1    KERDPKCLCFVIQQAKSGGQTLKDLGVQEAKLIQLPTSCQLQNASISNCPKLLGISPSSP  60

Query  453  DAAIFTNATTSHATSKTPGASPGGSTSQPATAGGG  557
            DAA+FT   TS A    PGAS G S + PAT   G
Sbjct  61   DAAVFTGNATSPA---APGASSGKSPATPATVKAG  92



>tpg|DAA48230.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=265

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC      ++  P CLCY+IQQ H G + V SLG++ DRL+
Sbjct  43   KLTDCMDYATGHAASPSSTCCGDAGDTEKARPECLCYIIQQTHTGRNQVQSLGLRFDRLM  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS  485
             LP+ C L N++ + C  LLNL  GS D A+F NA+ S
Sbjct  103  ALPAACNLPNSNVSLCITLLNLKPGSADYALFANASKS  140



>gb|KJB15530.1| hypothetical protein B456_002G183100 [Gossypium raimondii]
Length=118

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CLS+A G  + PSK+CC SVSSIKE +P CLCY++QQ    G  ++ SLG+++D+LL
Sbjct  37   VMTCLSFAQGKMEKPSKECCSSVSSIKEEEPKCLCYILQQTQASGAQNLKSLGVQQDKLL  96

Query  372  KLPSECKLANASTTNCP  422
            +LPS C+L NAS T+CP
Sbjct  97   QLPSACQLKNASVTDCP  113



>gb|KJB15531.1| hypothetical protein B456_002G183100 [Gossypium raimondii]
Length=151

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CLS+A G  + PSK+CC SVSSIKE +P CLCY++QQ    G  ++ SLG+++D+LL
Sbjct  37   VMTCLSFAQGKMEKPSKECCSSVSSIKEEEPKCLCYILQQTQASGAQNLKSLGVQQDKLL  96

Query  372  KLPSECKLANASTTNCP  422
            +LPS C+L NAS T+CP
Sbjct  97   QLPSACQLKNASVTDCP  113



>emb|CDY15701.1| BnaA07g08720D [Brassica napus]
Length=124

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CL +A G A  PSKKCCD++   KE DP CLCYVIQQ   G  ++  LG++ED+L+
Sbjct  43   KVTLCLDFATGKAPNPSKKCCDAIEDTKERDPKCLCYVIQQAKTGGQALKDLGVQEDKLI  102

Query  372  KLPSECKLANASTTNCPK  425
            +LP+ C+L NAS +NCP+
Sbjct  103  QLPTSCQLHNASISNCPR  120



>gb|ACF78638.1| unknown [Zea mays]
Length=134

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 7/118 (6%)
 Frame = +3

Query  207  LSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSE  386
            + YA G A +PS  CC      ++  P CLCY+IQQ H G + V SLG++ DRL+ LP+ 
Sbjct  1    MDYATGHAASPSSTCCGDAGDTEKARPECLCYIIQQTHTGRNQVQSLGLRFDRLMALPAA  60

Query  387  CKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGGL  560
            C L N++ + C  LLNL  GS D A+F N     A+  TP  S GG+ +  + AG G+
Sbjct  61   CNLPNSNVSLCITLLNLKPGSADYALFAN-----ASKITP--SAGGNPASDSAAGSGV  111



>gb|KJB78080.1| hypothetical protein B456_012G176200 [Gossypium raimondii]
Length=195

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CLS+A G A +PSK+CC+SV+ IKE  P CLCY++QQ    G  ++ SLG++ED+L 
Sbjct  39   VMTCLSFAQGKAASPSKECCNSVTEIKENKPKCLCYILQQTQTSGAQNLKSLGVQEDKLF  98

Query  372  KLPSECKLANASTTNCP  422
            +LPS C+L NAS ++CP
Sbjct  99   QLPSACQLKNASVSDCP  115



>ref|XP_008368324.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1-like 
[Malus domestica]
Length=118

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            KV  CLSYA G A+ P+K+CCDSV  I++T P CLCYV+QQ + G   +  +G++  +LL
Sbjct  39   KVAVCLSYATGKAETPTKECCDSVKGIRDTQPECLCYVMQQANSGSEEIKKMGVQVAKLL  98

Query  372  KLPSECKLANASTTNCP  422
            KLP+ C L NA+ ++CP
Sbjct  99   KLPTACSLKNATASDCP  115



>ref|XP_007044003.1| Glycosylphosphatidylinositol-anchored lipid protein transfer 
1, putative isoform 2 [Theobroma cacao]
 ref|XP_007044004.1| Glycosylphosphatidylinositol-anchored lipid protein transfer 
1, putative isoform 2 [Theobroma cacao]
 gb|EOX99834.1| Glycosylphosphatidylinositol-anchored lipid protein transfer 
1, putative isoform 2 [Theobroma cacao]
 gb|EOX99835.1| Glycosylphosphatidylinositol-anchored lipid protein transfer 
1, putative isoform 2 [Theobroma cacao]
Length=176

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVH-KGDSSVTSLGIKEDRLL  371
            VM CL++A G    P+K+CC SVS+IKE +P CLCY++QQ    G  ++ SLG++E +LL
Sbjct  94   VMTCLNFAQGKVATPTKECCSSVSTIKENEPKCLCYLLQQTQTSGAQNLKSLGVQEAKLL  153

Query  372  KLPSECKLANASTTNCP  422
            +LPS C+L NAS ++CP
Sbjct  154  QLPSACQLKNASVSDCP  170



>ref|XP_003572451.2| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Brachypodium distachyon]
Length=220

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSS--VTSLGIKEDR  365
             + +C+ YA G   +PS  CC  +S  ++  P CLCY+IQQVH    +     LG++ DR
Sbjct  81   HLTECMDYATGHEPSPSSTCCGDISDTQKARPECLCYIIQQVHGAGQAHGTQQLGLRFDR  140

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNAT  479
            +L LP+ CKLA A+ + C  LL+L   SPD A+F NA+
Sbjct  141  VLALPTACKLAGANVSLCINLLHLTPSSPDYAMFLNAS  178



>ref|XP_006848247.1| hypothetical protein AMTR_s00013p00038620 [Amborella trichopoda]
 gb|ERN09828.1| hypothetical protein AMTR_s00013p00038620 [Amborella trichopoda]
Length=179

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E   +M CL Y   +  +P+K+CC  ++ ++E   +CLCY+++ +  GD +V SL +   
Sbjct  37   EVNNLMPCLPYTQKSDPSPTKECCTKLTDVEERSVLCLCYLLRLIVNGDRTVKSLNLDLT  96

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT  503
            R L+LP+ CK+ NA+ T CPK+LN+   SP+ AIF N ++ ++TS T
Sbjct  97   RTLQLPTVCKI-NANVTQCPKILNISPSSPEYAIFMNQSSGNSTSGT  142



>ref|XP_006660326.1| PREDICTED: protein YLS3-like, partial [Oryza brachyantha]
Length=119

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  252  CDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTNCPKLL  431
            C   S  +   P CLCY++QQVH G + V SLG++ DRLL +P+ CKL NA+ + C  LL
Sbjct  1    CGDTSETQRQRPECLCYIVQQVHSGRNEVQSLGLRFDRLLAMPAACKLPNANVSLCINLL  60

Query  432  NLPAGSPDAAIFTNAT  479
            +L   SPD A+F NA+
Sbjct  61   HLTPSSPDYALFANAS  76



>gb|ACG28264.1| lipid transfer protein [Zea mays]
Length=122

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G A +PS  CC      ++  P CLCY+IQQVH G + V SLG++ DRL+
Sbjct  43   KLTDCMDYATGHAASPSSTCCGDAGDTEKARPECLCYIIQQVHTGRNQVQSLGLRFDRLM  102

Query  372  KLPSECKLANASTTNC  419
             LP+ C L N++ + C
Sbjct  103  ALPAACNLPNSNVSLC  118



>gb|EMT23392.1| hypothetical protein F775_32194 [Aegilops tauschii]
Length=123

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+ DC+ YA G  D PS KCC+  +  +++ P CLC +IQQVH G   V  LG++ +RLL
Sbjct  37   KLSDCMDYATGHEDTPSAKCCEDTADTQKSRPECLCSIIQQVHSGSHGVQQLGLRFERLL  96

Query  372  KLPSECKLANASTTNC  419
              P+ CKL NA+ + C
Sbjct  97   AQPAACKLPNANVSLC  112



>ref|XP_011086771.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=197

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 13/114 (11%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ +  GTA  P+K+CCD    +K   P CLC +I++     SS  S+G  I     L++
Sbjct  46   CIPFVSGTAKQPTKECCDDTKKVKTAQPKCLCVLIKE-----SSDPSMGLPINTTLALQM  100

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFT--NATTSHATSKTPGASPGGSTS  533
            P+ C + +A  ++CP LLNLPA SPDA IF   NA +S   S     SP GST+
Sbjct  101  PAACNI-DAKVSDCPSLLNLPADSPDAKIFKVGNADSSTGAS---ADSPSGSTA  150



>ref|XP_010934234.1| PREDICTED: protein YLS3-like isoform X1 [Elaeis guineensis]
Length=183

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 71/130 (55%), Gaps = 11/130 (8%)
 Frame = +3

Query  192  KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            K+  CL+Y  G+A AP+  CC S+  + +    CLC +++   + +  + S  +     L
Sbjct  44   KLSTCLTYMQGSARAPTPDCCSSLKQVVDKSFKCLCILVKD--RNEPELASFKVNVTFAL  101

Query  372  KLPSECKL-ANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LPS+C + ANAS   CP+LLNLP  SPDA IF      + TS   GAS G  T+  +T 
Sbjct  102  RLPSKCGVPANASA--CPRLLNLPPNSPDAKIFEE--YGNMTSSDAGASDG--TASMSTR  155

Query  549  GGGLWWVVQA  578
             GG  W  +A
Sbjct  156  AGG--WRTEA  163



>gb|ABR16730.1| unknown [Picea sitchensis]
Length=188

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL--LKL  377
            C+ Y  G+A  P+K CCD +  +   DP CLC +I+     DSS   LGI  ++   L+L
Sbjct  40   CIPYVQGSAKFPAKDCCDGLLKLHLKDPKCLCVLIK-----DSSDPQLGITINKTLALQL  94

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATT  482
            P +CK+A A+ + CP LL++   SPDA +F N TT
Sbjct  95   PDDCKVA-ANVSRCPALLHISPNSPDAQVFKNTTT  128



>ref|XP_011009645.1| PREDICTED: protein YLS3-like [Populus euphratica]
 ref|XP_011009646.1| PREDICTED: protein YLS3-like [Populus euphratica]
Length=195

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 60/113 (53%), Gaps = 5/113 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC+ +  + + +  CLC +I+  +  D     L I     L LPS
Sbjct  46   CLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIKDRNDPD---LGLKINATLALSLPS  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTSQP  539
             C  A A+ + CP LLNLP  SPDA IF   A +S+ T+ +P  SP    +QP
Sbjct  103  VCH-APANVSQCPALLNLPPNSPDAQIFYQLANSSNHTASSPALSPSPGGAQP  154



>ref|XP_010088879.1| hypothetical protein L484_020867 [Morus notabilis]
 gb|EXB37076.1| hypothetical protein L484_020867 [Morus notabilis]
Length=199

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+ +CC+    +KET P CLC +I++    D SV  L I     L++PS
Sbjct  42   CIPFVSGTAKKPTPECCEDTRKVKETKPKCLCVLIKE--STDPSV-GLPINTTLALQMPS  98

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +A  ++CP +LNLP  SPDA IF+ A
Sbjct  99   ACNI-DAKVSDCPSILNLPPNSPDAKIFSEA  128



>dbj|BAJ95766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL++  G   AP+  CC  + ++ +T P CLC +++     D     L +   R L LP+
Sbjct  44   CLTFVQGQGQAPTPDCCGGLKTVLQTSPKCLCVLVK---DRDDPGLDLKLNVTRALGLPA  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGG-STSQPATAGGGL  560
             C  A A+ ++CP+LL+LP  S DA +F       A   +P  +P   ST    +A  G+
Sbjct  101  ACS-APANISDCPRLLHLPPNSKDAQVFEQFAKQQAAQSSPSGAPSAPSTGAQKSAATGM  159

Query  561  WW  566
             W
Sbjct  160  RW  161



>ref|XP_004135899.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
 gb|KGN45178.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=197

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 60/121 (50%), Gaps = 7/121 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + D  CLC +++  +  D     L I     L LP 
Sbjct  49   CLPYVSGDAKAPTPDCCSGLKEVLQNDKKCLCVIVRDRNDPD---LGLQINVTLALSLPD  105

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN---ATTSHATSKTPGASPGGSTSQPATAGG  554
             C  A A+ +NCP LLN+P+ S DA +F       +S A +  P  SP  S +  +T GG
Sbjct  106  ICH-ATANVSNCPALLNMPSNSSDAQVFYQLGKGKSSSALAPAPMLSPSSSPTINSTVGG  164

Query  555  G  557
            G
Sbjct  165  G  165



>gb|KGN58452.1| hypothetical protein Csa_3G645900 [Cucumis sativus]
Length=147

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  KKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTN  416
            ++CCDS+  IKE+ P CLC+ IQQ   G+  + SLGI+E +LL LPS C L ++S ++
Sbjct  5    EECCDSIEGIKESKPKCLCFFIQQTRNGNQHIKSLGIQEIKLLHLPSVCHLKSSSVSH  62



>ref|XP_004158216.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized GPI-anchored 
protein At1g27950-like [Cucumis sativus]
Length=186

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + D  CLC +++  +  D     L I     L LP 
Sbjct  39   CLPYVSGDAKAPTPDCCSGLKEVLKNDKKCLCVIVRDRNDPD---LGLQINVTLALSLPD  95

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF--TNATTSHATSKTPGASPGGSTSQPATAGGG  557
             C  A A+ +NCP LLN+P+ S DA +F      +S A +  P  SP  S +  +T GGG
Sbjct  96   ICH-ATANVSNCPALLNMPSNSSDAQVFYQLEGKSSSALAPAPMLSPSSSPTINSTVGGG  154



>ref|XP_006369483.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66052.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=197

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL Y  G A AP+  CC+ +  + + +  CLC +I+     D +   LG+K +    L L
Sbjct  48   CLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIK-----DRNDPELGLKINATLALSL  102

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTSQP  539
            PS C  A A+ + CP LLNLP  SPDA IF   A +S+  + +P  SP    +QP
Sbjct  103  PSVCH-APANVSQCPALLNLPPNSPDAQIFYQLANSSNHIASSPALSPSPGGAQP  156



>ref|XP_003561314.1| PREDICTED: protein YLS3-like isoform X2 [Brachypodium distachyon]
Length=196

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 4/105 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL++  G A AP+  CC  + ++ ++   CLC +   V   D     L I   R L LP+
Sbjct  43   CLTFVQGQAPAPTPDCCAGLKTVLQSSRKCLCVL---VKDRDDPGLGLKINVTRALGLPA  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASP  518
             C  A A+ ++CP+LLNLP  S DA +F +     A   +PG+ P
Sbjct  100  ACS-AAANISDCPRLLNLPPNSKDAQVFEDFAKQQAAQGSPGSGP  143



>ref|XP_004985580.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
isoform X2 [Setaria italica]
Length=194

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 65/142 (46%), Gaps = 26/142 (18%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP   CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  44   CLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  98

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF-----------------TNATTSHATSKTP  506
            PS C    A+ ++C +LL++P GS DAAIF                 T  T SHA   T 
Sbjct  99   PSACGATRANASHCAQLLHIPPGSKDAAIFSPGGDKGSSAAPAKDNSTATTDSHALQSTN  158

Query  507  GASPGGSTSQPATAGGGLWWVV  572
            G   GG  S  ATAG  L  V+
Sbjct  159  GG--GGGVSTAATAGVALTAVL  178



>ref|XP_007203697.1| hypothetical protein PRUPE_ppa022009mg [Prunus persica]
 gb|EMJ04896.1| hypothetical protein PRUPE_ppa022009mg [Prunus persica]
Length=207

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+ +CC++   +K   P CLC +I+Q    D S+ SL +     L++PS
Sbjct  41   CIPFVSGTAKKPTPECCENTKKVKANKPKCLCVLIKQ--STDPSM-SLPVNTTLALQMPS  97

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT  503
             C + +   ++CP +L LP  SPDA IF  A ++  TS T
Sbjct  98   ACNI-DGKISDCPSILKLPPNSPDAKIFKEADSNSTTSPT  136



>gb|ABK22783.1| unknown [Picea sitchensis]
Length=182

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C SY  GT  +PS  CC ++ ++ +T P CLC +++     DS+  +LG  I +   L L
Sbjct  43   CFSYVQGTDKSPSTDCCANLKNVYQTAPKCLCILVK-----DSTSPALGLSINQTLALGL  97

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            PS CK+ NA+ + CP LLNL   SPDA IF
Sbjct  98   PSACKV-NANISACPALLNLSPNSPDAKIF  126



>ref|XP_009397688.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=199

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 8/115 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL+Y  G A AP+  CCD +S I   +  CLC +I+     D +   LGI  +  L   L
Sbjct  45   CLTYVEGQAKAPTPDCCDGLSKILSKNRTCLCVLIK-----DRNEPGLGITFNATLAMNL  99

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA  542
            P+ C  A+++ + CP+LL+LP  S +A IF     ++  + + G +P GS + PA
Sbjct  100  PTVCH-ASSNISECPELLHLPPHSKEAQIFEQFGKANQGNASSGHAPDGSLATPA  153



>ref|XP_011093401.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=197

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 67/138 (49%), Gaps = 24/138 (17%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  GTA  P+  CC  +  + +T+  CLC VI+  +  D     L I     L LP+
Sbjct  42   CLPYVGGTAKTPTPDCCSGLKQVLKTNKKCLCIVIKDRNDPD---LGLNINVTLALGLPA  98

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF------TNATTS--------------HATSKT  503
             C  A A+ + CP LLNLP  SP+A IF      +  TT+              ++TS  
Sbjct  99   VCN-APANISQCPALLNLPPNSPEAQIFYQLGKNSTGTTAASPVAGGPTANVGPNSTSAP  157

Query  504  PGASPGGSTSQPATAGGG  557
             GAS  GS+SQ  T+G G
Sbjct  158  AGASTAGSSSQRKTSGFG  175



>emb|CBI16491.3| unnamed protein product [Vitis vinifera]
Length=171

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 14/130 (11%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK--L  377
            CL Y  G   +P+  CC  +  + +    CLC +I+     D +  +LG+K +  L   L
Sbjct  27   CLPYVGGEGKSPTLDCCTGLKQVLQKARKCLCILIK-----DRNDPNLGLKINATLAMGL  81

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA------SPGGSTSQP  539
            PS C  A A+ + CP LL LPAGSPDA IF     S A SK+         S  GS+++ 
Sbjct  82   PSACH-APANISACPALLQLPAGSPDAKIFEEYGNSTAASKSTSVASAKANSSSGSSAEM  140

Query  540  ATAGGGLWWV  569
             + GG   WV
Sbjct  141  KSDGGRRRWV  150



>gb|KFK37241.1| hypothetical protein AALP_AA4G232200 [Arabis alpina]
Length=205

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 56/121 (46%), Gaps = 7/121 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  TD  CLC +IQ  +  D     L I     L LP+
Sbjct  46   CLPYVQGQAKSPTPDCCSGLKQVLNTDKKCLCVIIQDRNDPD---LGLQINVSLALALPT  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGSTSQPATAGG  554
             C  A A  T CP LL+L   SP+A +F    N +     +  P  S  G TS   TAG 
Sbjct  103  VCH-ATADVTKCPALLHLDPKSPEAQVFYQLANGSNKTGLASAPTGSATGPTSMSPTAGS  161

Query  555  G  557
            G
Sbjct  162  G  162



>ref|XP_006369482.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66051.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=161

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 61/113 (54%), Gaps = 11/113 (10%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL Y  G A AP+  CC+ +  + + +  CLC +I+     D +   LG+K +    L L
Sbjct  48   CLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIK-----DRNDPELGLKINATLALSL  102

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGS  527
            PS C  A A+ + CP LLNLP  SPDA IF    N++   A+S     SPGG+
Sbjct  103  PSVCH-APANVSQCPALLNLPPNSPDAQIFYQLANSSNHIASSPALSPSPGGN  154



>ref|XP_002283442.1| PREDICTED: protein YLS3-like [Vitis vinifera]
Length=188

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 14/130 (11%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK--L  377
            CL Y  G   +P+  CC  +  + +    CLC +I+     D +  +LG+K +  L   L
Sbjct  44   CLPYVGGEGKSPTLDCCTGLKQVLQKARKCLCILIK-----DRNDPNLGLKINATLAMGL  98

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA------SPGGSTSQP  539
            PS C  A A+ + CP LL LPAGSPDA IF     S A SK+         S  GS+++ 
Sbjct  99   PSACH-APANISACPALLQLPAGSPDAKIFEEYGNSTAASKSTSVASAKANSSSGSSAEM  157

Query  540  ATAGGGLWWV  569
             + GG   WV
Sbjct  158  KSDGGRRRWV  167



>ref|XP_010506351.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=201

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 54/116 (47%), Gaps = 4/116 (3%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L +     L LPS
Sbjct  45   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQVNVSLALALPS  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             C  A A  T CP LL+L   SPDA +F        ++  P  S  G TS   TAG
Sbjct  102  VCH-ATADITKCPALLHLDPNSPDAQVFYQLANKTVSASAPTGSSPGPTSMSPTAG  156



>ref|XP_010518028.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=201

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 54/116 (47%), Gaps = 4/116 (3%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L +     L LPS
Sbjct  45   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQVNVSLALALPS  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             C  A A  T CP LL+L   SPDA +F        ++  P  S  G TS   TAG
Sbjct  102  VCH-ATADITKCPALLHLDPNSPDAQVFYQLANKTVSASAPTGSSPGPTSMSPTAG  156



>ref|XP_010917572.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
 ref|XP_010917573.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
Length=187

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 52/96 (54%), Gaps = 8/96 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CLS+  G A AP+  CC  +  +    P CLC +I+     DS    LGIK +    L+L
Sbjct  44   CLSFVQGNAKAPTPDCCTGLKQVLAKSPKCLCILIK-----DSDDPQLGIKFNVSLALRL  98

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS  485
            PS C  A A+ + CPKLLNLP  S DA IF  A  +
Sbjct  99   PSLCS-APANISECPKLLNLPPNSQDAEIFKQAANT  133



>gb|EPS62245.1| non-specific lipid-transfer protein, partial [Genlisea aurea]
Length=133

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 14/122 (11%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RL  368
            V+ CL Y    A +P+K CC    ++ +  P C+C +I+     D +   LG++ D  R 
Sbjct  16   VITCLPYVSDQAKSPTKDCCSGFQTVLQESPQCICLLIK-----DRNDPGLGLQIDVPRA  70

Query  369  LKLPSECKL-ANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            + LP  CK+  N +  +CP +L+LP  SPDA +F         ++TP  +P      P T
Sbjct  71   MSLPQICKIHTNQTVGDCPAILHLPPNSPDAQVFQQFANVTG-AQTPAHAPS-----PVT  124

Query  546  AG  551
            AG
Sbjct  125  AG  126



>gb|KDP32327.1| hypothetical protein JCGZ_13252 [Jatropha curcas]
Length=200

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+ +CC     +K T P CLC +I++    D SV  L +     L++PS
Sbjct  42   CIPFVSGTAKKPTPECCQDTQKLKSTKPKCLCVLIKE--SSDPSV-GLPVNTTLALQMPS  98

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +A  ++CP +LNLP  SPDA IF  A
Sbjct  99   VCNI-DAKVSDCPTILNLPPDSPDAKIFKEA  128



>ref|XP_008803424.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=187

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CLSY  G A AP+  CC  +  +    P CLC +I+     D    S+       L+LPS
Sbjct  44   CLSYVQGNAKAPTPDCCTGLEQVLVKSPKCLCILIKD---SDDPQLSIKFNVTLALRLPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS  485
             C  A A+ + CPKLLNLP  S DAAIF  A  +
Sbjct  101  LCS-APANISECPKLLNLPPNSKDAAIFKQAANA  133



>ref|XP_010541739.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=187

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ +  GTA  P+ +CC+    +KE  P CLC +I++     S+  SLG  +     L++
Sbjct  43   CIPFVSGTAVKPTAQCCEETKKVKENKPECLCVMIKE-----STDPSLGLPVNTTLALQM  97

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
            P  C + +A  ++CP LLNLP  SP+A IF +A
Sbjct  98   PLACHI-DAKVSDCPSLLNLPENSPEAKIFKDA  129



>ref|XP_002299127.1| hypothetical protein POPTR_0001s04590g [Populus trichocarpa]
 gb|ABK96104.1| unknown [Populus trichocarpa]
 gb|EEE83932.1| hypothetical protein POPTR_0001s04590g [Populus trichocarpa]
Length=189

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 59/117 (50%), Gaps = 8/117 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G A AP+  CC  +  + +    CLC +I+     D     LGIK +  L  KL
Sbjct  46   CLPYVGGDAKAPTIDCCSGLKQVLDKSVKCLCVLIKDRDNPD-----LGIKFNVSLVAKL  100

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            PS C  A  + TNC  +L+LPAGSPDA +F        +   P AS   + S+ +TA
Sbjct  101  PSLCH-APVNVTNCIDILHLPAGSPDAKVFAGFANITGSVAAPVASANSTGSKSSTA  156



>gb|EYU25912.1| hypothetical protein MIMGU_mgv1a017757mg, partial [Erythranthe 
guttata]
Length=189

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+K CCD+ + ++   P CLC +I  +   D S+  L I     L++P+
Sbjct  46   CIPFVSGTAKQPTKDCCDNTNKVRAAKPKCLCVLI--IESTDPSI-GLPINTTLALQMPT  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTS  533
             CK+  A  ++CP LL L A SP+A IF  A+   +T+     SP  S S
Sbjct  103  ACKI-EAKVSDCPSLLKLAADSPNAKIFNVASADSSTAAATTNSPNNSDS  151



>ref|XP_007013274.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY30893.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=199

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+++  GTA  P+ +CC     +K T P CLC +I++    D S+  L +     L++PS
Sbjct  43   CIAFVSGTATKPTLQCCQDTQKVKATKPKCLCVLIKE--STDPSM-GLPVNTTLALQMPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +A  ++CP +LNLP  SPDA IF  A
Sbjct  100  ACSI-DAKVSDCPTILNLPPDSPDAKIFEEA  129



>gb|EEC74584.1| hypothetical protein OsI_10163 [Oryza sativa Indica Group]
Length=177

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 56/115 (49%), Gaps = 22/115 (19%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP+  CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  28   CLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  82

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA  542
            PS C   +A+ ++CP+LL++P  S DAAIF               SPGG    PA
Sbjct  83   PSACGATHANVSHCPQLLHIPPNSKDAAIF---------------SPGGDKGSPA  122



>ref|XP_006295014.1| hypothetical protein CARUB_v10024085mg [Capsella rubella]
 gb|EOA27912.1| hypothetical protein CARUB_v10024085mg [Capsella rubella]
Length=201

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L +     L LPS
Sbjct  45   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQVNVSLALALPS  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG  554
             C  A A  T CP LL+L   SPDA +F N          P + P GS  +P+   G
Sbjct  102  VCH-ATADITKCPALLHLDPNSPDAQVF-NQLGKGLNKTGPASGPAGSAPEPSLTAG  156



>ref|XP_010508309.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=204

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 56/119 (47%), Gaps = 7/119 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L +     L LPS
Sbjct  45   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQVNVSLALALPS  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGSTSQPATAG  551
             C  A A  T CP LL+L   SPDA +F      +    ++  P  S  G TS P TAG
Sbjct  102  VCH-ATADITKCPALLHLDPNSPDAQVFYQLAKGSNKTVSASAPTGSAPGPTSMPPTAG  159



>gb|ABF94168.1| Protease inhibitor/seed storage/LTP family protein, expressed 
[Oryza sativa Japonica Group]
Length=187

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 56/115 (49%), Gaps = 22/115 (19%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP+  CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  38   CLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  92

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA  542
            PS C   +A+ ++CP+LL++P  S DAAIF               SPGG    PA
Sbjct  93   PSACGATHANVSHCPQLLHIPPNSKDAAIF---------------SPGGDKGSPA  132



>ref|XP_003558736.1| PREDICTED: protein YLS3-like [Brachypodium distachyon]
Length=193

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +    P CLC +++   K D ++  + I     L LPS
Sbjct  41   CLQYVQGQARSPAPDCCGGLRQVLGKSPKCLCVLVKD--KDDPNL-GININASLALALPS  97

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPG  521
             C    A+ ++CP+LL+LP  S DAAIF     S    K P A+PG
Sbjct  98   ACGATKANVSHCPELLHLPPNSKDAAIF-----SPGGDKGPAATPG  138



>ref|NP_181958.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 sp|O64864.1|YLS3_ARATH RecName: Full=Protein YLS3; AltName: Full=Protein YELLOW-LEAF-SPECIFIC 
GENE 3; AltName: Full=Xylogen-like protein 9; Short=AtXYLP9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16079.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42777.1| putative non-specific lipid transfer protein nLTP [Arabidopsis 
thaliana]
 gb|AAO63932.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE73265.1| xylogen like protein 9 [Arabidopsis thaliana]
 gb|AEC10404.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=205

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  +D  CLC +IQ+ +  D     L +     L LPS
Sbjct  46   CLPYVQGKAKSPTPDCCSGLKQVINSDMKCLCMIIQERNDPD---LGLQVNVSLALALPS  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS-PGGSTSQP  539
             C  A A  T CP LL+L   SPDA +F     +   ++T  AS P GS S+P
Sbjct  103  VCH-ATADITKCPALLHLDPNSPDAQVFYQ--LAKGLNETVSASAPTGSASEP  152



>ref|XP_008802527.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
 ref|XP_008802528.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=187

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G+A AP+  CC SV  + E    C+C +++   + +  + S  +     L LPS
Sbjct  48   CLTYMQGSARAPTPDCCSSVKQVVEKSFKCVCVLVKD--RNEPELASFKVNVTLALGLPS  105

Query  384  ECKL-ANASTTNCPKLLNLPAGSPDAAIF  467
             C + ANAS  +CP+LLNLP  S DA +F
Sbjct  106  RCHVPANAS--DCPRLLNLPLNSTDAKVF  132



>ref|XP_004241629.2| PREDICTED: protein YLS3-like [Solanum lycopersicum]
Length=183

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ Y  GTA  P+ +CC+    +K   P CLC +I++     S+  SLG  I     L++
Sbjct  37   CIPYVSGTAKMPTPECCEDTQKLKAAKPKCLCVLIKE-----STDPSLGLPINTTLALQM  91

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            P+ CK+ +A  ++CP LL +PA SPDA IF
Sbjct  92   PAACKI-DAKVSDCPSLLKIPADSPDAKIF  120



>ref|XP_006476107.1| PREDICTED: protein YLS3-like [Citrus sinensis]
 gb|KDO80428.1| hypothetical protein CISIN_1g041699mg [Citrus sinensis]
Length=203

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+ +CC     +K + P CLC +I++    D S+  L I     L++P+
Sbjct  42   CIPFVSGTAKKPTSECCQDTQKLKASKPKCLCVLIKE--STDPSM-GLPINTTLALQMPA  98

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +AS ++CPKLLNL   SPDA IF  A
Sbjct  99   ACNI-DASVSSCPKLLNLAPDSPDAKIFKEA  128



>ref|XP_008242742.1| PREDICTED: protein YLS3-like [Prunus mume]
Length=197

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+ +CC++   +K   P CLC +I++    D S+  L +     L++PS
Sbjct  41   CIPFVSGTAKKPTPECCENTKKVKANKPKCLCVLIKE--STDPSM-GLPVNTTLALQMPS  97

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT  503
             C + +   ++CP +L LP  SPDA IF  A ++  TS T
Sbjct  98   ACNI-DGKISDCPSILKLPPNSPDAKIFKEADSNSTTSPT  136



>ref|XP_006365420.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Solanum tuberosum]
Length=261

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ Y  GTA  P+ +CC+    +K   P CLC +I++     S+  SLG  I     L++
Sbjct  118  CIPYVSGTAKMPTPECCEDTQKLKAAKPKCLCVLIKE-----STDPSLGLPINTTLALQM  172

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            P+ CK+ +A  ++CP LL +PA SPDA IF
Sbjct  173  PAACKI-DAKVSDCPSLLKIPADSPDAKIF  201



>ref|XP_006451053.1| hypothetical protein CICLE_v10010697mg [Citrus clementina]
 gb|ESR64293.1| hypothetical protein CICLE_v10010697mg [Citrus clementina]
Length=203

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GTA  P+ +CC     +K + P CLC +I++    D S+  L I     L++P+
Sbjct  42   CIPFVSGTAKKPTSECCQDTQKLKASKPNCLCVLIKE--STDPSM-GLPINTTLALQMPA  98

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +AS ++CPKLLNL   SPDA IF  A
Sbjct  99   ACNI-DASVSSCPKLLNLAPDSPDAKIFKEA  128



>ref|XP_009602101.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=184

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ Y  GTA  P+ +CC+    ++   P CLC +I++     S+  SLG  I     L++
Sbjct  39   CIPYVSGTAKKPTAECCEDTQKVRAAKPKCLCVLIKE-----STDPSLGLPINTTLALQM  93

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
            PS C + +A  ++CP +L LPA SPDA IF  A
Sbjct  94   PSACNI-DAKVSDCPSILKLPADSPDAKIFKIA  125



>ref|XP_002515567.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF47016.1| lipid binding protein, putative [Ricinus communis]
Length=188

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            C+ Y  GTA  P+ +CC     +K + P CLC +I++     S+  S+G+  +  L L  
Sbjct  42   CIPYVSGTAKNPTPQCCQDTQKVKASKPKCLCVLIKE-----STDPSMGLPVNTTLALHM  96

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            PS C + +A  ++CP +LNLP  SPDA IF
Sbjct  97   PSACNI-DAEVSDCPSILNLPPDSPDAKIF  125



>ref|XP_010934252.1| PREDICTED: protein YLS3 [Elaeis guineensis]
Length=204

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 64/128 (50%), Gaps = 11/128 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL+Y    A AP+  CC  +  +      CLC +I+     D    SLG+K +    + L
Sbjct  62   CLTYVENRASAPTPDCCSGLKQVLAKSRKCLCVLIK-----DRDNPSLGVKINVTTAMAL  116

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF-TNATTSHATSKTPGAS--PGGSTSQPATA  548
            P+ C  A+A+ + CPKLLNLP  S DA IF  +  T+ AT+ T   S    G++ Q    
Sbjct  117  PTVCH-ASANISECPKLLNLPPNSKDAQIFEQHGNTTQATANTGATSSVASGASVQGNYH  175

Query  549  GGGLWWVV  572
            GG  W  V
Sbjct  176  GGKKWLGV  183



>ref|XP_009781023.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=184

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ Y  GTA  P+ +CC+    ++   P CLC +I++     S+  SLG  I     L++
Sbjct  39   CIPYVSGTAKKPTPECCEDTQKVRAAKPKCLCVLIKE-----STDPSLGLPINTTLALQM  93

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
            PS C + +A  ++CP +L LPA SPDA IF  A
Sbjct  94   PSACNI-DAKVSDCPSILKLPADSPDAKIFKIA  125



>ref|XP_002281585.1| PREDICTED: protein YLS3 [Vitis vinifera]
Length=194

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ +  GTA  P+++CC     +K + P CLC +I++     S+  SLG  +     L++
Sbjct  42   CIPFVSGTAKKPTQQCCQDTQKVKSSKPKCLCVLIKE-----STDPSLGLPVNTTLALQM  96

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
            PS C + +A  ++CP LL+LP  S DA IF  A +S  +S
Sbjct  97   PSACNI-DAKVSDCPTLLSLPPDSADAKIFKEADSSAESS  135



>gb|EEE58386.1| hypothetical protein OsJ_09548 [Oryza sativa Japonica Group]
Length=177

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 55/115 (48%), Gaps = 22/115 (19%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP+  CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  28   CLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  82

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA  542
            P  C   +A+ ++CP+LL++P  S DAAIF               SPGG    PA
Sbjct  83   PCACGATHANVSHCPQLLHIPPNSKDAAIF---------------SPGGDKGSPA  122



>ref|XP_002881958.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58217.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 57/115 (50%), Gaps = 7/115 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L I     L LPS
Sbjct  46   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQINVSLALALPS  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTSQPAT  545
             C  A A  T CP LL+L   SPDA +F   A  S+ TS  P ++P G  S P +
Sbjct  103  VCH-ATADVTKCPALLHLDPNSPDAQVFYQLAKGSNKTS--PASAPTGLASGPTS  154



>gb|EYU39237.1| hypothetical protein MIMGU_mgv1a014178mg [Erythranthe guttata]
Length=198

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 8/110 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP   CC  +  I +  P C+C +++   + D ++  L I     L LPS
Sbjct  42   CLPYVSGEAKAPPVDCCTGLKQILQKSPQCICLLVKD--RNDPTL-GLQINATLALGLPS  98

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN----ATTSHATSKTPGASPG  521
            +C  A A+ + CP LL+LP  SPDA +F +    A  S+ATS +    PG
Sbjct  99   QCH-APANISACPALLHLPPNSPDAKVFEDFVNSANKSNATSTSIAPVPG  147



>ref|XP_009418410.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=210

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 10/127 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+++  GTA+AP+  CC  + ++    P CLC +++     D     + I   R L LP+
Sbjct  64   CITFVQGTAEAPTPDCCAGLKTVLANRPKCLCILVKM---HDDPQLPIKINVTRALALPT  120

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF------TNATTSHATSKTPGASPGGSTSQPAT  545
             C  A A+ + CP++L LP  S +A IF      T A  +   + T G SP  S+   + 
Sbjct  121  ACS-ARANISKCPQILKLPPNSKEAEIFKQSGSPTQAKGNSTINTTTGTSPRASSETSSG  179

Query  546  AGGGLWW  566
                L W
Sbjct  180  RSDYLEW  186



>ref|XP_008461230.1| PREDICTED: protein YLS3-like [Cucumis melo]
Length=192

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 7/121 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A  P+  CC  +  + + +  CLC +++  +  D     L I     L LP 
Sbjct  47   CLPYVSGDAKTPTPDCCSGLKEVLKNNKKCLCVIVKDRNDPD---LGLQINVTLALGLPD  103

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN---ATTSHATSKTPGASPGGSTSQPATAGG  554
             C  A A+ +NCP LLNLP+ S +A +F       +S A +  P  SP    +  +T GG
Sbjct  104  ICH-ATANVSNCPALLNLPSNSSEAQVFYQLGKGKSSSALAPAPIISPSSPATISSTVGG  162

Query  555  G  557
            G
Sbjct  163  G  163



>ref|XP_007205970.1| hypothetical protein PRUPE_ppa012060mg [Prunus persica]
 gb|EMJ07169.1| hypothetical protein PRUPE_ppa012060mg [Prunus persica]
Length=185

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 59/117 (50%), Gaps = 8/117 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL Y  G A AP+  CC  +  +++    CLC +I+     D +  +LG+K +    L+L
Sbjct  45   CLPYVGGDAKAPTLDCCTGIKEVEQKSKKCLCVLIK-----DRNDPNLGLKINATLALQL  99

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            P+ C +   + + C  LLNLP+ SPDA +F       A S T   + G STS    A
Sbjct  100  PTSCHVP-VNISRCVDLLNLPSNSPDAKMFREYANKTAASSTVPIASGNSTSNGTVA  155



>ref|XP_008225280.1| PREDICTED: protein YLS3-like [Prunus mume]
Length=185

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 54/115 (47%), Gaps = 4/115 (3%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  +++    CLC +I+     D     L I     L+LP+
Sbjct  45   CLPYVGGDAKAPTLDCCTGIKEVEQKSKKCLCVLIKD---HDDPNLGLKINATLALQLPT  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
             C +   + + C  LLNLP+ SPDA +F       A S T   + G STS    A
Sbjct  102  SCHVP-VNISRCVDLLNLPSNSPDAKMFREYANKTAASSTVPIASGNSTSNGTVA  155



>emb|CDP07663.1| unnamed protein product [Coffea canephora]
Length=191

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 58/117 (50%), Gaps = 6/117 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A  P+  CC  +  + +T+  CLC VI+  +  D     L I     L LPS
Sbjct  44   CLPYVGGNAKFPTPDCCSGLKEVLKTNKKCLCLVIKDRNDPD---LGLSINVTLALGLPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG  554
             C  A A+ + CP LL+L   SPDA +F      HA+S   G+   G T+  A++ G
Sbjct  101  VCN-APANISECPALLHLDPNSPDAQVFYQ--NGHASSSIAGSPVSGPTATAASSPG  154



>ref|XP_006397607.1| hypothetical protein EUTSA_v10001638mg [Eutrema salsugineum]
 gb|ESQ39060.1| hypothetical protein EUTSA_v10001638mg [Eutrema salsugineum]
Length=200

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  +D  CLC +IQ  +  D     L I     L LPS
Sbjct  44   CLPYVQGQAKSPTPDCCSGLKQVINSDKKCLCVIIQDRNDPD---LGLQINVSLALALPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS-PGGSTSQP  539
             C +  A  T CP LL+L   SPDA +F     ++  +KT  AS P GS  +P
Sbjct  101  VCHV-TADVTKCPALLHLDPNSPDAQVFYQ--LANGLNKTGLASAPTGSAPEP  150



>ref|XP_006439006.1| hypothetical protein CICLE_v10033694mg [Citrus clementina]
 gb|ESR52246.1| hypothetical protein CICLE_v10033694mg [Citrus clementina]
Length=205

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 61/123 (50%), Gaps = 12/123 (10%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + D  CLC +I+ ++  +     L I     L LPS
Sbjct  46   CLPYVGGDAKAPTPDCCSGLKQVLKNDKKCLCVIIRDMNDPE---LGLNINVTLTLGLPS  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF----TNATTSH-ATSKTPGASP---GGSTSQP  539
             C  A A+ + CP LL+L   SP+A +F     N ++ H A + TP  SP   GG    P
Sbjct  103  VCH-ATANVSQCPALLHLDPNSPEAQVFYQFGRNPSSPHTAITSTPAPSPTAAGGGGKNP  161

Query  540  ATA  548
             +A
Sbjct  162  ISA  164



>emb|CBI28121.3| unnamed protein product [Vitis vinifera]
Length=260

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKL  377
            C+ +  GTA  P+++CC     +K + P CLC +I++     S+  SLG  +     L++
Sbjct  82   CIPFVSGTAKKPTQQCCQDTQKVKSSKPKCLCVLIKE-----STDPSLGLPVNTTLALQM  136

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
            PS C + +A  ++CP LL+LP  S DA IF  A +S  +S
Sbjct  137  PSACNI-DAKVSDCPTLLSLPPDSADAKIFKEADSSAESS  175



>ref|XP_002468449.1| hypothetical protein SORBIDRAFT_01g046080 [Sorghum bicolor]
 gb|EER95447.1| hypothetical protein SORBIDRAFT_01g046080 [Sorghum bicolor]
Length=195

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 64/124 (52%), Gaps = 10/124 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP   CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  45   CLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  99

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFT---NATTSHATSKTPGASPGGSTSQPATA  548
            P+ C    A+ ++C +LL++P GS DAA+F+   +  ++ A +K    +   S +  AT 
Sbjct  100  PNACGATRANVSHCAQLLHIPPGSKDAAVFSPGGDKGSTAAPAKDNSTATTDSRALQATN  159

Query  549  GGGL  560
            GGG+
Sbjct  160  GGGV  163



>ref|XP_006359139.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Solanum tuberosum]
Length=193

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 18/139 (13%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + +    CLC +I+  +  D     L +     L LPS
Sbjct  43   CLPYVGGNAPAPTPDCCTGLKQVLKASKKCLCLLIKDRNDPD---LGLQLNVTLALTLPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNAT----------TSHATSKTPGASPGGS-T  530
             CK A A+ + CP LL+LPA SP+A +F              ++H+   + G+SP G+  
Sbjct  100  VCK-APANISECPALLHLPANSPEAQVFYQIANNSSSIAGSPSAHSPIPSVGSSPTGAPA  158

Query  531  SQPATAG---GGLWWVVQA  578
              P +AG   G  W+ ++A
Sbjct  159  GAPKSAGCHIGKRWFGLEA  177



>ref|XP_009409233.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=196

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 61/145 (42%), Gaps = 29/145 (20%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G+A AP+  CC     +      CLC +I+     D+      I   R L LPS
Sbjct  44   CLTYIGGSAKAPTVDCCSGFKQVVTKSLKCLCVLIRNR---DNPNLGFKINVTRALLLPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFT---------------NATTSHAT-SKTPGAS  515
            +C    A  T CP+LLNLP  S +A +F                N+TTS AT  KT    
Sbjct  101  KCDTP-AQVTECPRLLNLPQNSAEAKVFEEFGEELKAYAASSYGNSTTSMATGGKTSDQK  159

Query  516  PGGSTSQPATA---------GGGLW  563
              GS S+   A          GG W
Sbjct  160  GNGSLSKSGEANKRRLGMSMNGGFW  184



>ref|XP_008775497.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=195

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 63/130 (48%), Gaps = 14/130 (11%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL+Y    A  P+  CC  +  +  T+  CLC +I+     D     LGIK +    + L
Sbjct  49   CLTYVENRALTPTPDCCSGLKQVLATNRKCLCVLIK-----DRDEPGLGIKLNVTTAMAL  103

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTN------ATTSHATSKTPGASPGGSTSQP  539
            PS C+ A+++ + CPKLLNLP GS +A IF        A  + A +    ++  GS S  
Sbjct  104  PSVCR-ASSNISECPKLLNLPPGSAEAQIFEQYGRSPPAADTKANAGASTSNEAGSASAQ  162

Query  540  ATAGGGLWWV  569
                GG  W+
Sbjct  163  GNCHGGKKWL  172



>ref|XP_010228246.1| PREDICTED: protein YLS3-like isoform X1 [Brachypodium distachyon]
Length=199

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL++  G A AP+  CC  + ++ ++   CLC +++     D     L I   R L LP+
Sbjct  43   CLTFVQGQAPAPTPDCCAGLKTVLQSSRKCLCVLVKD---RDDPGLGLKINVTRALGLPA  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTP  506
             C  A A+ ++CP+LLNLP  S DA +F +     A   +P
Sbjct  100  ACS-AAANISDCPRLLNLPPNSKDAQVFEDFAKQQAAQGSP  139



>ref|XP_009394719.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=192

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 56/117 (48%), Gaps = 7/117 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ Y  GTA AP+  CC  +  +    P CLC +++     D     + I   R L LP 
Sbjct  50   CIPYVEGTAQAPTPDCCTGLKDVVAKSPKCLCILVKD---HDDPQLPIKINLTRALALPK  106

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG  554
             C     + + CPKLLNLP  S +A IF  A ++   + T   SP    S PA+ GG
Sbjct  107  ACN-TPVNISACPKLLNLPPNSKEAEIFKQAGSAAQANATATTSP---PSTPASDGG  159



>ref|XP_009770685.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=192

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (50%), Gaps = 14/125 (11%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y    A AP+  CC  +  + +    CLC +I+  +  D     L +     L LPS
Sbjct  38   CLPYVTANAPAPTPDCCTGLKQVLKASKKCLCLLIKDRNDPD---LGLNLNVTLALSLPS  94

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN--------ATTSHATSKTP--GASPGGSTS  533
             C+ A A+ + CP LL+LP  SPDA +F          A++  A S TP  G+SP G+ +
Sbjct  95   VCQ-APANISQCPALLHLPPNSPDAQVFYQIGNGSSSIASSPQANSPTPSVGSSPTGTPA  153

Query  534  QPATA  548
              A+A
Sbjct  154  GAASA  158



>ref|NP_181959.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAC16080.1| unknown protein [Arabidopsis thaliana]
 gb|AAP12845.1| At2g44300 [Arabidopsis thaliana]
 dbj|BAE73266.1| xylogen like protein 10 [Arabidopsis thaliana]
 gb|AEC10405.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=204

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L I     L LPS
Sbjct  45   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQINVSLALALPS  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT-PGASPGGSTSQP  539
             C  A A  T CP LL+L   SPDA +F     +   +KT P ++P GS+  P
Sbjct  102  VCHAA-ADVTKCPALLHLDPNSPDAQVFYQ--LAKGLNKTGPASAPTGSSPGP  151



>ref|XP_011025176.1| PREDICTED: protein YLS3 [Populus euphratica]
Length=190

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 59/119 (50%), Gaps = 10/119 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G A AP+  CC  +  + +    CLC +I+     D    +LG+K +  L  KL
Sbjct  46   CLPYVSGDAKAPTLDCCSGLKQVLDKSKKCLCVLIK-----DRDNPNLGVKFNVSLVAKL  100

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNA--TTSHATSKTPGASPGGSTSQPATA  548
            PS C  +  + T C  LL+LPA SPDA  F      T  A+  TP  S   + S P++A
Sbjct  101  PSLCH-SPVNVTECIDLLHLPANSPDAKFFEGFANITQSASIDTPAGSGSSTGSNPSSA  158



>ref|XP_002459511.1| hypothetical protein SORBIDRAFT_02g005900 [Sorghum bicolor]
 gb|EER96032.1| hypothetical protein SORBIDRAFT_02g005900 [Sorghum bicolor]
Length=210

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 12/119 (10%)
 Frame = +3

Query  204  CLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLL  371
            CL+Y     TA AP+  CC  + ++ ++   CLC +++     D    +LG+K +  + L
Sbjct  48   CLTYVQEDATAAAPTPDCCAGLETVLQSSRKCLCVLVK-----DRDDPNLGLKINVTKAL  102

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            +LP+ C  A A+ ++CP+LLNLP GS DA +F       A   T  A  GG ++  A+A
Sbjct  103  RLPAVCN-APANISDCPRLLNLPPGSKDAQVFEQFARQAAAQGT--APSGGGSAAKASA  158



>gb|ACR37836.1| unknown [Zea mays]
 tpg|DAA43565.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=192

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP   CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  43   CLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  97

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFT  470
            P+ C    A+ ++C +LL++P GS DAA+F+
Sbjct  98   PNACGATRANVSHCAQLLHIPPGSKDAAVFS  128



>emb|CDP03376.1| unnamed protein product [Coffea canephora]
Length=202

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ Y  G    P+ +CC+    +K   P CLC +I++    D S+  L I     LK+PS
Sbjct  43   CIPYVSGDEKIPTPECCEDTKKVKSAKPKCLCVLIKE--STDPSM-GLPINTTLALKMPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNAT  479
             CK+ +A  ++CP +LNL   SPDA IF  A+
Sbjct  100  ACKI-DAKVSDCPSILNLAPDSPDAKIFEAAS  130



>ref|XP_002881957.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58216.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 5/114 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  +D  CLC +IQ  +  D     L +     L LPS
Sbjct  46   CLPYVQGQAKSPTPDCCSGLKQVLNSDMKCLCVIIQDRNDPD---LGLQVNVSLALGLPS  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
             C  A A  T CP LL+L   SP+A +F            P ++P GS  +P +
Sbjct  103  VCH-ATADITKCPALLHLDPKSPEAHVFYQLAKG-LNETGPASAPTGSAPEPTS  154



>gb|ACG31262.1| lipid transfer protein [Zea mays]
Length=192

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP   CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  43   CLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  97

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFT  470
            P+ C    A+ ++C +LL++P GS DAA+F+
Sbjct  98   PNACGATRANVSHCAQLLHIPPGSKDAAVFS  128



>emb|CBI16494.3| unnamed protein product [Vitis vinifera]
Length=174

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 9/107 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G   AP+  CC  +  + +    CLC +I+     D    +LG K +  L   L
Sbjct  28   CLPYVQGEGKAPTLDCCTGLKQVLQKSKKCLCVLIK-----DRDDPNLGFKINTTLALSL  82

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSK-TPGAS  515
            P+ C    A+ + CP LL LP GSPDA IF  +  S  T+K TP AS
Sbjct  83   PTACN-TPANMSECPALLQLPPGSPDAKIFEESGNSTVTTKSTPVAS  128



>ref|XP_011010692.1| PREDICTED: protein YLS3-like [Populus euphratica]
Length=190

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 58/123 (47%), Gaps = 11/123 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G A AP+  CC  +  + +    CLC +I+     D     LGIK +  L  KL
Sbjct  46   CLPYVGGDAKAPTIDCCSGLKQVLDKSVKCLCVLIKDRDNPD-----LGIKFNVSLVAKL  100

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAI---FTNATTSHATSKTPGASPGGSTSQPATA  548
            PS C  A  + T C  +L+LPAGSPDA +   F N T     +    A+  GS S  A  
Sbjct  101  PSLCH-APVNVTKCIDILHLPAGSPDAKVFAGFANITGGSVAAPVASANSTGSKSSAAAE  159

Query  549  GGG  557
              G
Sbjct  160  KSG  162



>gb|ACG45950.1| lipid transfer protein [Zea mays]
Length=192

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP   CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  43   CLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  97

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
            P+ C    A+ ++C +LL++P GS DAA+F+  +   +T+
Sbjct  98   PNACGATRANVSHCAQLLHIPPGSKDAAVFSPGSDKGSTA  137



>gb|ACG37967.1| lipid transfer protein [Zea mays]
Length=192

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL--  377
            CL Y  G A AP   CC  +  +    P CLC +++     D    +LGIK +  L L  
Sbjct  43   CLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVK-----DKDDPNLGIKINATLALAL  97

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS  497
            P+ C    A+ ++C +LL++P GS DAA+F+  +   +T+
Sbjct  98   PNACGATRANVSHCAQLLHIPPGSKDAAVFSPGSDKGSTA  137



>ref|XP_004229337.1| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=194

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (50%), Gaps = 15/127 (12%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + +    CLC +I+  +  D     L +     L LPS
Sbjct  43   CLPYVGGNAPAPTPDCCTGLKQVLKDSKKCLCLLIKDRNDPD---LGLQLNVTLALTLPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTP---------GASPGGS-T  530
             CK A A+ + CP LL+LPA SPDA +F   A  S + + +P         G+SP G+  
Sbjct  100  VCK-APANISECPALLHLPANSPDAQVFYQIANNSSSIAGSPLAHSPIPSVGSSPTGAPA  158

Query  531  SQPATAG  551
              P +AG
Sbjct  159  GAPKSAG  165



>ref|XP_002285691.1| PREDICTED: protein YLS3-like [Vitis vinifera]
Length=190

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 9/107 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G   AP+  CC  +  + +    CLC +I+     D    +LG K +  L   L
Sbjct  44   CLPYVQGEGKAPTLDCCTGLKQVLQKSKKCLCVLIK-----DRDDPNLGFKINTTLALSL  98

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSK-TPGAS  515
            P+ C    A+ + CP LL LP GSPDA IF  +  S  T+K TP AS
Sbjct  99   PTACN-TPANMSECPALLQLPPGSPDAKIFEESGNSTVTTKSTPVAS  144



>ref|XP_008337357.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=199

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GT+  P  +CC++   +K   P CLC +I++    D S+  L +    +L++PS
Sbjct  41   CIPFVSGTSKKPMPECCENTKKLKANKPKCLCVLIKE--STDPSM-GLPVNTTLVLQMPS  97

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +   ++CP +LNLP  SPDA  F  A
Sbjct  98   ACDI-DGKISDCPSILNLPPNSPDAKFFKEA  127



>ref|XP_009374052.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=198

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ +  GT+  P+ +CC++   +K   P CLC +I++    D S+  L +     L++PS
Sbjct  41   CIPFVSGTSKKPTPECCENTKKLKANKPKCLCVLIKE--STDPSM-GLPVNTTLALQMPS  97

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA  476
             C + +   ++CP +LNLP  SPDA  F  A
Sbjct  98   ACDI-DGKISDCPSILNLPPNSPDAKFFKEA  127



>ref|XP_002968703.1| hypothetical protein SELMODRAFT_38281, partial [Selaginella moellendorffii]
 ref|XP_002989953.1| hypothetical protein SELMODRAFT_28175, partial [Selaginella moellendorffii]
 gb|EFJ08966.1| hypothetical protein SELMODRAFT_28175, partial [Selaginella moellendorffii]
 gb|EFJ29819.1| hypothetical protein SELMODRAFT_38281, partial [Selaginella moellendorffii]
Length=104

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 6/84 (7%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RL  368
            V  CL Y  G    PS  CC  +SS+  T PVCLC    Q+ +G  ++++LG+  D  R 
Sbjct  25   VAPCLDYVQGNGKTPSSDCCKGLSSLVTTSPVCLC----QLSEGKLNLSALGVTVDMKRA  80

Query  369  LKLPSECKLANASTTNCPKLLNLP  440
            L LP+ CK+  A  + C   L++P
Sbjct  81   LSLPTVCKIKGADRSRCAGKLSIP  104



>ref|XP_002877294.1| lipid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53553.1| lipid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=196

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 62/122 (51%), Gaps = 15/122 (12%)
 Frame = +3

Query  204  CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R  365
            CLSY      G A  P K CC +++ + E+ P CLCY++     GD + T LGIK D  +
Sbjct  48   CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLS----GDMAAT-LGIKIDKAK  102

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA---SPGGSTSQ  536
             LKLP  C +     + C  L  +P G+P A     A+ ++A     GA   SPGG  S 
Sbjct  103  ALKLPGVCGVLTPDPSLC-SLFGIPVGAPVAMGNEGASPAYAPGSMSGAESPSPGGFGSG  161

Query  537  PA  542
            P+
Sbjct  162  PS  163



>ref|XP_006397606.1| hypothetical protein EUTSA_v10001634mg [Eutrema salsugineum]
 gb|ESQ39059.1| hypothetical protein EUTSA_v10001634mg [Eutrema salsugineum]
Length=208

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 55/113 (49%), Gaps = 7/113 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y    A +P+  CC  +  +  +D  CLC +IQ  +  D     L I     L LPS
Sbjct  44   CLPYVQEQAKSPTPDCCSGLKQVINSDKKCLCVIIQDRNDPD---LGLKINVSLALALPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT-PGASPGGSTSQP  539
             C +  A  T CP LL+L   SPDA  F     ++ ++KT P ++P G   +P
Sbjct  101  VCHV-TADVTKCPALLHLDPNSPDAQFFYQ--LANGSNKTGPASAPTGLAPEP  150



>ref|XP_001753173.1| predicted protein [Physcomitrella patens]
 gb|EDQ82214.1| predicted protein [Physcomitrella patens]
Length=160

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 3/119 (3%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  ++  C  Y       P+  CC ++S +    PVCLC ++++V+ GD +   L + + 
Sbjct  8    EFSELSSCFEYVASNVTKPTAACCSTLSEVHLNRPVCLCQILKEVNSGDPATAGLNVTKG  67

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQP  539
              L+LP+ CK+ +A+  +CP LL  P  SP  +  +  +T+  TS     SP  S + P
Sbjct  68   --LELPAACKV-DANVNSCPALLGEPISSPSPSAESPKSTADTTSGQKAGSPADSVATP  123



>ref|XP_004241377.1| PREDICTED: xylogen-like protein 11 [Solanum lycopersicum]
Length=185

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 16/117 (14%)
 Frame = +3

Query  201  DCLSYAIGTADA--PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCL++    ++   P K CC  ++ + +++P+CLC+++ + H G  +     I  D+ LK
Sbjct  54   DCLAFVERGSNTTTPGKGCCPEIAGLLDSNPICLCHMLGRAHSG--AKIGFNIDVDKALK  111

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            LPS C L    +T C   L +P G+P             + ++P  SPGG  + P +
Sbjct  112  LPSACSLEFPPSTTCSD-LGIPVGAP-----------LPSEESPAPSPGGFATSPTS  156



>gb|AAM66942.1| lipid-transfer protein-like protein [Arabidopsis thaliana]
Length=193

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (51%), Gaps = 13/124 (10%)
 Frame = +3

Query  204  CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R  365
            CLSY      G A  P K CC +++ + E+ P CLCY++     GD +   LGIK D  +
Sbjct  48   CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLS----GDMA-AQLGIKIDKAK  102

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA-SPGGSTSQPA  542
             LKLP  C +     + C  L  +P G+P A     A+ ++A     GA SPGG  S P+
Sbjct  103  ALKLPGVCGVITPDPSLC-SLFGIPVGAPVAMGDEGASPAYAPGSMSGAESPGGFGSGPS  161

Query  543  TAGG  554
             + G
Sbjct  162  ASRG  165



>ref|NP_189958.1| non-specific lipid transfer protein GPI-anchored 2 [Arabidopsis 
thaliana]
 sp|Q9LZH5.1|LTPG2_ARATH RecName: Full=Non-specific lipid transfer protein GPI-anchored 
2; Short=AtLTPG-2; Short=Protein LTP-GPI-ANCHORED 2; AltName: 
Full=Xylogen-like protein 5; Short=AtXYP5; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB83144.1| lipid-transfer-like protein [Arabidopsis thaliana]
 gb|AAK76582.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAL85151.1| putative lipid-transfer protein [Arabidopsis thaliana]
 dbj|BAE73261.1| xylogen like protein 5 [Arabidopsis thaliana]
 gb|AEE77821.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=193

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (51%), Gaps = 13/124 (10%)
 Frame = +3

Query  204  CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R  365
            CLSY      G A  P K CC +++ + E+ P CLCY++     GD +   LGIK D  +
Sbjct  48   CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLS----GDMA-AQLGIKIDKAK  102

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA-SPGGSTSQPA  542
             LKLP  C +     + C  L  +P G+P A     A+ ++A     GA SPGG  S P+
Sbjct  103  ALKLPGVCGVITPDPSLC-SLFGIPVGAPVAMGDEGASPAYAPGSMSGAESPGGFGSGPS  161

Query  543  TAGG  554
             + G
Sbjct  162  ASRG  165



>ref|XP_001774074.1| predicted protein [Physcomitrella patens]
 gb|EDQ61126.1| predicted protein [Physcomitrella patens]
Length=541

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +3

Query  183  ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED  362
            E  ++  C +Y       PS  CC S+  +    PVCLC ++ +V+ GD S    GI   
Sbjct  391  EFNELASCFAYVTSNDTKPSTDCCSSLLQVHLNRPVCLCQILNEVNSGDPSTA--GINVT  448

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSP  452
            + L LP+ C + NA   +CP LL  P  SP
Sbjct  449  KGLGLPAACNV-NADVNSCPALLGQPMSSP  477



>ref|XP_006658373.1| PREDICTED: protein YLS3-like [Oryza brachyantha]
Length=203

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 55/106 (52%), Gaps = 5/106 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL++    A AP+  CC  + ++ +    CLC +I+     D    +L I   + L LPS
Sbjct  40   CLTFVQDEAAAPTPDCCAGLRTVLQASRKCLCVLIKD---RDDPNLNLKINVTKALSLPS  96

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSK-TPGASP  518
             C  A A+ ++CP+LLNLP  S +A +F       A  + +P ASP
Sbjct  97   LCN-APANISDCPRLLNLPPNSTEAQVFLQFAKQQAAMQGSPSASP  141



>ref|XP_011088858.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=202

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  GTA AP+  CC ++  +  T   CLC +I+  +  D     L I     L LP 
Sbjct  46   CLPYVGGTAKAPTPDCCTALKQLLNTKKKCLCVIIKDRNDPD---LGLNINVTLALGLPQ  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF  467
             C  A A+ + CP LL LP  SP+A IF
Sbjct  103  VCN-APANVSQCPALLKLPPDSPEAQIF  129



>ref|XP_011089694.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=193

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 10/117 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL Y  G +  P   CC     + +    CLC +++     D +  SLG K +    L L
Sbjct  44   CLPYVSGESKFPPMDCCTGFKEVLQKSKECLCLLVK-----DRNDPSLGFKINATLALSL  98

Query  378  PSECKL-ANASTTNCPKLLNLPAGSPDAAIFTNATTS--HATSKTPGASPGGSTSQP  539
            PS+C    N S T+CP +L+LP  SPDA +F +   S   + +  P A+   ST  P
Sbjct  99   PSKCNAPVNQSITDCPAVLHLPPNSPDAKVFEDFANSGKKSNATAPPAAENSSTEMP  155



>gb|KHG04910.1| hypothetical protein F383_07676 [Gossypium arboreum]
Length=208

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 60/114 (53%), Gaps = 7/114 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + +  CLC +I+  +  D     L I     L LPS
Sbjct  53   CLPYVGGNAKAPTPDCCSGLKQVLKNNKKCLCIIIKDRNDPD---LGLNINVTLALSLPS  109

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGSTSQ  536
             C  A A+ + CP+LL++   SP+A +F   + +++S+   ++P ++P  S  +
Sbjct  110  VCN-APANISKCPELLHMDPNSPEAQVFYQLSKSSSSNGGHQSPASAPTASVGE  162



>ref|XP_008451078.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2 
isoform X1 [Cucumis melo]
Length=176

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 56/110 (51%), Gaps = 13/110 (12%)
 Frame = +3

Query  201  DCLSYAI-GTADA-PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCLSY   G+ D  P+K+CC  ++ + E+ P CLC ++    K       L I  DR +K
Sbjct  44   DCLSYVTAGSNDTKPNKQCCSELAGLVESSPKCLCELLSDPDK-----VGLTIDVDRAMK  98

Query  375  LPSECKLANASTTNCPKLLNLPAG-----SPDAAIFTNATTSHATSKTPG  509
            LPS+C+++    + C  LL  P G     SPD  +        +T+ TPG
Sbjct  99   LPSQCRISTPPISLC-SLLGFPVGSSPAPSPDLGVQPPDAGGSSTTDTPG  147



>ref|XP_009364110.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=193

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 13/127 (10%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ Y  G A  P+  CC  +  + +    CLC +I+     D     L I     L LPS
Sbjct  46   CIPYVGGDAKTPTLDCCSGIKEVVQKSKKCLCILIKD---RDDPKLGLKINSTLALNLPS  102

Query  384  ECKL-ANASTTNCPKLLNLPAGSPDAAIFT---NATTSHATSKTP----GASPGGSTSQP  539
             C +  N ST  C  LLNLP+ SPDA +F    N T + + S  P     ++  G+ +Q 
Sbjct  103  SCHVPVNIST--CIDLLNLPSNSPDAKMFRDFENQTEARSNSTAPLSSVNSTSSGTVAQA  160

Query  540  ATAGGGL  560
             + GG L
Sbjct  161  KSDGGRL  167



>ref|XP_010915020.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
Length=189

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ YA G+A  P+ +CC     ++ + P CLC +I  V   D S+ +L I     L +P+
Sbjct  43   CVPYASGSAPKPTPECCADAEKLRASQPKCLCVLI--VESTDPSL-ALPINTTLALHMPA  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN----------ATTSHATSKTPGASPG--GS  527
             C  ++A  +NCP +L L   SP+A IF +          A++S  +S    AS G  GS
Sbjct  100  ACN-SDAKVSNCPSILKLNPSSPEAKIFRDATASTSPSSAASSSSGSSDAGPASSGESGS  158

Query  528  TSQPATAGGGLWWVVQA  578
             + P   GGGL   V A
Sbjct  159  KTAPTNGGGGLESFVGA  175



>ref|XP_010544520.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=199

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 4/88 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G A AP+  CC  +  + +T+  CLC +I+  +  D     L I     L LPS
Sbjct  43   CLTYVQGQAKAPTPDCCSGLRQVLKTNKKCLCELIRDRNDPD---LGLQINVSLALGLPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF  467
             C  A A  T CP LL+L   SP+A +F
Sbjct  100  VCH-AAADVTKCPSLLHLDPNSPEAQVF  126



>gb|EEE66751.1| hypothetical protein OsJ_23458 [Oryza sativa Japonica Group]
Length=198

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 13/117 (11%)
 Frame = +3

Query  204  CLSY----AIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R  365
            CL++    A G A AP+  CC  + ++      CLC +I+     D    +LG+K +  +
Sbjct  29   CLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIK-----DRDDPNLGLKINVTK  83

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTS  533
             L LP  C  A A+ ++CP+LLNLP  S DA IF   A    A   +P ASP G  +
Sbjct  84   ALSLPQLCN-APANISDCPRLLNLPPNSKDAQIFEQFAKQQAAMQGSPSASPVGEQT  139



>ref|NP_001170312.1| putative bifunctional inhibitor/LTP/seed storage protein family 
precursor [Zea mays]
 gb|ACN36566.1| unknown [Zea mays]
 tpg|DAA59932.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=206

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 10/92 (11%)
 Frame = +3

Query  204  CLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIK--EDRLL  371
            CL+Y     TA AP+  CC  + ++ ++   CLC +++     D    +LG+K   D+ L
Sbjct  50   CLTYVQEQATATAPTPDCCAGLKAVLQSSRKCLCVLVK-----DRDDPNLGLKLNVDKAL  104

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIF  467
             LP+ C  A A+ ++CP+LL+LPAGS DA +F
Sbjct  105  GLPAVCH-APANISDCPRLLDLPAGSKDAQVF  135



>gb|KDO46035.1| hypothetical protein CISIN_1g029183mg [Citrus sinensis]
Length=197

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 60/123 (49%), Gaps = 12/123 (10%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + D  CLC +I+   + D  +  L I     L LPS
Sbjct  35   CLPYVGGDAKAPTPDCCSGLKQVLKNDKKCLCVIIRD--RNDPEL-GLNINVTLALGLPS  91

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF----TNATTSH-ATSKTPGASP---GGSTSQP  539
             C  A A+ + CP LL+L   SP+A +F     N ++ H   + TP  SP   GG    P
Sbjct  92   VCH-APANVSQCPALLHLDPNSPEAQVFYQFGRNPSSPHTVITSTPTPSPTAAGGGGKNP  150

Query  540  ATA  548
             +A
Sbjct  151  ISA  153



>ref|NP_001152188.1| lipid binding protein precursor [Zea mays]
 gb|ACG46301.1| lipid binding protein [Zea mays]
Length=206

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = +3

Query  204  CLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIK--EDRLL  371
            CL+Y     TA AP+  CC  + ++ ++   CLC +++     D    +LG+K   D+ L
Sbjct  49   CLTYVQEQATATAPTPDCCAGLKAVLQSSRKCLCVLVK-----DRDDPNLGLKLNVDKAL  103

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN  473
             LP+ C  A A+ ++CP+LL+LPAGS DA +F  
Sbjct  104  GLPAVCH-APANISDCPRLLDLPAGSKDAQVFEQ  136



>ref|XP_006356037.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Solanum tuberosum]
Length=168

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 56/117 (48%), Gaps = 17/117 (15%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G + +PS  CC  + ++ + +P CLC    QV  G  S   L I + + L LP+
Sbjct  40   CLNYITGNSSSPSSGCCTQLGTVVKNNPECLC----QVLNGGGSNMGLNINQTQALALPN  95

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG  554
             CK+   S + C       AGSP        ++   T ++P     GS S P++ GG
Sbjct  96   ACKVQTPSISKC------NAGSP-------TSSPAGTPRSPNTEASGSGSTPSSRGG  139



>ref|XP_004511135.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cicer arietinum]
Length=196

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 58/113 (51%), Gaps = 6/113 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G    P+  CCD + ++  T+  CLC +I+   + D  +  + I     L LP+
Sbjct  44   CLPYVEGEGKTPAPDCCDGLKTLLNTNKKCLCLIIKD--RNDPDLGGIQINVTLALGLPT  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGSTS  533
             C  A A+ + CP+LL++   S +A +F   +N     A S + GASP G+ S
Sbjct  102  VCN-APANISKCPELLHMDPKSAEAQVFYGSSNVGPGPAPSPSDGASPEGTRS  153



>ref|XP_008378010.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=198

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  +   +  CLC +I+   + D  +  L I     L LPS
Sbjct  45   CLPYVGGQAKAPTPDCCSGLKQVLNNNKKCLCVIIK--DRNDPEL-GLQINVTLALGLPS  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA---TTSHATSKTPGASPGGSTS  533
             CK A A+ + CP+LL+L   SP+A +F      +T  A+S  P  S  G TS
Sbjct  102  VCK-APANVSKCPELLHLDPKSPEAQVFYQLEGNSTKTASSLAPSPSVDGPTS  153



>ref|XP_009769034.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
[Nicotiana sylvestris]
Length=169

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 56/117 (48%), Gaps = 17/117 (15%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G + +PS  CC  + ++ + +P CLC    QV  G  S   L I + + L LP+
Sbjct  40   CLNYITGNSSSPSSGCCTQLGTVVKNNPECLC----QVLNGGGSNLGLNINQTQALALPT  95

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG  554
             CK+   S + C       AGSP+       ++   T  +PG    G  S P++ GG
Sbjct  96   ACKVQTPSVSKC------NAGSPN-------SSPAGTPSSPGTEASGRGSVPSSEGG  139



>gb|EEC81687.1| hypothetical protein OsI_25271 [Oryza sativa Indica Group]
Length=198

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 56/115 (49%), Gaps = 9/115 (8%)
 Frame = +3

Query  204  CLSY----AIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL  371
            CL++    A G A AP+  CC  + ++      CLC +I+     D     L I   + L
Sbjct  29   CLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKD---RDDPNLDLKINVTKAL  85

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTS  533
             LP  C  A A+ ++CP+LLNLP  S DA IF   A    A   +P ASP G  +
Sbjct  86   SLPQLCN-APANISDCPRLLNLPPNSKDAQIFEQFAKQQAAMQGSPSASPVGEQT  139



>gb|KDP44350.1| hypothetical protein JCGZ_19217 [Jatropha curcas]
Length=181

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 59/117 (50%), Gaps = 9/117 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK--L  377
            CL Y  GTA AP+  CC  +  + E    CLC +I+     D    SLG+K +  L   L
Sbjct  39   CLPYVGGTAKAPTLDCCTGLKQVLEKSKKCLCILIK-----DRDDPSLGLKINATLAATL  93

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA  548
            PS C  A A+ T C  LL+L   SP+A +F       ++S  P AS G ST   ++A
Sbjct  94   PSACH-APANITQCIDLLHLAPSSPEAKVFAGFANITSSSSAPVAS-GNSTKSGSSA  148



>gb|KDP20375.1| hypothetical protein JCGZ_05258 [Jatropha curcas]
Length=196

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 54/106 (51%), Gaps = 5/106 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y   T+ +P+  CC+ +  +   +  CLC +I+  +  D     L I     L LPS
Sbjct  43   CLPYVGATSKSPTPDCCNGLKQVLRDNKKCLCVIIKDRNDPD---LGLKINVTLALGLPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASP  518
             C  A A+ + CP LL+L   SPDA +F   A +S+ +  +P  SP
Sbjct  100  VCH-ATANVSQCPALLHLAPNSPDAQVFYQFAKSSNQSGTSPAPSP  144



>ref|XP_006482799.1| PREDICTED: protein YLS3-like [Citrus sinensis]
Length=159

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 9/110 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + D  CLC +I+ ++  +     L I     L LPS
Sbjct  46   CLPYVGGDAKAPTPDCCSGLKQVLKNDKKCLCVIIRDMNDPE---LGLNINVTLTLGLPS  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF----TNATTSH-ATSKTPGASP  518
             C  A A+ + CP LL+L   SP+A +F     N ++ H   + TP  SP
Sbjct  103  VCH-APANVSQCPALLHLDPNSPEAQVFYQFGRNPSSPHTVITSTPTPSP  151



>ref|XP_010673513.1| PREDICTED: protein YLS3 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 61/121 (50%), Gaps = 15/121 (12%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL--LKL  377
            CL Y  G A AP++ CC  +  + +    C+C +I+     D    SLG+K +    L L
Sbjct  43   CLPYVGGQAKAPTQDCCTGLKQVIKASKKCVCILIK-----DRDDPSLGLKINATLGLTL  97

Query  378  PSECKL-ANASTTNCPKLLNLPAGSPDAAIFTN-------ATTSHATSKTPGASPGGSTS  533
            P  C L A+ +   CP LL+LP  SPDA +FT+         +S  TS     S GG+++
Sbjct  98   PQACHLPASDNVDQCPALLHLPPNSPDAKMFTDLAKRAAAVNSSAPTSSANSTSAGGASA  157

Query  534  Q  536
            +
Sbjct  158  K  158



>ref|XP_009791428.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like 
[Nicotiana sylvestris]
Length=156

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 46/96 (48%), Gaps = 9/96 (9%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            +  CLSY  G++  PS  CC ++S + ++ P CLC     +  G  S   + I +   L 
Sbjct  36   MYSCLSYVTGSSKTPSSSCCSALSGVLQSQPRCLC----TIANGGGSSLGVQINQTLALA  91

Query  375  LPSECKLANASTTNC-----PKLLNLPAGSPDAAIF  467
            LP  CKL     + C     P +  +P GSP+ ++ 
Sbjct  92   LPGACKLQTPPVSRCYAGNGPAMSPMPMGSPEGSVL  127



>ref|XP_006419150.1| hypothetical protein EUTSA_v10002676mg [Eutrema salsugineum]
 gb|ESQ37586.1| hypothetical protein EUTSA_v10002676mg [Eutrema salsugineum]
Length=189

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 60/125 (48%), Gaps = 15/125 (12%)
 Frame = +3

Query  192  KVMDCLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKE  359
             + DCLSY      G A  P K CC  ++ + ET P CLCY++     GD +    GIK 
Sbjct  44   NMTDCLSYVQVGDGGGAAKPDKACCPELAGLVETSPQCLCYLL----AGDMA-AQYGIKI  98

Query  360  D--RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA-SPGGST  530
            D  + LKLP  C +     + C  L  +P G+P+     N   S A + T G  SPGG  
Sbjct  99   DKAKALKLPGVCGVVTPPPSLC-SLFGVPVGAPEP--MGNEEASPAFAPTSGTESPGGFA  155

Query  531  SQPAT  545
            S P+ 
Sbjct  156  SGPSV  160



>ref|XP_007205989.1| hypothetical protein PRUPE_ppa012218mg [Prunus persica]
 gb|EMJ07188.1| hypothetical protein PRUPE_ppa012218mg [Prunus persica]
Length=179

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (55%), Gaps = 13/106 (12%)
 Frame = +3

Query  201  DCLSYAIGTADA--PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCLSY +  ++   P K CC  ++ + + +P+CLC ++   +  +S    L I  +R LK
Sbjct  46   DCLSYVMPGSNLTKPDKPCCPELAELVKDNPICLCSLLANSNSSNS--VGLEIDVNRALK  103

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA  512
            LP+ CK++    + C +LL +P G+P        T S A + +PG+
Sbjct  104  LPTVCKVSTPPPSTC-ELLGIPVGAP--------TASEAPANSPGS  140



>ref|XP_009602114.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
[Nicotiana tomentosiformis]
Length=169

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 55/117 (47%), Gaps = 17/117 (15%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G +  PS  CC  + ++ + +PVCLC    Q+  G  S   L I + + L LP+
Sbjct  40   CLNYITGNSSLPSSGCCTQLGTVVKNNPVCLC----QILNGGGSNLGLNINQTQALALPT  95

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG  554
             CK+   S + C       AGSP+       ++   T  +PG    G  S P++  G
Sbjct  96   ACKVQTPSVSKC------NAGSPN-------SSPAGTPNSPGTEASGRGSVPSSEDG  139



>gb|KJB22206.1| hypothetical protein B456_004G035100 [Gossypium raimondii]
Length=273

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 11/115 (10%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + +  CLC +I+  +  D     L I     L LPS
Sbjct  118  CLPYVGGNAKAPTPDCCSGLKQVLKNNKKCLCIIIKDRNDPD---LGLNINVTLALSLPS  174

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS-------KTPGASPGGS  527
             C  A A+ + CP+LL++   SP+A +F   + S +++         P AS GGS
Sbjct  175  VCN-APANISKCPELLHMDPNSPEAQVFYQLSKSSSSNGGLQSPASAPTASVGGS  228



>gb|ABB90545.1| lipid transfer protein [Triticum aestivum]
Length=185

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 13/121 (11%)
 Frame = +3

Query  204  CLSYA--IGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLL  371
            CL+Y     TA +P+  CC     +      CLC +++     D    +LGIK +  R +
Sbjct  42   CLTYVQLAATARSPTPDCCSGFRQVLGVSKKCLCVLVK-----DRDEPTLGIKFNVTRAM  96

Query  372  KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG  551
             LPS C +  A+ ++CPK+LN+   S +A IF      H   +   A+ GGS +   T+G
Sbjct  97   NLPSACNIP-ATFSDCPKILNMSPDSKEAEIFKQYGIEH---EGKNATAGGSAAVTGTSG  152

Query  552  G  554
            G
Sbjct  153  G  153



>ref|XP_007052623.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96780.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=177

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  +   +  CLC +I+  +  D     L I     L LPS
Sbjct  26   CLPYVGGDAKAPTPDCCSGLKQVLNNNKKCLCVIIKDRNDPD---LGLNINVTLALALPS  82

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTSQPATAGGGL  560
             C  A A+ + CP+LL++   S +A +F   + +S+  +  P  SP G++    + G  +
Sbjct  83   VCN-APANVSKCPELLHMDPNSREAQVFYQLSKSSNGGANNPAPSPTGNSISSKSEGANI  141



>gb|EPS60733.1| hypothetical protein M569_14069, partial [Genlisea aurea]
Length=140

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 4/108 (4%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            V  CL Y    A  P+  CC     + +T P C C +I+   + D S+  L I   R L 
Sbjct  35   VATCLPYVSDEAPKPTPDCCVGFKQVLDTSPACFCLLIKD--RNDPSL-GLQINVTRSLT  91

Query  375  LPSECKL-ANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS  515
            LP  CK+   AS ++CP  L+L   S +A IFT    + A S  P  S
Sbjct  92   LPQVCKVTTKASISDCPAALHLAPNSTEAQIFTQIGDTKANSTAPSHS  139



>ref|XP_002512201.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF50235.1| lipid binding protein, putative [Ricinus communis]
Length=133

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  + + +  CLC VI+  +  D     L I     L LP+
Sbjct  26   CLPYVGGNAKSPTPDCCTGLKEVLKNNKKCLCVVIKDRNDPD---LGLKINVTLALGLPT  82

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS  485
             C  A A+ + CP LL+L   SPDA +F   T S
Sbjct  83   VCH-ATANVSQCPALLHLAPNSPDAQVFYQFTKS  115



>ref|XP_009592817.1| PREDICTED: protein YLS3-like isoform X2 [Nicotiana tomentosiformis]
Length=170

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 11/132 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y    A AP+  CC  +  + +    CLC +I+  +  D     L +     L LPS
Sbjct  43   CLPYVTANAPAPTPDCCTGLKQVLKASKKCLCLLIKDRNDPD---LGLNLNVTLALSLPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGGLW  563
             C+ A A+ + CP LL+LP  SPDA +F   +   ++  +   SP  ++  P+   G  W
Sbjct  100  VCQ-APANISQCPALLHLPPNSPDAQVFYQISNGSSSIAS---SPQANSPIPSDDVGLPW  155

Query  564  ----WVVQARPA  587
                +   ARP+
Sbjct  156  VSVHYYAYARPS  167



>ref|XP_008807342.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like 
[Phoenix dactylifera]
Length=189

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 9/115 (8%)
 Frame = +3

Query  201  DCLSY--AIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCLSY  A   A  P K CC  ++S+ +  P+CLC    ++  G +S   + I   R LK
Sbjct  45   DCLSYVQAGSKAKVPDKACCPELASLVDNYPICLC----ELLGGAASSYGISIDSARALK  100

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQP  539
            LPS C +     + C   L +P GSP +   + A  S + S      PGGSTS P
Sbjct  101  LPSVCHVTTPPVSTC-AALGIPVGSPMSP--SMAPGSGSPSSGGPELPGGSTSSP  152



>ref|XP_008451079.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2 
isoform X2 [Cucumis melo]
Length=174

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 11/108 (10%)
 Frame = +3

Query  201  DCLSYAI-GTADA-PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCLSY   G+ D  P+K+CC  ++ + E+ P CLC ++    K       L I  DR +K
Sbjct  44   DCLSYVTAGSNDTKPNKQCCSELAGLVESSPKCLCELLSDPDK-----VGLTIDVDRAMK  98

Query  375  LPSECKLANASTTNCPKLLNLPAGS---PDAAIFTNATTSHATSKTPG  509
            LPS+C+++    + C  LL  P GS   P   +        +T+ TPG
Sbjct  99   LPSQCRISTPPISLC-SLLGFPVGSSPAPSPGVQPPDAGGSSTTDTPG  145



>ref|XP_010098644.1| putative GPI-anchored protein [Morus notabilis]
 gb|EXB75445.1| putative GPI-anchored protein [Morus notabilis]
Length=177

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 7/113 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + +  CLC VI+  +  D     L I     L LPS
Sbjct  27   CLPYVGGQAKAPTPDCCSGLKQVLKDNKKCLCVVIRDRNDPD---LGLQINVTLALSLPS  83

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNA---TTSHATSKTPGASPGGSTS  533
             C  A A+ + CP+LL +   SP+A +F      +T   ++ +P  S GG  S
Sbjct  84   VCN-APANVSKCPELLKMDPHSPEAQVFYQLERNSTKTDSNPSPSPSAGGHIS  135



>ref|XP_008809013.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=192

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ Y  G+A  P+ +CC     ++ + P CLC +I  V   D S+ +L I     L +P+
Sbjct  43   CVPYVSGSAPKPTPECCADAEKVRASQPKCLCVLI--VESTDPSL-ALPINTTLALHMPA  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNAT  479
             C  ++A  +NCP +L L   SP+A IF +A+
Sbjct  100  ACN-SDAKVSNCPSILKLNPSSPEARIFKDAS  130



>ref|XP_010536250.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2, 
partial [Tarenaya hassleriana]
Length=153

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 13/124 (10%)
 Frame = +3

Query  201  DCLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--  362
            DCLSY +    G A  P   CC  ++ + E+ P CLCY++     G ++    GIK D  
Sbjct  5    DCLSYVMAGSGGGASKPDAGCCPELAGLVESSPQCLCYLL-----GGNTAEQYGIKIDMA  59

Query  363  RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS-PGGSTSQP  539
            + LKLPS C +     + C  L  +P  +P  +   ++  + A + +PG   P G  + P
Sbjct  60   KALKLPSVCGVVTPPPSLC-SLFGVPVAAPTTSEAPSSNENIAPTISPGVEPPQGFAASP  118

Query  540  ATAG  551
            A AG
Sbjct  119  AAAG  122



>ref|XP_011089118.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=196

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL Y  G +  P   CC  +  +    P C+C +++     D +  SLG+K +    L L
Sbjct  53   CLPYVSGESKTPPIDCCAGLKQVLHKSPECICLLVK-----DRNDPSLGLKINATLALTL  107

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTN  473
            PS+C  A A+ ++CP LL+LP  SPDA +F +
Sbjct  108  PSQCH-APANVSHCPALLHLPPNSPDAKVFED  138



>ref|XP_004134131.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Cucumis sativus]
 gb|KGN56963.1| hypothetical protein Csa_3G146490 [Cucumis sativus]
Length=169

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 6/86 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G +  PS+ CC  +S++  ++P CLC    QV  G  S   + I + + L LP 
Sbjct  38   CLNYITGNSSTPSQSCCTQLSNVVRSNPQCLC----QVLNGGGSSLGVNINQTQALALPQ  93

Query  384  ECKLANASTTNCPKLLNLPAGSPDAA  461
             C +   S ++C   ++ PAGSP  A
Sbjct  94   ACNVQTPSVSSCN--VDSPAGSPAGA  117



>ref|XP_007159392.1| hypothetical protein PHAVU_002G234400g [Phaseolus vulgaris]
 gb|ESW31386.1| hypothetical protein PHAVU_002G234400g [Phaseolus vulgaris]
Length=187

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 8/110 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL+YA G A  P+  CC  +  + +    CLC +I+     D +  SLG+K +    LKL
Sbjct  41   CLTYASGEAAVPTMDCCFGLKEVIDKSKRCLCILIK-----DRNDPSLGLKVNVTLALKL  95

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS  527
            P  CK    + T C  LL+LP  S DA +F     S     +P ++P  +
Sbjct  96   PEVCK-TPTNITECVDLLHLPPNSADAKVFEGFEKSLTNQTSPPSTPAAT  144



>gb|KEH19312.1| Lipid transfer protein [Medicago truncatula]
Length=195

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G    P+  CCD + ++ +T+  CLC +I+   + D  +  + I     L LP+
Sbjct  44   CLPYVEGEGKTPAPDCCDGLKTLLKTNKKCLCVIIKD--RNDPDLGGIVINVTLALNLPT  101

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGSTSQPAT  545
             C  A A+ + CP+LL++   S +A +F    N +++ + S  P  S G S+   +T
Sbjct  102  VCN-APANISKCPELLHMDPNSAEAQVFYTLNNGSSNISPSAAPSPSDGASSQARST  157



>ref|XP_002270671.1| PREDICTED: protein YLS3 [Vitis vinifera]
 emb|CBI32156.3| unnamed protein product [Vitis vinifera]
Length=188

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  + + +  CLC +I+  +  D     L +     L LPS
Sbjct  41   CLPYVGGDAKAPTPDCCSGLKQVLQKNKKCLCVIIKDRNDPD---LGLNLNATLALGLPS  97

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHAT-SKTP  506
             C  A A+ + CP LL+L   SPDA +F   A +S+ T S TP
Sbjct  98   VCH-APANVSQCPALLHLAPNSPDAQVFYQFANSSNGTASSTP  139



>gb|KJB66104.1| hypothetical protein B456_010G127100 [Gossypium raimondii]
Length=189

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 65/133 (49%), Gaps = 20/133 (15%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G A  P+  CC  +  + +    CLC +I+     D    SLG+K +  L   L
Sbjct  44   CLPYVGGEAKTPTIDCCSGLKQVLDKSKKCLCVLIK-----DKDDPSLGLKINGTLAGTL  98

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPGGSTSQPATA  548
            PS C+ A+AS   C  LL+L   S +A +F      T  H +  TP A+ G STS+P++A
Sbjct  99   PSTCR-ASASMAECISLLHLAPNSQEAKLFEGYQKLTEGHGS--TPAAT-GNSTSRPSSA  154

Query  549  ------GGGLWWV  569
                  G G  WV
Sbjct  155  AEKSDGGQGKRWV  167



>ref|XP_006838654.1| hypothetical protein AMTR_s00002p00240480 [Amborella trichopoda]
 gb|ERN01223.1| hypothetical protein AMTR_s00002p00240480 [Amborella trichopoda]
Length=190

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y  G A +P+K CC     + E    C C +I+     DS+  +LGIK +  L  KL
Sbjct  44   CLPYVQGEAASPTKDCCRGFKQVVEKSDKCFCILIK-----DSTDPNLGIKINTSLAAKL  98

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS  515
            P  C   + + + CP++L++   +P+A IF    ++ AT+ +  AS
Sbjct  99   PHSCS-TSVNISRCPEILHISPNAPEAQIFKQFASAVATNTSAPAS  143



>gb|EMT29098.1| hypothetical protein F775_26764 [Aegilops tauschii]
Length=144

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +3

Query  234  APSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTT  413
            AP+  CC  + ++ +T P CLC +++     D     L +   R L LP+ C  A A+ +
Sbjct  10   APTPDCCGGLKTVLQTSPKCLCVLVKD---RDDPGLDLKLNVTRALGLPAACS-APANIS  65

Query  414  NCPKLLNLPAGSPDAAIF  467
            +CP+LLNLP  S DA +F
Sbjct  66   DCPRLLNLPPNSKDAEVF  83



>ref|XP_004228722.1| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=193

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 65/123 (53%), Gaps = 15/123 (12%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL--LKL  377
            CL Y  G A +P+  CC  +  + +   +CLC +++     D +  SLG+K +    L L
Sbjct  44   CLPYVSGEAKSPTPDCCTGLKEVLDKSKICLCILVK-----DRNDPSLGLKINATLALSL  98

Query  378  PSEC----KLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGA-SPGGSTSQP  539
            P+ C     ++N S   CP+LL+L   SPDA +F + A ++  +S  P A   G S+ +P
Sbjct  99   PTLCHAPPNMSNVSM--CPELLHLAPNSPDAKVFQDFAKSAKGSSAAPSAPVSGNSSGKP  156

Query  540  ATA  548
            A +
Sbjct  157  ANS  159



>ref|XP_006419149.1| hypothetical protein EUTSA_v10002676mg [Eutrema salsugineum]
 gb|ESQ37585.1| hypothetical protein EUTSA_v10002676mg [Eutrema salsugineum]
Length=187

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 15/124 (12%)
 Frame = +3

Query  192  KVMDCLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKE  359
             + DCLSY      G A  P K CC  ++ + ET P CLCY++     GD +    GIK 
Sbjct  44   NMTDCLSYVQVGDGGGAAKPDKACCPELAGLVETSPQCLCYLL----AGDMA-AQYGIKI  98

Query  360  D--RLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTS  533
            D  + LKLP  C +     + C  L  +P G+P+     N   S A + T   SPGG  S
Sbjct  99   DKAKALKLPGVCGVVTPPPSLC-SLFGVPVGAPEP--MGNEEASPAFAPT-SESPGGFAS  154

Query  534  QPAT  545
             P+ 
Sbjct  155  GPSV  158



>ref|XP_006361136.1| PREDICTED: xylogen-like protein 11-like [Solanum tuberosum]
Length=194

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (50%), Gaps = 16/117 (14%)
 Frame = +3

Query  201  DCLSYAIGTADA--PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCL++    +++  P K CC  ++ + +++P+CLC ++ + H G  +     I  D+ LK
Sbjct  57   DCLTFVERGSNSTTPGKGCCPEIAGLLDSNPICLCQMLGRAHSG--AKIGFNIDVDKALK  114

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            LPS C L     + C   L +P G+P             + ++P  SPGG  + P +
Sbjct  115  LPSACSLEFPPASTCSD-LGVPVGAP-----------LPSEESPAPSPGGFATSPTS  159



>ref|XP_007015522.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY33141.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=185

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 14/117 (12%)
 Frame = +3

Query  201  DCLSYAIGTADA--PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            DCL+Y    ++   P K CC  ++ + E+ P CLCY++    K  +S     I  +R L 
Sbjct  50   DCLTYVEAGSNLTKPEKPCCPELAGLVESTPQCLCYLLD---KNATSSYGFNIDMNRALN  106

Query  375  LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
            LP+ CK++    + C  +   PA SP         T +  S +PG +P G  + P++
Sbjct  107  LPTVCKVSTPPVSLCSVITGAPAESP---------TGNGGSMSPGFAPQGLAASPSS  154



>ref|XP_002466309.1| hypothetical protein SORBIDRAFT_01g005410 [Sorghum bicolor]
 gb|EER93307.1| hypothetical protein SORBIDRAFT_01g005410 [Sorghum bicolor]
Length=186

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 52/111 (47%), Gaps = 5/111 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            C+ Y  G   AP   CC +VS +  + P CLC V+     G ++   + +  DR L+LP+
Sbjct  47   CMDYMSGNETAPDGPCCSAVSGMLRSSPGCLCMVV----GGTAASLGVAVDADRALRLPA  102

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQ  536
             CK+     + C   + +P  SP A   +    + AT      +P GS S+
Sbjct  103  ACKVQAPPASQC-NAVGVPVPSPAAGTASPGDPAAATPSDANVTPAGSGSK  152



>ref|XP_008438652.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
[Cucumis melo]
Length=169

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G +  PS+ CC  +SS+  + P CLC    QV  G  +   + I + + L LP 
Sbjct  38   CLNYITGNSSTPSQSCCTQLSSVVRSQPQCLC----QVLNGGGASLGVNINQTQALALPQ  93

Query  384  ECKLANASTTNCPKLLNLPAGSPDAA  461
             C +   S ++C   ++ PAGSP  A
Sbjct  94   ACNVQTPSVSSCN--VDSPAGSPAGA  117



>ref|XP_009592816.1| PREDICTED: protein YLS3-like isoform X1 [Nicotiana tomentosiformis]
Length=197

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y    A AP+  CC  +  + +    CLC +I+  +  D     L +     L LPS
Sbjct  43   CLPYVTANAPAPTPDCCTGLKQVLKASKKCLCLLIKDRNDPD---LGLNLNVTLALSLPS  99

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF  467
             C+ A A+ + CP LL+LP  SPDA +F
Sbjct  100  VCQ-APANISQCPALLHLPPNSPDAQVF  126



>ref|XP_002521629.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF40736.1| lipid binding protein, putative [Ricinus communis]
Length=211

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 15/125 (12%)
 Frame = +3

Query  201  DCLSYAIGTADA--PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVT-SLGIKED--R  365
            DCLSY   +++   P K CC  ++ + + +P+CLC ++     G+S++T S G K D  R
Sbjct  70   DCLSYVTESSNVTVPDKNCCPELAGLLDGNPICLCQLL-----GNSNLTESYGFKIDVNR  124

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPG-ASPGGSTSQPA  542
             LKLPS C+++    + C  +   P   P   I + A+ S   ++TPG A P G  S P+
Sbjct  125  ALKLPSICRVSTPPVSLC-SVAGYPVPGP---IASEASPSPMDNQTPGVAPPEGLASSPS  180

Query  543  TAGGG  557
            T   G
Sbjct  181  TGNNG  185



>ref|XP_008231395.1| PREDICTED: protein YLS3-like isoform X2 [Prunus mume]
Length=190

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 55/113 (49%), Gaps = 4/113 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A +P+  CC  +  +  ++  CLC +I+   + D  +  L I     L LPS
Sbjct  44   CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIK--DRNDPEL-GLQINVTLALGLPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA  542
             C++  A+ + CP+LL+L   SP+A +F     +   +     +P  S   PA
Sbjct  101  VCQVP-ANVSKCPELLHLDPKSPEAQVFYQLERNSTQTANSSLAPSPSVGAPA  152



>ref|XP_002304871.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
 gb|EEE79850.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
Length=190

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 56/119 (47%), Gaps = 10/119 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL  377
            CL Y    A AP+  CC  +  + +    CLC +I+     D    +LGIK +  L  KL
Sbjct  46   CLPYVSDDAKAPTLDCCSGLKQVLDKSKKCLCVLIK-----DRDNPNLGIKFNVSLVAKL  100

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNA--TTSHATSKTPGASPGGSTSQPATA  548
            PS C  +  + T C  LL+LPA SPDA  F      T   +  TP  S     S P++A
Sbjct  101  PSLCH-SPVNVTECINLLHLPANSPDAKFFEGFANVTQSGSIDTPVGSGSSIGSNPSSA  158



>ref|NP_001030803.1| non-specific lipid transfer protein GPI-anchored 2 [Arabidopsis 
thaliana]
 gb|AEE77822.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=191

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 61/123 (50%), Gaps = 13/123 (11%)
 Frame = +3

Query  204  CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R  365
            CLSY      G A  P K CC +++ + E+ P CLCY++     GD +   LGIK D  +
Sbjct  48   CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLS----GDMA-AQLGIKIDKAK  102

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
             LKLP  C +     + C  L  +P G+P A     A+ ++A       SPGG  S P+ 
Sbjct  103  ALKLPGVCGVITPDPSLC-SLFGIPVGAPVAMGDEGASPAYAPGSM-SESPGGFGSGPSA  160

Query  546  AGG  554
            + G
Sbjct  161  SRG  163



>ref|XP_004504341.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=194

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 10/127 (8%)
 Frame = +3

Query  201  DCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLP  380
            +CL +  G A +P+  CC  V  +      CLC +I+     D     L I     L+LP
Sbjct  47   NCLPFVTGQAKSPNIDCCTGVKDVINNSKRCLCILIKD---HDDPNLGLKINVTLALQLP  103

Query  381  SECKLANASTTNCPKLLNLPAGSPDAAIF---TNATTSHATSKTPGASPG---GSTSQPA  542
            ++CK    + T C  +L+LP  SP+A IF    N+   ++++  P AS     G++++  
Sbjct  104  NDCKTP-TNITKCVGILHLPPKSPEAKIFEDIQNSMEKNSSTAVPPASNSTGKGTSTRGQ  162

Query  543  TAGGGLW  563
               GG W
Sbjct  163  EKNGGGW  169



>dbj|BAH56934.1| AT3G43720 [Arabidopsis thaliana]
Length=187

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 61/123 (50%), Gaps = 17/123 (14%)
 Frame = +3

Query  204  CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R  365
            CLSY      G A  P K CC +++ + E+ P CLCY++     GD +   LGIK D  +
Sbjct  48   CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLS----GDMA-AQLGIKIDKAK  102

Query  366  LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT  545
             LKLP  C +     + C  L  +P G+P A     A+ ++A       SPGG  S P+ 
Sbjct  103  ALKLPGVCGVITPDPSLC-SLFGIPVGAPVAMGDEGASPAYAPE-----SPGGFGSGPSA  156

Query  546  AGG  554
            + G
Sbjct  157  SRG  159



>ref|XP_002889436.1| hypothetical protein ARALYDRAFT_311412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65695.1| hypothetical protein ARALYDRAFT_311412 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 42/83 (51%), Gaps = 3/83 (4%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G + +PS  CC   S++ ++ P CLCYV   V+  +SS +         L LP+
Sbjct  35   CLNYLNGGSTSPSSNCCSQFSTVVQSSPECLCYV---VNSNESSFSGFKFNRTLALNLPT  91

Query  384  ECKLANASTTNCPKLLNLPAGSP  452
             C +   S + C    N P+ SP
Sbjct  92   ACNVQTPSPSQCNTGSNRPSTSP  114



>ref|XP_007219100.1| hypothetical protein PRUPE_ppa015466mg, partial [Prunus persica]
 gb|EMJ20299.1| hypothetical protein PRUPE_ppa015466mg, partial [Prunus persica]
Length=147

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 8/108 (7%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A  P+  CC  +  +  ++  CLC +IQ   + D  +  L I     L LPS
Sbjct  44   CLPYVQGQAKTPTPDCCSGLKQVLNSNKKCLCVIIQ--DRNDPEL-DLQINVTLALGLPS  100

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF----TNATTSHATSKTPGAS  515
             C++  A+ + CP+LL+L   SP+A +F     N+T +  +S  P  S
Sbjct  101  VCQVP-ANVSKCPELLHLDPKSPEAQVFYQLERNSTQTANSSLAPSPS  147



>ref|XP_004306485.1| PREDICTED: protein YLS3-like [Fragaria vesca subsp. vesca]
Length=207

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL Y  G A AP+  CC  +  +   +  CLC +IQ  +  D     L I     L LPS
Sbjct  56   CLPYVGGEAMAPTPDCCSGLKQVLNNNKKCLCVIIQDRNDPD---LGLQINVTLALGLPS  112

Query  384  ECKLANASTTNCPKLLNLPAGSPDAAIF  467
             C  A A+ + CP+LL+L   SP+A +F
Sbjct  113  VCH-AAANVSKCPELLHLDPKSPEAQVF  139



>ref|XP_004164321.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Cucumis sativus]
Length=169

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 9/111 (8%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS  383
            CL+Y  G +  PS+ CC  +S++  ++P CLC    QV  G  S   + I + + L LP 
Sbjct  38   CLNYITGNSSTPSQSCCTQLSNVVRSNPQCLC----QVLNGGGSSLGVNINQTQALALPQ  93

Query  384  ECKLANASTTNC--PKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGST  530
             C +   S ++C      + PAG+PD+   +N   S   SKT  ++  GS+
Sbjct  94   ACNVQTPSVSSCNVDSPADSPAGAPDS---SNNVPSGTGSKTVPSTDNGSS  141



>ref|XP_002530873.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF31513.1| lipid binding protein, putative [Ricinus communis]
Length=145

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 8/90 (9%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK--L  377
            CL Y  GTA  P+  CC  + S+ +    CLC +I+     D     LGIK +  L   L
Sbjct  40   CLPYVGGTAKTPTLDCCTGLKSVLDKSRKCLCVLIKDRDNPD-----LGIKFNATLAAFL  94

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIF  467
            P+ C  A  + T C  LL+LP  SPDA +F
Sbjct  95   PAACH-APVNVTECIDLLHLPPSSPDAKVF  123



>gb|AFG47010.1| hypothetical protein 2_5794_01, partial [Pinus taeda]
Length=133

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  234  APSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG--IKEDRLLKLPSECKLANAS  407
            +PS  CC ++ ++  + P CLC +++     DS+  SLG  I +   L LP+ CK+ NA+
Sbjct  4    SPSTDCCTNLKNVYGSAPKCLCILVK-----DSTSASLGVSINQTLALGLPAACKV-NAN  57

Query  408  TTNCPKLLNLPAGSPDAAIF  467
             + CP LLN+   SPDA +F
Sbjct  58   ISECPALLNISPDSPDAKVF  77



>ref|XP_009354800.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=149

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 56/109 (51%), Gaps = 11/109 (10%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK--L  377
            CL Y  G A AP+  CC  +  +   +  CLC +I+     D +   LG++ +  L   L
Sbjct  45   CLPYVGGQAKAPTPDCCSGLKQVLNNNKKCLCVIIK-----DRNDPELGLQMNVTLALGL  99

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNA---TTSHATSKTPGAS  515
            PS CK A A+ + CP+LL+L   SP+A +F      +T  A+S  P  S
Sbjct  100  PSVCK-APANVSKCPELLHLDPKSPEAQVFYQLEGNSTKTASSLAPSPS  147



>gb|KEH43852.1| Lipid transfer protein [Medicago truncatula]
Length=154

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  195  VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK  374
            +M CL Y  G +  P+  CC  ++++ ++ P CLC +I     G    +SLGI +   L 
Sbjct  35   LMPCLGYVRGNSPTPTAGCCTQLANVVKSQPECLCLII-----GSDLGSSLGINKTLALA  89

Query  375  LPSECKLANASTTNCPKLLNLPAGS  449
            LP+ C +     + C  + N PAGS
Sbjct  90   LPAACNVETPPVSQCETVANPPAGS  114



>ref|XP_010101138.1| putative GPI-anchored protein [Morus notabilis]
 gb|EXB87356.1| putative GPI-anchored protein [Morus notabilis]
Length=182

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 63/135 (47%), Gaps = 15/135 (11%)
 Frame = +3

Query  204  CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL  377
            CL++  G A +P+  CC  + ++ E    CLC +++     D     L IK +  R L+L
Sbjct  46   CLNFVGGQASSPTSDCCRGLKTVVEKSTKCLCVLVK-----DRDDPELDIKFNVTRALQL  100

Query  378  PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASP-----GGSTSQPA  542
            PS C +   + T C  LL L   S DA +F +   S     +  ASP     G STS   
Sbjct  101  PSTCHVP-LNLTACVDLLGLAPNSTDAKVFEDFAKSLGNGTSTSASPAARTDGNSTSHGN  159

Query  543  TAGGGLW--WVVQAR  581
            TA  G     +++AR
Sbjct  160  TAAKGERDGIIIRAR  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925