BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF015L20

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097825.1|  PREDICTED: syntaxin-51-like                        200   1e-60   Sesamum indicum [beniseed]
ref|XP_011095474.1|  PREDICTED: syntaxin-52-like                        193   4e-58   Sesamum indicum [beniseed]
ref|XP_009786725.1|  PREDICTED: syntaxin-51-like                        190   1e-56   Nicotiana sylvestris
ref|XP_010324299.1|  PREDICTED: syntaxin-51-like isoform X1             190   1e-56   Solanum lycopersicum
ref|XP_006346178.1|  PREDICTED: syntaxin-51-like isoform X1             190   2e-56   
ref|XP_006346179.1|  PREDICTED: syntaxin-51-like isoform X2             187   1e-55   Solanum tuberosum [potatoes]
ref|XP_009591371.1|  PREDICTED: syntaxin-51-like                        187   1e-55   Nicotiana tomentosiformis
ref|XP_004244081.1|  PREDICTED: syntaxin-51-like isoform X2             187   1e-55   Solanum lycopersicum
gb|EYU27391.1|  hypothetical protein MIMGU_mgv1a013014mg                186   5e-55   Erythranthe guttata [common monkey flower]
ref|XP_009625654.1|  PREDICTED: syntaxin-51-like isoform X1             186   8e-55   Nicotiana tomentosiformis
ref|XP_006452473.1|  hypothetical protein CICLE_v10009364mg             183   5e-54   Citrus clementina [clementine]
ref|XP_009625656.1|  PREDICTED: syntaxin-51-like isoform X2             182   1e-53   Nicotiana tomentosiformis
emb|CDP13772.1|  unnamed protein product                                182   1e-53   Coffea canephora [robusta coffee]
ref|XP_009765136.1|  PREDICTED: syntaxin-51-like isoform X1             181   8e-53   Nicotiana sylvestris
ref|XP_006595709.1|  PREDICTED: syntaxin-51-like                        179   1e-52   Glycine max [soybeans]
gb|ACU19604.1|  unknown                                                 179   1e-52   Glycine max [soybeans]
ref|XP_004491441.1|  PREDICTED: syntaxin-52-like isoform X2             177   4e-52   Cicer arietinum [garbanzo]
ref|XP_010246481.1|  PREDICTED: syntaxin-52-like                        177   8e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004491440.1|  PREDICTED: syntaxin-52-like isoform X1             177   1e-51   Cicer arietinum [garbanzo]
ref|XP_009765138.1|  PREDICTED: syntaxin-51-like isoform X2             177   1e-51   Nicotiana sylvestris
ref|XP_010647220.1|  PREDICTED: syntaxin-51-like                        174   1e-50   
ref|XP_002277100.1|  PREDICTED: syntaxin-51                             174   1e-50   Vitis vinifera
ref|XP_010099994.1|  hypothetical protein L484_014031                   174   2e-50   
ref|XP_010245902.1|  PREDICTED: syntaxin-51-like                        174   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010537838.1|  PREDICTED: syntaxin-51                             172   6e-50   Tarenaya hassleriana [spider flower]
ref|XP_006602182.1|  PREDICTED: syntaxin-52-like isoform X2             172   1e-49   Glycine max [soybeans]
gb|KJB22166.1|  hypothetical protein B456_004G032900                    169   1e-49   Gossypium raimondii
ref|XP_007146536.1|  hypothetical protein PHAVU_006G048900g             171   2e-49   Phaseolus vulgaris [French bean]
gb|KJB81689.1|  hypothetical protein B456_013G156800                    168   2e-49   Gossypium raimondii
ref|XP_003551745.1|  PREDICTED: syntaxin-52-like isoform X1             171   2e-49   Glycine max [soybeans]
gb|ACU23148.1|  unknown                                                 171   2e-49   Glycine max [soybeans]
gb|KDP39206.1|  hypothetical protein JCGZ_00963                         171   3e-49   Jatropha curcas
gb|KJB22167.1|  hypothetical protein B456_004G032900                    168   3e-49   Gossypium raimondii
gb|KJB81687.1|  hypothetical protein B456_013G156800                    168   4e-49   Gossypium raimondii
gb|KJB22169.1|  hypothetical protein B456_004G032900                    169   4e-49   Gossypium raimondii
gb|KJB22168.1|  hypothetical protein B456_004G032900                    169   4e-49   Gossypium raimondii
gb|KHN30881.1|  Syntaxin-51                                             170   5e-49   Glycine soja [wild soybean]
gb|KHG18509.1|  Syntaxin-51 -like protein                               170   6e-49   Gossypium arboreum [tree cotton]
gb|AFK40726.1|  unknown                                                 170   6e-49   Lotus japonicus
gb|KJB81686.1|  hypothetical protein B456_013G156800                    169   6e-49   Gossypium raimondii
gb|AFK34174.1|  unknown                                                 170   7e-49   Lotus japonicus
gb|KJB81691.1|  hypothetical protein B456_013G156800                    168   8e-49   Gossypium raimondii
gb|KHG11788.1|  Syntaxin-51 -like protein                               169   1e-48   Gossypium arboreum [tree cotton]
gb|KJB22165.1|  hypothetical protein B456_004G032900                    169   1e-48   Gossypium raimondii
ref|XP_007142350.1|  hypothetical protein PHAVU_008G273200g             169   1e-48   Phaseolus vulgaris [French bean]
gb|KJB81690.1|  hypothetical protein B456_013G156800                    169   1e-48   Gossypium raimondii
ref|XP_006344878.1|  PREDICTED: syntaxin-52-like                        169   1e-48   
gb|KGN56069.1|  hypothetical protein Csa_3G064180                       169   2e-48   Cucumis sativus [cucumbers]
ref|XP_004149588.1|  PREDICTED: syntaxin-52-like                        169   2e-48   Cucumis sativus [cucumbers]
ref|XP_010532045.1|  PREDICTED: syntaxin-51-like isoform X2             169   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_010532042.1|  PREDICTED: syntaxin-51-like isoform X1             168   2e-48   Tarenaya hassleriana [spider flower]
gb|KHM99515.1|  Syntaxin-51                                             168   3e-48   Glycine soja [wild soybean]
gb|AFK42434.1|  unknown                                                 166   3e-48   Lotus japonicus
ref|XP_007020671.1|  Syntaxin of plants 51 isoform 1                    168   3e-48   
ref|XP_003532151.1|  PREDICTED: syntaxin-51-like isoform X1             168   3e-48   Glycine max [soybeans]
gb|AHA84215.1|  syntaxin-51                                             171   7e-48   Phaseolus vulgaris [French bean]
gb|AAZ32890.1|  syntaxin of plants                                      164   7e-48   Medicago sativa [alfalfa]
ref|XP_008449105.1|  PREDICTED: syntaxin-51-like                        167   8e-48   Cucumis melo [Oriental melon]
gb|ACJ84463.1|  unknown                                                 166   9e-48   Medicago truncatula
gb|EPS71742.1|  hypothetical protein M569_03017                         167   1e-47   Genlisea aurea
ref|XP_010909005.1|  PREDICTED: syntaxin-52-like                        166   2e-47   Elaeis guineensis
gb|AFK40910.1|  unknown                                                 166   2e-47   Lotus japonicus
ref|XP_003617659.1|  Syntaxin-51                                        164   2e-47   Medicago truncatula
ref|XP_004500114.1|  PREDICTED: syntaxin-52-like                        166   2e-47   Cicer arietinum [garbanzo]
gb|KEH18882.1|  syntaxin of plants protein                              166   3e-47   Medicago truncatula
ref|XP_008787642.1|  PREDICTED: syntaxin-52-like                        165   4e-47   Phoenix dactylifera
gb|KJB11950.1|  hypothetical protein B456_002G094300                    162   6e-47   Gossypium raimondii
gb|KJB11948.1|  hypothetical protein B456_002G094300                    162   6e-47   Gossypium raimondii
gb|KJB11949.1|  hypothetical protein B456_002G094300                    162   7e-47   Gossypium raimondii
gb|KHG00459.1|  Syntaxin-51 -like protein                               165   7e-47   Gossypium arboreum [tree cotton]
gb|AFK34675.1|  unknown                                                 164   8e-47   Medicago truncatula
ref|XP_003600182.1|  Syntaxin-52                                        164   9e-47   
gb|ABI84247.1|  syntaxin                                                162   1e-46   Arachis hypogaea [goober]
gb|KJB11947.1|  hypothetical protein B456_002G094300                    162   1e-46   Gossypium raimondii
gb|AES70433.2|  syntaxin of plants protein                              164   2e-46   Medicago truncatula
gb|KJB11954.1|  hypothetical protein B456_002G094300                    162   3e-46   Gossypium raimondii
gb|KJB11946.1|  hypothetical protein B456_002G094300                    163   3e-46   Gossypium raimondii
gb|AFK35227.1|  unknown                                                 163   3e-46   Medicago truncatula
gb|ABK23110.1|  unknown                                                 160   3e-45   Picea sitchensis
ref|XP_010940839.1|  PREDICTED: syntaxin-52-like                        158   2e-44   Elaeis guineensis
ref|XP_010675821.1|  PREDICTED: syntaxin-52-like                        158   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007211870.1|  hypothetical protein PRUPE_ppa010128mg             157   5e-44   Prunus persica
ref|XP_004151390.1|  PREDICTED: syntaxin-51-like                        157   7e-44   Cucumis sativus [cucumbers]
emb|CDX88551.1|  BnaC06g39950D                                          157   9e-44   
ref|XP_006302763.1|  hypothetical protein CARUB_v10020885mg             156   1e-43   Capsella rubella
ref|XP_006389870.1|  hypothetical protein EUTSA_v10019084mg             155   3e-43   
ref|XP_002887794.1|  hypothetical protein ARALYDRAFT_477131             155   3e-43   
ref|XP_008447706.1|  PREDICTED: syntaxin-51-like                        155   4e-43   Cucumis melo [Oriental melon]
ref|XP_008227024.1|  PREDICTED: syntaxin-52-like                        155   5e-43   Prunus mume [ume]
ref|XP_008775700.1|  PREDICTED: syntaxin-52-like isoform X2             154   8e-43   Phoenix dactylifera
ref|XP_008775698.1|  PREDICTED: syntaxin-52-like isoform X1             154   9e-43   Phoenix dactylifera
ref|XP_008784838.1|  PREDICTED: syntaxin-52-like                        154   1e-42   Phoenix dactylifera
ref|XP_009106789.1|  PREDICTED: syntaxin-52-like                        153   2e-42   
emb|CDY68585.1|  BnaAnng27700D                                          153   2e-42   Brassica napus [oilseed rape]
gb|AAM64357.1|  unknown                                                 153   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117773.1|  PREDICTED: syntaxin-51-like                        152   5e-42   Brassica rapa
ref|XP_009128372.1|  PREDICTED: syntaxin-52 isoform X2                  152   5e-42   Brassica rapa
emb|CDY52847.1|  BnaA09g56390D                                          152   5e-42   Brassica napus [oilseed rape]
ref|XP_009128371.1|  PREDICTED: syntaxin-52 isoform X1                  152   5e-42   Brassica rapa
ref|NP_565213.1|  syntaxin-52                                           152   7e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AFW61957.1|  hypothetical protein ZEAMMB73_963395                    150   7e-42   
emb|CDY33349.1|  BnaC05g12340D                                          152   8e-42   Brassica napus [oilseed rape]
ref|XP_010472824.1|  PREDICTED: syntaxin-52                             151   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002892898.1|  hypothetical protein ARALYDRAFT_471821             151   1e-41   
gb|AAF68106.1|AC010793_1  F20B17.2                                      152   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149057.1|  PREDICTED: syntaxin-51                             151   1e-41   Brassica rapa
ref|XP_008345031.1|  PREDICTED: syntaxin-52-like isoform X3             150   2e-41   
ref|XP_008345029.1|  PREDICTED: syntaxin-52-like isoform X1             151   2e-41   
emb|CDX81754.1|  BnaC08g38470D                                          150   2e-41   
ref|XP_011461087.1|  PREDICTED: syntaxin-52-like                        150   3e-41   Fragaria vesca subsp. vesca
ref|XP_006304162.1|  hypothetical protein CARUB_v10010186mg             150   3e-41   Capsella rubella
ref|XP_010429855.1|  PREDICTED: syntaxin-52-like                        150   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009416129.1|  PREDICTED: syntaxin-52-like                        150   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009361064.1|  PREDICTED: syntaxin-52-like isoform X2             149   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_009361063.1|  PREDICTED: syntaxin-52-like isoform X1             150   5e-41   Pyrus x bretschneideri [bai li]
emb|CDX87371.1|  BnaA07g35020D                                          155   5e-41   
gb|ACF80713.1|  unknown                                                 147   5e-41   Zea mays [maize]
ref|XP_004976388.1|  PREDICTED: syntaxin-52-like                        149   7e-41   Setaria italica
gb|AFW61961.1|  hypothetical protein ZEAMMB73_963395                    147   8e-41   
gb|AFW61956.1|  SNARE domain containing protein                         150   1e-40   
gb|ACN36591.1|  unknown                                                 147   1e-40   Zea mays [maize]
ref|XP_004249335.1|  PREDICTED: syntaxin-51                             148   1e-40   Solanum lycopersicum
ref|NP_001045701.1|  Os02g0119400                                       148   1e-40   
gb|EAY84230.1|  hypothetical protein OsI_05611                          148   1e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010417628.1|  PREDICTED: syntaxin-52-like                        148   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008676698.1|  PREDICTED: uncharacterized protein LOC100217...    147   2e-40   Zea mays [maize]
ref|XP_009606725.1|  PREDICTED: syntaxin-52-like                        148   2e-40   Nicotiana tomentosiformis
ref|XP_006646793.1|  PREDICTED: syntaxin-52-like                        147   3e-40   Oryza brachyantha
ref|XP_009773941.1|  PREDICTED: syntaxin-52-like                        147   4e-40   Nicotiana sylvestris
ref|XP_008385825.1|  PREDICTED: syntaxin-52-like                        147   4e-40   
ref|XP_007211871.1|  hypothetical protein PRUPE_ppa010128mg             148   4e-40   
gb|KCW66898.1|  hypothetical protein EUGRSUZ_F00647                     145   4e-40   Eucalyptus grandis [rose gum]
gb|KCW70251.1|  hypothetical protein EUGRSUZ_F03509                     145   4e-40   Eucalyptus grandis [rose gum]
ref|NP_001136935.1|  uncharacterized protein LOC100217094               147   4e-40   Zea mays [maize]
ref|NP_001131944.1|  uncharacterized protein LOC100193337               147   6e-40   Zea mays [maize]
ref|XP_006339244.1|  PREDICTED: syntaxin-51-like                        146   7e-40   Solanum tuberosum [potatoes]
gb|KCW66897.1|  hypothetical protein EUGRSUZ_F00647                     145   8e-40   Eucalyptus grandis [rose gum]
gb|ACG48507.1|  SNARE domain containing protein                         146   8e-40   Zea mays [maize]
ref|XP_009407478.1|  PREDICTED: syntaxin-52-like                        146   9e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659260.1|  PREDICTED: syntaxin-52-like                        146   1e-39   Oryza brachyantha
ref|XP_010060271.1|  PREDICTED: syntaxin-51-like isoform X2             146   1e-39   Eucalyptus grandis [rose gum]
ref|XP_010063061.1|  PREDICTED: syntaxin-52-like                        146   1e-39   Eucalyptus grandis [rose gum]
gb|KCW66896.1|  hypothetical protein EUGRSUZ_F00647                     146   1e-39   Eucalyptus grandis [rose gum]
gb|ACG31926.1|  SNARE domain containing protein                         145   2e-39   Zea mays [maize]
ref|XP_006416838.1|  hypothetical protein EUTSA_v10008662mg             145   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010060270.1|  PREDICTED: syntaxin-51-like isoform X1             145   2e-39   Eucalyptus grandis [rose gum]
ref|NP_001077546.1|  syntaxin-51                                        145   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563994.1|  syntaxin-51                                           145   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343645.1|  PREDICTED: syntaxin-52-like isoform X2             144   7e-39   Pyrus x bretschneideri [bai li]
ref|XP_009334173.1|  PREDICTED: syntaxin-52-like isoform X3             144   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_009334172.1|  PREDICTED: syntaxin-52-like isoform X2             144   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_009343644.1|  PREDICTED: syntaxin-52-like isoform X1             144   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_006406341.1|  hypothetical protein EUTSA_v10021502mg             142   3e-38   
ref|XP_009334171.1|  PREDICTED: syntaxin-52-like isoform X1             144   4e-38   
gb|EAZ06340.1|  hypothetical protein OsI_28572                          139   5e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_010476728.1|  PREDICTED: syntaxin-51                             142   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010459159.1|  PREDICTED: syntaxin-51-like                        141   8e-38   Camelina sativa [gold-of-pleasure]
dbj|BAJ97107.1|  predicted protein                                      141   8e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007202519.1|  hypothetical protein PRUPE_ppa010912mg             141   9e-38   Prunus persica
ref|XP_010497722.1|  PREDICTED: syntaxin-51-like                        141   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008240610.1|  PREDICTED: syntaxin-51-like                        141   1e-37   Prunus mume [ume]
gb|EMS60104.1|  Syntaxin-51                                             141   1e-37   Triticum urartu
ref|NP_001061436.1|  Os08g0277900                                       139   4e-37   
ref|XP_010673197.1|  PREDICTED: syntaxin-52-like                        139   8e-37   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ85147.1|  predicted protein                                      138   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008668816.1|  PREDICTED: syntaxin-52-like                        138   2e-36   
gb|EEC83251.1|  hypothetical protein OsI_28573                          141   2e-36   Oryza sativa Indica Group [Indian rice]
gb|EEE68383.1|  hypothetical protein OsJ_26713                          140   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EMT28389.1|  hypothetical protein F775_28894                         138   2e-36   
ref|XP_009377637.1|  PREDICTED: syntaxin-51-like                        137   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_006373682.1|  hypothetical protein POPTR_0016s02990g             135   2e-35   
ref|XP_011041363.1|  PREDICTED: syntaxin-52-like                        135   2e-35   Populus euphratica
ref|XP_006373681.1|  hypothetical protein POPTR_0016s02990g             134   6e-35   
ref|XP_007020672.1|  Syntaxin of plants 51 isoform 2                    130   1e-33   
ref|XP_006373683.1|  hypothetical protein POPTR_0016s03000g             130   1e-33   
gb|ABK92777.1|  unknown                                                 127   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011040715.1|  PREDICTED: syntaxin-52-like                        129   6e-33   Populus euphratica
ref|XP_002307951.1|  hypothetical protein POPTR_0006s03120g             127   2e-32   
gb|ABK92902.1|  unknown                                                 126   4e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011041367.1|  PREDICTED: syntaxin-52-like                        126   5e-32   Populus euphratica
ref|XP_011040717.1|  PREDICTED: syntaxin-52-like                        124   5e-31   Populus euphratica
emb|CBI29594.3|  unnamed protein product                                117   2e-30   Vitis vinifera
ref|XP_010111270.1|  hypothetical protein L484_027923                   119   7e-30   
gb|KJB62826.1|  hypothetical protein B456_009G444600                    119   1e-29   Gossypium raimondii
ref|XP_006836711.1|  hypothetical protein AMTR_s00088p00114370          108   4e-27   
gb|AFW61958.1|  hypothetical protein ZEAMMB73_963395                    109   1e-26   
ref|XP_003573428.1|  PREDICTED: syntaxin-52-like                        107   5e-25   Brachypodium distachyon [annual false brome]
gb|EYU33678.1|  hypothetical protein MIMGU_mgv1a021393mg                107   8e-25   Erythranthe guttata [common monkey flower]
ref|NP_173073.2|  Target SNARE coiled-coil domain protein               105   2e-24   
ref|XP_006380963.1|  hypothetical protein POPTR_0006s03130g           92.0    1e-19   
ref|XP_001778077.1|  predicted protein                                85.5    7e-17   
ref|XP_004987204.1|  PREDICTED: syntaxin-52-like                      81.6    1e-15   
ref|XP_001751913.1|  Qc-SNARE, SYP5 family                            80.1    5e-15   
ref|XP_006399472.1|  hypothetical protein EUTSA_v10015786mg           76.6    4e-14   
ref|NP_683311.2|  putative syntaxin-type t-SNARE protein              72.8    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAM52319.1|AC105363_8  Hypothetical protein                        72.8    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465967.1|  hypothetical protein SORBIDRAFT_01g049130        71.6    5e-12   Sorghum bicolor [broomcorn]
ref|XP_011398897.1|  Syntaxin-52                                      70.5    1e-11   Auxenochlorella protothecoides
ref|XP_006650984.1|  PREDICTED: syntaxin-52-like                      67.4    9e-11   
ref|XP_005649717.1|  Qc-snare protein, Syn8/Syntaxin8-family          67.4    1e-10   Coccomyxa subellipsoidea C-169
ref|XP_005850452.1|  hypothetical protein CHLNCDRAFT_59611            66.2    3e-10   Chlorella variabilis
gb|EAY88317.1|  hypothetical protein OsI_09776                        66.6    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004363668.1|  hypothetical protein CAOG_03940                  62.0    1e-08   Capsaspora owczarzaki ATCC 30864
gb|KIZ07812.1|  Syntaxin-51                                           61.2    2e-08   Monoraphidium neglectum
ref|XP_010646520.1|  PREDICTED: syntaxin-52-like                      62.0    3e-08   Vitis vinifera
ref|XP_002730935.1|  PREDICTED: syntaxin-8-like                       59.3    1e-07   Saccoglossus kowalevskii
gb|ABR25694.1|  syntaxin 51                                           58.2    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004206098.1|  PREDICTED: syntaxin-8-like                       57.8    4e-07   Hydra vulgaris
gb|KDD75355.1|  hypothetical protein H632_c726p1                      56.2    7e-07   Helicosporidium sp. ATCC 50920
gb|KJB26468.1|  hypothetical protein B456_004G245700                  55.8    1e-06   Gossypium raimondii
gb|KHG02271.1|  Syntaxin-52 -like protein                             54.3    4e-06   Gossypium arboreum [tree cotton]
ref|XP_007030625.1|  Syntaxin of plants 52, putative isoform 2        51.6    4e-05   
ref|XP_002531208.1|  syntaxin, putative                               50.8    4e-05   
ref|XP_010041363.1|  PREDICTED: uncharacterized protein LOC104430313  50.4    1e-04   Eucalyptus grandis [rose gum]
ref|XP_003064731.1|  predicted protein                                51.2    1e-04   Micromonas pusilla CCMP1545
ref|XP_002970090.1|  hypothetical protein SELMODRAFT_441012           48.5    7e-04   Selaginella moellendorffii
gb|KJB62825.1|  hypothetical protein B456_009G444600                  47.4    8e-04   Gossypium raimondii



>ref|XP_011097825.1| PREDICTED: syntaxin-51-like [Sesamum indicum]
Length=235

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAASGDSWVREYNEAV+LADDITNMISERSSLP TG EAQRHSSAIRRKITILGTRLDSL
Sbjct  3    MAASGDSWVREYNEAVRLADDITNMISERSSLPATGPEAQRHSSAIRRKITILGTRLDSL  62

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQPLTEKE+NRRKDM+A LRSK NQMASTLNMSNFAN
Sbjct  63   QSLLSKLPGKQPLTEKEMNRRKDMVANLRSKVNQMASTLNMSNFAN  108



>ref|XP_011095474.1| PREDICTED: syntaxin-52-like [Sesamum indicum]
Length=233

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAASGDSWVREYNEAVKLADDIT+MISERSSLP TG EAQRHSSAIRRKITILGTRLDSL
Sbjct  1    MAASGDSWVREYNEAVKLADDITSMISERSSLPATGPEAQRHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ LTEKE+NRR DM+A LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPGKQSLTEKEMNRRADMVANLRSKVNQMASTLNMSNFAN  106



>ref|XP_009786725.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786781.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786839.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786902.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
Length=233

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW+REYNEA+K+ADDITNMISERSSLP +G EAQRHSSAIRRKITILGTRLD+L
Sbjct  1    MASSGDSWIREYNEALKIADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLDNL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQPLTEKE+NRRKDMLA L+SK  QMASTLNMS+FAN
Sbjct  61   QSLLSKLPGKQPLTEKEMNRRKDMLANLKSKVTQMASTLNMSSFAN  106



>ref|XP_010324299.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum lycopersicum]
Length=238

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L+ MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKITILGTRL
Sbjct  3    LQVMASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRL  62

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            D+L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FAN
Sbjct  63   DNLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFAN  111



>ref|XP_006346178.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum tuberosum]
Length=238

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L+ MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKITILGTRL
Sbjct  3    LQVMASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRL  62

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            D+L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FAN
Sbjct  63   DNLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFAN  111



>ref|XP_006346179.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum tuberosum]
Length=233

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKITILGTRLD+L
Sbjct  1    MASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLDNL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FAN
Sbjct  61   QSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFAN  106



>ref|XP_009591371.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591379.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591390.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591398.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591404.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
Length=233

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW+REYNEA+K+ADDITNMISE+SSLP +G E QRHSSAIRRKITILGTRLD+L
Sbjct  1    MASSGDSWIREYNEALKIADDITNMISEKSSLPASGPEVQRHSSAIRRKITILGTRLDNL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQPLTEKE+NRRKDMLA L+SK  QMASTLNMS+FAN
Sbjct  61   QSLLSKLPGKQPLTEKEMNRRKDMLANLKSKVTQMASTLNMSSFAN  106



>ref|XP_004244081.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum lycopersicum]
Length=233

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKITILGTRLD+L
Sbjct  1    MASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLDNL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FAN
Sbjct  61   QSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFAN  106



>gb|EYU27391.1| hypothetical protein MIMGU_mgv1a013014mg [Erythranthe guttata]
Length=233

 Score =   186 bits (471),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAA GDSWVREYNEAVKLADDITNMISERSSLP TG EAQRHSSAIRRKITILGTRLDSL
Sbjct  1    MAAPGDSWVREYNEAVKLADDITNMISERSSLPATGPEAQRHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            +SL SKLP KQ L+EKE+NRR+DM+A LRSK  QMAS LNMSNFA
Sbjct  61   QSLFSKLPGKQSLSEKEMNRRRDMVANLRSKVTQMASALNMSNFA  105



>ref|XP_009625654.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625655.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
Length=250

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L+ MA+SGDSW+REYNEAVKL DDI NMISERSSLP TG EAQRHSS+IRRKITILGTRL
Sbjct  15   LQGMASSGDSWIREYNEAVKLTDDIGNMISERSSLPATGPEAQRHSSSIRRKITILGTRL  74

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            DSL+S+ S LP KQ LTEKE+NRRKDMLA L+SKA QMASTLNMSNFAN
Sbjct  75   DSLQSIDSNLPGKQRLTEKEMNRRKDMLANLKSKATQMASTLNMSNFAN  123



>ref|XP_006452473.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 ref|XP_006474986.1| PREDICTED: syntaxin-51-like [Citrus sinensis]
 gb|ESR65713.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 gb|KDO62148.1| hypothetical protein CISIN_1g026774mg [Citrus sinensis]
Length=233

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA++ DSW++EYNEA+KLADDI  MISERSS+P +G E+QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQP++EKE+NRRKDMLA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFAN  106



>ref|XP_009625656.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana tomentosiformis]
Length=233

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW+REYNEAVKL DDI NMISERSSLP TG EAQRHSS+IRRKITILGTRLDSL
Sbjct  1    MASSGDSWIREYNEAVKLTDDIGNMISERSSLPATGPEAQRHSSSIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S+ S LP KQ LTEKE+NRRKDMLA L+SKA QMASTLNMSNFAN
Sbjct  61   QSIDSNLPGKQRLTEKEMNRRKDMLANLKSKATQMASTLNMSNFAN  106



>emb|CDP13772.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGD WV+EYNEAVKLADDITNMISER+SLP TG EAQRH+SAIRRKITIL TRL+SL
Sbjct  1    MASSGDPWVKEYNEAVKLADDITNMISERNSLPATGPEAQRHASAIRRKITILSTRLESL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+LP KQ LTEKE+NRRKDMLA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSRLPGKQ-LTEKEMNRRKDMLANLRSKVNQMASTLNMSNFAN  105



>ref|XP_009765136.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana sylvestris]
Length=250

 Score =   181 bits (458),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L+ MA+SGDSW+REYNEAVKL DDI NMISERSSL TTG EAQRHSS+IRRKITILGTRL
Sbjct  15   LQGMASSGDSWIREYNEAVKLTDDIGNMISERSSLSTTGPEAQRHSSSIRRKITILGTRL  74

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            DSL+S+ SKLP  + LT+KE+NRRKDMLA L+SKA QMASTLNMSNFAN
Sbjct  75   DSLQSIDSKLPGMERLTKKEMNRRKDMLANLKSKATQMASTLNMSNFAN  123



>ref|XP_006595709.1| PREDICTED: syntaxin-51-like [Glycine max]
 gb|KHN23883.1| Syntaxin-51 [Glycine soja]
Length=232

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEA+KLADDI+ MISE+SS P +G E Q HSSAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEALKLADDISGMISEQSSFPASGPETQHHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQP++EKE+NRRKDML+ LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPGKQPISEKEMNRRKDMLSNLRSKVNQMASTLNMSNFAN  106



>gb|ACU19604.1| unknown [Glycine max]
Length=232

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEA+KLADDI+ MISE+SS P +G E Q HSSAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEALKLADDISGMISEQSSFPASGPETQHHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQP++EKE+NRRKDML+ LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPGKQPISEKEMNRRKDMLSNLRSKVNQMASTLNMSNFAN  106



>ref|XP_004491441.1| PREDICTED: syntaxin-52-like isoform X2 [Cicer arietinum]
Length=198

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA++ D WV+EYNEA+KL DDI++MISE+SS P +G EAQR SSAIRRKITILGTRLDSL
Sbjct  1    MASNSDQWVKEYNEALKLGDDISSMISEQSSFPASGPEAQRQSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQPL+EKE+NRRKDMLA LRSK NQMAS+LNMSNFAN
Sbjct  61   QSLLSKLPGKQPLSEKEMNRRKDMLANLRSKVNQMASSLNMSNFAN  106



>ref|XP_010246481.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
 ref|XP_010246482.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
Length=233

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE++EA KLADDI  MISERSS P +G E QRHSSAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMREFSEASKLADDINGMISERSSFPPSGPETQRHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP+KQP+TEKE++RR+DMLA L+SKANQMASTLNMSNFAN
Sbjct  61   QSLLSKLPSKQPITEKEMHRRQDMLANLKSKANQMASTLNMSNFAN  106



>ref|XP_004491440.1| PREDICTED: syntaxin-52-like isoform X1 [Cicer arietinum]
Length=232

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA++ D WV+EYNEA+KL DDI++MISE+SS P +G EAQR SSAIRRKITILGTRLDSL
Sbjct  1    MASNSDQWVKEYNEALKLGDDISSMISEQSSFPASGPEAQRQSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQPL+EKE+NRRKDMLA LRSK NQMAS+LNMSNFAN
Sbjct  61   QSLLSKLPGKQPLSEKEMNRRKDMLANLRSKVNQMASSLNMSNFAN  106



>ref|XP_009765138.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana sylvestris]
Length=233

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW+REYNEAVKL DDI NMISERSSL TTG EAQRHSS+IRRKITILGTRLDSL
Sbjct  1    MASSGDSWIREYNEAVKLTDDIGNMISERSSLSTTGPEAQRHSSSIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S+ SKLP  + LT+KE+NRRKDMLA L+SKA QMASTLNMSNFAN
Sbjct  61   QSIDSKLPGMERLTKKEMNRRKDMLANLKSKATQMASTLNMSNFAN  106



>ref|XP_010647220.1| PREDICTED: syntaxin-51-like [Vitis vinifera]
Length=233

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EY EA KLADDI  MISER SLPT+G+E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWIKEYYEASKLADDIYGMISERISLPTSGSETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL KLP KQP+TEKE+NRRKDML+ LRSK +QMASTLNMSNFAN
Sbjct  61   QSLLLKLPGKQPITEKEMNRRKDMLSNLRSKVSQMASTLNMSNFAN  106



>ref|XP_002277100.1| PREDICTED: syntaxin-51 [Vitis vinifera]
 emb|CBI26707.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS DSW++EYN+AVKLADDI  MISER S    G +AQRH+SAIRRKITILGTRLDSL+S
Sbjct  2    ASSDSWMKEYNDAVKLADDINGMISERISFSAPGVDAQRHASAIRRKITILGTRLDSLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLSKLP KQPLTEKE+NRRKDM+A L+SKANQMASTLNMSNFAN
Sbjct  62   LLSKLPGKQPLTEKEMNRRKDMVANLKSKANQMASTLNMSNFAN  105



>ref|XP_010099994.1| hypothetical protein L484_014031 [Morus notabilis]
 gb|EXB81099.1| hypothetical protein L484_014031 [Morus notabilis]
Length=223

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +1

Query  259  SGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESL  438
            +GDSWV+EYNEA+KLADDI  MISERSSL  +G E QRH+SAIRRKITILGTRLD L+S+
Sbjct  2    AGDSWVKEYNEAMKLADDINGMISERSSLHASGPETQRHASAIRRKITILGTRLDGLQSI  61

Query  439  LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            L+KLP KQP++EKE+NRRKDMLA LRSK NQMAS LNMSNFAN
Sbjct  62   LTKLPGKQPISEKEMNRRKDMLANLRSKVNQMASALNMSNFAN  104



>ref|XP_010245902.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245903.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245904.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
Length=233

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++E++EA KLADDI  MISER S P +G E QRHSSAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEFSEASKLADDINGMISERGSFPPSGPETQRHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S+LSKLP+KQP+TEKE++RR+DMLA  RSKANQMASTLNMSNFAN
Sbjct  61   QSILSKLPSKQPITEKEMHRRQDMLANFRSKANQMASTLNMSNFAN  106



>ref|XP_010537838.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
 ref|XP_010537839.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
Length=233

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWVREYNEA+KL++DI  MIS+RSS   +G EAQRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVREYNEALKLSEDINGMISQRSSSAVSGPEAQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+K+P KQP++EKE+NRRKDM+  LRSKANQMAS LNMSNFAN
Sbjct  61   QSLLAKIPGKQPISEKEMNRRKDMIGNLRSKANQMASALNMSNFAN  106



>ref|XP_006602182.1| PREDICTED: syntaxin-52-like isoform X2 [Glycine max]
Length=251

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 3/108 (3%)
 Frame = +1

Query  244  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLD  423
            + MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKITILGTRLD
Sbjct  21   RVMASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLD  80

Query  424  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SL+SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFAN
Sbjct  81   SLQSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFAN  125



>gb|KJB22166.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=141

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFAN
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFAN  105



>ref|XP_007146536.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
 gb|ESW18530.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
Length=229

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK+P K   TEKE+NRRKDML  LR+K NQMASTLNMSNFAN
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLGNLRTKVNQMASTLNMSNFAN  103



>gb|KJB81689.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=141

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  105



>ref|XP_003551745.1| PREDICTED: syntaxin-52-like isoform X1 [Glycine max]
Length=229

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFAN
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFAN  103



>gb|ACU23148.1| unknown [Glycine max]
Length=229

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFAN
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFAN  103



>gb|KDP39206.1| hypothetical protein JCGZ_00963 [Jatropha curcas]
Length=233

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEAVKLADDI+ MISERSS P +G E QRH SAIRRKITILGTRLDSL
Sbjct  1    MASSADPWMKEYNEAVKLADDISGMISERSSFPASGPETQRHGSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+KLP KQ ++EKE+NRRKDM+A LR+K NQMAS+LNMSNFA+
Sbjct  61   QSLLTKLPGKQQVSEKEMNRRKDMVANLRTKVNQMASSLNMSNFAH  106



>gb|KJB22167.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=152

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFAN
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFAN  105



>gb|KJB81687.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81688.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=150

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  105



>gb|KJB22169.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=196

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFAN
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFAN  105



>gb|KJB22168.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=190

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFAN
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFAN  105



>gb|KHN30881.1| Syntaxin-51 [Glycine soja]
Length=229

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK+P K   TEKE+NRRKDML  LR+K NQMASTLNMSNFAN
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLLNLRTKVNQMASTLNMSNFAN  103



>gb|KHG18509.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=223

 Score =   170 bits (430),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPVSGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFAN
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFAN  105



>gb|AFK40726.1| unknown [Lotus japonicus]
Length=233

 Score =   170 bits (430),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEAVKLADDI+ MISERSS   +G EAQRHSSAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAVKLADDISTMISERSSSVESGPEAQRHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP  KQP++EKE+NRRKDMLA+LRS+ N+MASTL+M NF+N
Sbjct  61   QSLLSKLPAGKQPVSEKELNRRKDMLASLRSRVNEMASTLSMPNFSN  107



>gb|KJB81686.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=190

 Score =   169 bits (427),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  105



>gb|AFK34174.1| unknown [Lotus japonicus]
Length=233

 Score =   170 bits (430),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEAVKLADDI+ MISERSS   +G EAQRHSSAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAVKLADDISTMISERSSSVESGPEAQRHSSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP  KQP++EKE+NRRKDMLA+LRS+ N+MASTL+M NF+N
Sbjct  61   QSLLSKLPAGKQPVSEKELNRRKDMLASLRSRVNEMASTLSMPNFSN  107



>gb|KJB81691.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=195

 Score =   168 bits (426),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  105



>gb|KHG11788.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=238

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  61   QSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  105



>gb|KJB22165.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=231

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFAN
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFAN  105



>ref|XP_007142350.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 ref|XP_007142351.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14344.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14345.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
Length=232

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S +SW++EYNEA+KL+DDI+ MISE+SS   +G E QRHS+AIRRKITILGTRLDSL
Sbjct  1    MASSSNSWMKEYNEALKLSDDISGMISEQSSFSASGPEIQRHSTAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK P KQP++EKE+NRRKDMLA+LRS+ NQMASTLNMSNF+N
Sbjct  61   QSLLSKFPGKQPISEKEMNRRKDMLASLRSRVNQMASTLNMSNFSN  106



>gb|KJB81690.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81692.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=231

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  105



>ref|XP_006344878.1| PREDICTED: syntaxin-52-like [Solanum tuberosum]
Length=238

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L+ M A GDSW++EYNEA KLADDI  MISER+ LP TG EAQRHSS IRRKITILG RL
Sbjct  3    LQGMVAFGDSWIQEYNEAGKLADDIIYMISERNLLPATGPEAQRHSSLIRRKITILGFRL  62

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            D L+S+ SKLP KQ LTEKE+NRRKDMLA L+SKA +MASTLNMSNFAN
Sbjct  63   DILQSIDSKLPGKQHLTEKEMNRRKDMLANLKSKAAEMASTLNMSNFAN  111



>gb|KGN56069.1| hypothetical protein Csa_3G064180 [Cucumis sativus]
Length=230

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M A  D W++EYNEA KL DDI  MISERSS P TG E+QRH+SAIRRKITILGT++D L
Sbjct  1    MMAPSDLWIKEYNEASKLGDDINGMISERSSFPATGPESQRHASAIRRKITILGTKVDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL KLP KQPL+EKEINRRKDML  +RSK  QMASTLNMSNFAN
Sbjct  61   QSLLLKLPVKQPLSEKEINRRKDMLVQMRSKVKQMASTLNMSNFAN  106



>ref|XP_004149588.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
 ref|XP_004161879.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
Length=233

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M A  D W++EYNEA KL DDI  MISERSS P TG E+QRH+SAIRRKITILGT++D L
Sbjct  1    MMAPSDLWIKEYNEASKLGDDINGMISERSSFPATGPESQRHASAIRRKITILGTKVDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL KLP KQPL+EKEINRRKDML  +RSK  QMASTLNMSNFAN
Sbjct  61   QSLLLKLPVKQPLSEKEINRRKDMLVQMRSKVKQMASTLNMSNFAN  106



>ref|XP_010532045.1| PREDICTED: syntaxin-51-like isoform X2 [Tarenaya hassleriana]
Length=234

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPT-TGTEAQRHSSAIRRKITILGTRLDS  426
            MA+S DSWVREYNEA+KL++DI  MISERSSL   +G EAQRH+SAIRRKITILGTRLDS
Sbjct  1    MASSSDSWVREYNEALKLSEDINGMISERSSLAVVSGPEAQRHASAIRRKITILGTRLDS  60

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            L+SLL+K+P KQP++EKE+NRRKDM++ LRSKA+QMAS LN+SNFAN
Sbjct  61   LQSLLAKIPGKQPISEKEMNRRKDMISNLRSKASQMASALNVSNFAN  107



>ref|XP_010532042.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532044.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
Length=235

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPT-TGTEAQRHSSAIRRKITILGTRLDS  426
            MA+S DSWVREYNEA+KL++DI  MISERSSL   +G EAQRH+SAIRRKITILGTRLDS
Sbjct  1    MASSSDSWVREYNEALKLSEDINGMISERSSLAVVSGPEAQRHASAIRRKITILGTRLDS  60

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            L+SLL+K+P KQP++EKE+NRRKDM++ LRSKA+QMAS LN+SNFAN
Sbjct  61   LQSLLAKIPGKQPISEKEMNRRKDMISNLRSKASQMASALNVSNFAN  107



>gb|KHM99515.1| Syntaxin-51 [Glycine soja]
Length=234

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            + AS DSW++EYNEAVKLADDI  MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  6    LMASSDSWMKEYNEAVKLADDINGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  65

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK+P K   TEKE+NRRKDMLA LR+K NQMASTLNMSNFAN
Sbjct  66   QSLLSKVPAK---TEKEMNRRKDMLANLRTKVNQMASTLNMSNFAN  108



>gb|AFK42434.1| unknown [Lotus japonicus]
Length=149

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W++EYNEA+KLADDI +MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDTWMKEYNEAMKLADDINSMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDTLANLRSKVNQMASTLNMSNFAN  103



>ref|XP_007020671.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 ref|XP_007020673.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12196.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12198.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
Length=231

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WV+EYNEAVK+ADDI  MIS+RSSLP +G E QRH+SAIRRKITILGTRLD L
Sbjct  1    MASSSDPWVKEYNEAVKIADDINGMISDRSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFA+
Sbjct  61   QSLLSR-PTGRPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAS  105



>ref|XP_003532151.1| PREDICTED: syntaxin-51-like isoform X1 [Glycine max]
 ref|XP_006586106.1| PREDICTED: syntaxin-51-like isoform X2 [Glycine max]
Length=228

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS DSW++EYNEAVKLADDI  MISERSS P +G E QRH+SAIRRKITILGTRLDSL+S
Sbjct  2    ASSDSWMKEYNEAVKLADDINGMISERSSFPASGPETQRHASAIRRKITILGTRLDSLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLSK+P K   TEKE+NRRKDMLA LR+K NQMASTLNMSNFAN
Sbjct  62   LLSKVPAK---TEKEMNRRKDMLANLRTKVNQMASTLNMSNFAN  102



>gb|AHA84215.1| syntaxin-51 [Phaseolus vulgaris]
Length=359

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S +SW++EYNEA+KLADDI+ M+SE+SS P +G E QRHS+AIRRKITIL TRLDSL
Sbjct  128  MASSSNSWMKEYNEALKLADDISGMVSEQSSFPASGPEIQRHSTAIRRKITILCTRLDSL  187

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK P KQP++EKE+NRRKDMLA+LRS+ NQMASTLNMSNF+N
Sbjct  188  QSLLSKFPGKQPISEKEMNRRKDMLASLRSRVNQMASTLNMSNFSN  233



>gb|AAZ32890.1| syntaxin of plants [Medicago sativa]
Length=133

 Score =   164 bits (415),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  103



>ref|XP_008449105.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449106.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449108.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449109.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=231

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            A  D W++EYNEA KL DDI  MISERSS P TG E+QRH+SAIRRKITILGT++D L+S
Sbjct  2    APSDLWIKEYNEASKLGDDINGMISERSSFPATGPESQRHASAIRRKITILGTKVDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLSKLP KQPL+EKEINRRKDML  +RS+  QMASTLNMSNFAN
Sbjct  62   LLSKLPVKQPLSEKEINRRKDMLIQMRSEVKQMASTLNMSNFAN  105



>gb|ACJ84463.1| unknown [Medicago truncatula]
Length=194

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  103



>gb|EPS71742.1| hypothetical protein M569_03017, partial [Genlisea aurea]
Length=245

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            A  GDSWVREYNEA+KLADDITNMI ERSS+P TG EAQRHSSAIRRKITILGTRLDSL 
Sbjct  1    AVHGDSWVREYNEAIKLADDITNMIHERSSVPATGPEAQRHSSAIRRKITILGTRLDSLS  60

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             + ++ P  Q L+EKE+NRR+D+++ LRSK NQMA++LNMSNFAN
Sbjct  61   QVSARSPGNQSLSEKELNRRRDLVSGLRSKVNQMAASLNMSNFAN  105



>ref|XP_010909005.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=232

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE NEA KLADDI+ MISER SLP +G + QRH+SAIRRKITILGT+LDSL
Sbjct  1    MASSSDSWLRELNEASKLADDISAMISERGSLPPSGPDTQRHTSAIRRKITILGTKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLLSKLP+KQP+++KE+ +R+DML+ LRSKA QMASTLNMSNFAN
Sbjct  61   ESLLSKLPSKQPISDKELLKRQDMLSNLRSKAKQMASTLNMSNFAN  106



>gb|AFK40910.1| unknown [Lotus japonicus]
Length=229

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W++EYNEA+KLADDI +MISERSS P +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDTWMKEYNEAMKLADDINSMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDTLANLRSKVNQMASTLNMSNFAN  103



>ref|XP_003617659.1| Syntaxin-51 [Medicago truncatula]
 gb|AET00618.1| syntaxin of plants protein [Medicago truncatula]
Length=167

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+WV+EYNEA KLA+DI++M+SE SS P +G EAQR SS+ R+KITILGTRLDSL+S
Sbjct  2    ASSDAWVKEYNEATKLAEDISSMVSEWSSCPASGPEAQRQSSSTRKKITILGTRLDSLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLSKLP KQPL+EKE NRR DMLA LRSK NQMASTLNMSNFAN
Sbjct  62   LLSKLPGKQPLSEKEENRRMDMLANLRSKVNQMASTLNMSNFAN  105



>ref|XP_004500114.1| PREDICTED: syntaxin-52-like [Cicer arietinum]
Length=229

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA+KLADDI+ MISE +S PT+G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAMKLADDISGMISEHTSFPTSGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  103



>gb|KEH18882.1| syntaxin of plants protein [Medicago truncatula]
Length=229

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  103



>ref|XP_008787642.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=232

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE NEA KLADDI+ MISER SLP +G + QRH+SAIRRKITILGT+LDSL
Sbjct  1    MASSSDSWLRELNEASKLADDISAMISERGSLPPSGPDTQRHTSAIRRKITILGTKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            ESLLSKLP+KQP++ KE+++R+DML+ LRSKA QMASTLNMSNFA
Sbjct  61   ESLLSKLPSKQPISNKELHKRRDMLSNLRSKAKQMASTLNMSNFA  105



>gb|KJB11950.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=140

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|KJB11948.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=142

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|KJB11949.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=149

 Score =   162 bits (410),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|KHG00459.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=237

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|AFK34675.1| unknown [Medicago truncatula]
Length=229

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  103



>ref|XP_003600182.1| Syntaxin-52 [Medicago truncatula]
Length=233

 Score =   164 bits (416),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRLDSL
Sbjct  5    MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  64

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  65   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  107



>gb|ABI84247.1| syntaxin [Arachis hypogaea]
Length=152

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVKLADDI  MISERSSL T+G EAQRH+SAIRRKITILG RLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDINGMISERSSLSTSGPEAQRHASAIRRKITILGIRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK+P K   +EKE+NRR++ L TLRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKVPGK---SEKEMNRRRETLTTLRSKVNQMASTLNMSNFAN  103



>gb|KJB11947.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=151

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|AES70433.2| syntaxin of plants protein [Medicago truncatula]
Length=261

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 3/109 (3%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L  MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRL
Sbjct  30   LLQMASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRL  89

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            DSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFAN
Sbjct  90   DSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFAN  135



>gb|KJB11954.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=192

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|KJB11946.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11951.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11952.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11953.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=230

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKITILGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFAN
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFAN  104



>gb|AFK35227.1| unknown [Medicago truncatula]
Length=229

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP K   +EKE+NR KD LA LRSK NQMASTLNMSNFAN
Sbjct  61   QSLLSKLPVK---SEKEMNRCKDNLANLRSKVNQMASTLNMSNFAN  103



>gb|ABK23110.1| unknown [Picea sitchensis]
Length=233

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSWV+E+NEA KLADDI   + ERSSLP +G E QRH SAIRRKITILGTRLDSL
Sbjct  1    MASSADSWVKEFNEASKLADDINARLGERSSLPPSGPETQRHLSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LL KLP++QP++EKE++RR+DML  LRSK+NQMAS LNMS F N
Sbjct  61   ENLLPKLPSRQPISEKELHRRQDMLVNLRSKSNQMASALNMSRFGN  106



>ref|XP_010940839.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940848.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940854.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=233

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++E+NEA KLADDIT MISER SLP +G E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSVDPWMKEFNEASKLADDITVMISERGSLPPSGPETQRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            ESLLSK P+ QP  +KE+ +R+DM+A L+SKA QMASTLNMSNF+
Sbjct  61   ESLLSKHPSTQPKMQKELQKRQDMVANLKSKAKQMASTLNMSNFS  105



>ref|XP_010675821.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=234

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            + SGDSW++EYN+A KLADDI  MISE++++  +G ++QRH SA+RRKITILGTRLDSLE
Sbjct  3    STSGDSWMKEYNDATKLADDINGMISEKTAMSGSGPDSQRHFSAVRRKITILGTRLDSLE  62

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SLLSK P+K+ +TEKE+N RKDML+ LR+K NQMA+TLNMSNFAN
Sbjct  63   SLLSKPPSKKSITEKELNHRKDMLSNLRTKTNQMATTLNMSNFAN  107



>ref|XP_007211870.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13069.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=232

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISERS+LP +G +AQR+ SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISERSTLPASGPDAQRYVSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM++TL  S+ AN
Sbjct  61   QSLLSKLPGKQPISEKELNRRKDMIGTLRSKVLQMSTTLT-SHSAN  105



>ref|XP_004151390.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 ref|XP_004156357.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 gb|KGN43995.1| hypothetical protein Csa_7G084710 [Cucumis sativus]
Length=233

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA + +SW +EYNEA+KL++DI  MISERSSL  +G EAQRH+SAIRRKITILGTRLD+L
Sbjct  1    MAYTLESWTKEYNEALKLSEDINGMISERSSLAASGPEAQRHASAIRRKITILGTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S L KL  KQP+ EKE+NRR+DM+  LRSKA QMASTLNMSNFAN
Sbjct  61   QSQLPKLQGKQPIPEKEMNRRRDMIGNLRSKAKQMASTLNMSNFAN  106



>emb|CDX88551.1| BnaC06g39950D [Brassica napus]
Length=233

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFAN  106



>ref|XP_006302763.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
 gb|EOA35661.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
Length=233

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+WVREYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWVREYNEALKLSEDINGMMSERNAAGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ +++KE+NRRKDM+A LRSK NQ+ASTLNMSNFAN
Sbjct  61   QSLLVKVPGKQNVSDKEMNRRKDMVANLRSKTNQVASTLNMSNFAN  106



>ref|XP_006389870.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 ref|XP_006389871.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27156.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27157.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
Length=233

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWIREYNEALKLSEDINAMMSERNSSALTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL KLP KQ ++EKE+NRRKDM+  LR KANQ+AS LNMSNFAN
Sbjct  61   QSLLVKLPGKQHVSEKEMNRRKDMVGNLRIKANQVASALNMSNFAN  106



>ref|XP_002887794.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64053.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWIREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKIPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>ref|XP_008447706.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=233

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA + +SW +EYNEA+KL++DI  MISERSSL  +G EAQRH+SAIRRKITILGTRLD+L
Sbjct  1    MAYTLESWTKEYNEALKLSEDINGMISERSSLAASGPEAQRHASAIRRKITILGTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S L KL  KQP+ EKE+NRR+DM+  LRSKA QMAS LNMSNFAN
Sbjct  61   QSQLPKLQGKQPIPEKEMNRRRDMIGNLRSKAKQMASALNMSNFAN  106



>ref|XP_008227024.1| PREDICTED: syntaxin-52-like [Prunus mume]
Length=232

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISER +LP +G + QR+ SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISERITLPASGPDTQRYVSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM+STL  S+ AN
Sbjct  61   QSLLSKLPGKQPISEKELNRRKDMIGTLRSKVVQMSSTLT-SHSAN  105



>ref|XP_008775700.1| PREDICTED: syntaxin-52-like isoform X2 [Phoenix dactylifera]
Length=222

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+ E NEA +LA+DI+ MISER SLP +G + Q H+S+IRRKITILGTRLDSL
Sbjct  1    MASSSDSWLWELNEASRLANDISAMISERGSLPPSGPDIQHHTSSIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLLSKLP+KQP+++KE+++ +DML+ LRSKA QMASTLNMS+FAN
Sbjct  61   ESLLSKLPSKQPISDKELHKCQDMLSNLRSKAKQMASTLNMSSFAN  106



>ref|XP_008775698.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
 ref|XP_008775699.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
Length=232

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+ E NEA +LA+DI+ MISER SLP +G + Q H+S+IRRKITILGTRLDSL
Sbjct  1    MASSSDSWLWELNEASRLANDISAMISERGSLPPSGPDIQHHTSSIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLLSKLP+KQP+++KE+++ +DML+ LRSKA QMASTLNMS+FAN
Sbjct  61   ESLLSKLPSKQPISDKELHKCQDMLSNLRSKAKQMASTLNMSSFAN  106



>ref|XP_008784838.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784839.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784840.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784841.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=233

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++E+NEA KLADDIT MISE  SLP +G E QRH+SAIRRKITILGTRLD+L
Sbjct  1    MASSVDPWIKEFNEASKLADDITVMISESGSLPPSGPETQRHTSAIRRKITILGTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            ESLLSK P+ QP  +KE+ +R+DM+A L+SKANQMAS LNMS+F+
Sbjct  61   ESLLSKHPSTQPKMQKELQKRQDMVANLKSKANQMASALNMSSFS  105



>ref|XP_009106789.1| PREDICTED: syntaxin-52-like [Brassica rapa]
Length=232

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDSL+S
Sbjct  2    ASSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LL K+P KQ ++EKE+NRRKDM+ +LRSKAN++AS LNMSNFAN
Sbjct  62   LLVKVPGKQHVSEKEMNRRKDMVGSLRSKANKVASALNMSNFAN  105



>emb|CDY68585.1| BnaAnng27700D [Brassica napus]
Length=236

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  247  AMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDS  426
            A ++S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDS
Sbjct  2    ASSSSSDTWMREYNEALKLSEDINGMMSERNSSALTGPDAQRRASAIRRKITILGTRLDS  61

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            L+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFAN
Sbjct  62   LQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFAN  108



>gb|AAM64357.1| unknown [Arabidopsis thaliana]
Length=233

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWIREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>ref|XP_009117773.1| PREDICTED: syntaxin-51-like [Brassica rapa]
Length=233

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            ++S DSW+REYNEA+KLA+DI  MISERS    TG +AQR +SAIRRKITI GTRLDSL+
Sbjct  3    SSSSDSWMREYNEALKLAEDINGMISERSKSALTGPDAQRRASAIRRKITIFGTRLDSLQ  62

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFAN
Sbjct  63   SLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFAN  106



>ref|XP_009128372.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 ref|XP_009128373.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 emb|CDY49743.1| BnaA02g19290D [Brassica napus]
Length=234

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            ++S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDSL+
Sbjct  3    SSSSDTWMREYNEALKLSEDINGMMSERNSSGLTGPDAQRRASAIRRKITILGTRLDSLQ  62

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFAN
Sbjct  63   SLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFAN  107



>emb|CDY52847.1| BnaA09g56390D [Brassica napus]
Length=233

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            ++S DSW+REYNEA+KLA+DI  MISERS    TG +AQR +SAIRRKITI GTRLDSL+
Sbjct  3    SSSSDSWMREYNEALKLAEDINGMISERSKSALTGPDAQRRASAIRRKITIFGTRLDSLQ  62

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFAN
Sbjct  63   SLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFAN  106



>ref|XP_009128371.1| PREDICTED: syntaxin-52 isoform X1 [Brassica rapa]
 ref|XP_009128374.1| PREDICTED: syntaxin-52 isoform X3 [Brassica rapa]
Length=236

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            ++S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDSL+
Sbjct  5    SSSSDTWMREYNEALKLSEDINGMMSERNSSGLTGPDAQRRASAIRRKITILGTRLDSLQ  64

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFAN
Sbjct  65   SLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFAN  109



>ref|NP_565213.1| syntaxin-52 [Arabidopsis thaliana]
 ref|NP_001031301.1| syntaxin-52 [Arabidopsis thaliana]
 sp|Q94KK7.1|SYP52_ARATH RecName: Full=Syntaxin-52; Short=AtSYP52 [Arabidopsis thaliana]
 gb|AAK40224.1|AF355756_1 syntaxin of plants 52 [Arabidopsis thaliana]
 gb|AAO41986.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04091.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36269.1| syntaxin-52 [Arabidopsis thaliana]
 gb|AEE36270.1| syntaxin-52 [Arabidopsis thaliana]
Length=233

 Score =   152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>gb|AFW61957.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=192

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L AMA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRL
Sbjct  42   LPAMASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRL  101

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            DSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFAN
Sbjct  102  DSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFAN  149



>emb|CDY33349.1| BnaC05g12340D [Brassica napus]
Length=232

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA+KLA+DI  MISER+    TG +AQR +SAIRRKITI GTRL+SL
Sbjct  1    MASSSDSWMREYNEALKLAEDINGMISERNKSSLTGPDAQRRASAIRRKITIFGTRLESL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMAS LNMSNFAN
Sbjct  61   HSLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMASVLNMSNFAN  105



>ref|XP_010472824.1| PREDICTED: syntaxin-52 [Camelina sativa]
Length=233

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ +++KE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>ref|XP_002892898.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69157.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYN+A+KL+++I  MISERSS   TG +AQR +SAIRRKITI GTRLDSL
Sbjct  1    MASSSDSWMREYNDALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+K+  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFAN
Sbjct  61   QSLLAKIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFAN  105



>gb|AAF68106.1|AC010793_1 F20B17.2 [Arabidopsis thaliana]
Length=260

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>ref|XP_009149057.1| PREDICTED: syntaxin-51 [Brassica rapa]
 emb|CDY35073.1| BnaA06g10830D [Brassica napus]
Length=232

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA+KLA+DI  MISER+    TG +AQR +SAIRRKITI GTRL+SL
Sbjct  1    MASSSDSWMREYNEALKLAEDINGMISERNKSSLTGPDAQRRASAIRRKITIFGTRLESL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+K+  K P++EKE+NRRKDM+  LRS+ANQMAS LNMSNFAN
Sbjct  61   QSLLAKIHGK-PISEKEMNRRKDMIGNLRSQANQMASALNMSNFAN  105



>ref|XP_008345031.1| PREDICTED: syntaxin-52-like isoform X3 [Malus domestica]
 ref|XP_008355319.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
Length=231

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWIREYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  59

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +N
Sbjct  60   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSN  104



>ref|XP_008345029.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
 ref|XP_008345030.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
 ref|XP_008355318.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
Length=240

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKITILGTRLDSL
Sbjct  10   MASSSDSWIREYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  68

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +N
Sbjct  69   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSN  113



>emb|CDX81754.1| BnaC08g38470D [Brassica napus]
Length=233

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNM-ISERSSLPTTGTEAQRHSSAIRRKITILGTRLDS  426
            MA+S DSW+REYNEA+KLA+DI  M ISERS    TG +AQR +SAIRRKITI GTRLDS
Sbjct  1    MASSSDSWMREYNEALKLAEDINGMMISERSKSAVTGPDAQRRASAIRRKITIFGTRLDS  60

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            L+SLL+K+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFAN
Sbjct  61   LQSLLAKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFAN  106



>ref|XP_011461087.1| PREDICTED: syntaxin-52-like [Fragaria vesca subsp. vesca]
Length=232

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEAVKL+DDI+ MISERSS P +G E QRH SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLSDDISGMISERSSFPASGPETQRHVSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
            +S LS LP KQ +T KE+NRRKDM+A L+SK +QM+STL
Sbjct  61   QSELSTLPGKQHITAKEMNRRKDMIANLKSKVSQMSSTL  99



>ref|XP_006304162.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 ref|XP_006304163.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37060.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37061.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
Length=232

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA+KL++DI  MISE SS   TG +AQRH+S IRRKIT+ GTRLDSL
Sbjct  1    MASSSDSWMREYNEALKLSEDINGMISEISSSAATGPDAQRHASLIRRKITMFGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +S+L+K+  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFAN
Sbjct  61   QSILAKIHGK-PISEKEMNRRKDMVGNLRSKANQMATALNMSNFAN  105



>ref|XP_010429855.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W+R+YNEA+KL++DI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWMRDYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ +++KE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>ref|XP_009416129.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416130.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W+RE+NEA KL++DI+ M+SER SLP +G + QRH +A+RRKITIL TRLDSL
Sbjct  1    MASSLDQWMREFNEASKLSEDISAMMSERGSLPPSGPDTQRHLTAMRRKITILRTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLLSKLP+ QP+ +K++++R++MLA ++SKANQMASTLNMSNF N
Sbjct  61   ESLLSKLPSMQPIKDKDLHKRQEMLANMKSKANQMASTLNMSNFGN  106



>ref|XP_009361064.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWIKEYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  59

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +N
Sbjct  60   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSN  104



>ref|XP_009361063.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKITILGTRLDSL
Sbjct  10   MASSSDSWIKEYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  68

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +N
Sbjct  69   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSN  113



>emb|CDX87371.1| BnaA07g35020D [Brassica napus]
Length=526

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFAN  106



>gb|ACF80713.1| unknown [Zea mays]
Length=148

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFAN  105



>ref|XP_004976388.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=231

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WV+EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWVKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLL+++P K  +T+KE+++R+DML+ L+SKA QMA++ NMSNFAN
Sbjct  61   ESLLTRIPPK-SITDKEMHKRQDMLSNLKSKAKQMATSFNMSNFAN  105



>gb|AFW61961.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=177

 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFAN  105



>gb|AFW61956.1| SNARE domain containing protein [Zea mays]
Length=275

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L AMA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRL
Sbjct  42   LPAMASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRL  101

Query  421  DSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            DSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFAN
Sbjct  102  DSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFAN  149



>gb|ACN36591.1| unknown [Zea mays]
Length=177

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFAN  105



>ref|XP_004249335.1| PREDICTED: syntaxin-51 [Solanum lycopersicum]
Length=231

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE+NEA KLAD++++MIS +SSLP++G E+QRH SA RRKITIL TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEVSSMISAKSSLPSSGPESQRHLSAARRKITILRTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL  LP+KQPL++KE+ RR DML  + +KANQMASTLNM+N AN
Sbjct  61   QSLLQTLPSKQPLSKKEMKRRHDMLDNMITKANQMASTLNMNNLAN  106



>ref|NP_001045701.1| Os02g0119400 [Oryza sativa Japonica Group]
 dbj|BAD08125.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAD07621.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF07615.1| Os02g0119400 [Oryza sativa Japonica Group]
 gb|EAZ21521.1| hypothetical protein OsJ_05145 [Oryza sativa Japonica Group]
 dbj|BAG95712.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87292.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WVREY+EA +LADD+T+MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWVREYSEASRLADDVTSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFAN
Sbjct  61   EALLSRIPPK-SITDKELHKRQDMLSNLKSRAKQMATSFNMSNFAN  105



>gb|EAY84230.1| hypothetical protein OsI_05611 [Oryza sativa Indica Group]
Length=232

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WVREY+EA +LADD+T+MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWVREYSEASRLADDVTSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFAN
Sbjct  61   EALLSRIPPK-SITDKELHKRQDMLSNLKSRAKQMATSFNMSNFAN  105



>ref|XP_010417628.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D+W+R+YNEA+KL+DDI  M+SER++   TG +AQR +SAIRRKITILGTRLDSL
Sbjct  1    MASSSDAWMRDYNEALKLSDDIHGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL K+P K  +++KE+NRRKDM+  LRSK NQ+AS LNMSNFAN
Sbjct  61   QSLLVKVPGKLNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFAN  106



>ref|XP_008676698.1| PREDICTED: uncharacterized protein LOC100217094 isoform X1 [Zea 
mays]
 gb|ACN34822.1| unknown [Zea mays]
 gb|AFW61959.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=196

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFAN  105



>ref|XP_009606725.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
 ref|XP_009606726.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
Length=231

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE+NEA KLAD+I +MIS R+SLP++G E QRH SA RRKITIL TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEIGSMISARNSLPSSGPETQRHLSAARRKITILKTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL  LP+KQPLT+KE+ RR DML  + +KANQMA+TLNM+N AN
Sbjct  61   QSLLPTLPSKQPLTKKEMKRRHDMLDNMITKANQMATTLNMNNLAN  106



>ref|XP_006646793.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WVREY EA +LADD+T+MI+ER SLP +G E  RH+S IRRKITILGTRLDSL
Sbjct  1    MASSPDPWVREYGEASRLADDVTSMIAERGSLPQSGPEIMRHTSGIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFAN
Sbjct  61   EALLSRVPPKS-ITDKELHKRQDMLSNLKSRAKQMATSFNMSNFAN  105



>ref|XP_009773941.1| PREDICTED: syntaxin-52-like [Nicotiana sylvestris]
Length=231

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE+NEA KLAD++ +MIS R+SLP++G E QRH SA RRKITIL TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEVGSMISARNSLPSSGPETQRHLSAARRKITILKTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL  LP+KQPLT+KE+ RR DML  + +KANQMA+TLNM+N AN
Sbjct  61   QSLLPTLPSKQPLTKKEMKRRHDMLDNMITKANQMATTLNMNNLAN  106



>ref|XP_008385825.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385826.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385827.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008359248.1| PREDICTED: syntaxin-52-like [Malus domestica]
Length=231

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  59

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN AN
Sbjct  60   QSLLSKLPGKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTAN  104



>ref|XP_007211871.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13070.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=262

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  271  WVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLSKL  450
            W++EYNEA KLADDI  MISERS+LP +G +AQR+ SAIRRKITILGTRLDSL+SLLSKL
Sbjct  38   WMKEYNEATKLADDINGMISERSTLPASGPDAQRYVSAIRRKITILGTRLDSLQSLLSKL  97

Query  451  PTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
            P KQP++EKE+NRRKDM+ TLRSK  QM++TL
Sbjct  98   PGKQPISEKELNRRKDMIGTLRSKVLQMSTTL  129



>gb|KCW66898.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=175

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKITIL TRLDSL
Sbjct  1    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A
Sbjct  61   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSA  104



>gb|KCW70251.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70252.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=177

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA S DSW++EYNEA KLADDI  MISE     ++G E QRH+S+IRRKITILGTRLDSL
Sbjct  1    MAYSADSWMKEYNEAAKLADDIGGMISEHDKSVSSGPENQRHASSIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSN  558
            +S+L+K+P  +P++EKE+NRR+DML++LR+K +QMAS LNMSN
Sbjct  61   QSVLTKMPGNRPISEKEMNRRRDMLSSLRTKKDQMASALNMSN  103



>ref|NP_001136935.1| uncharacterized protein LOC100217094 [Zea mays]
 gb|ACF82924.1| unknown [Zea mays]
 gb|AFW61960.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLLGRIPPK-SITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFAN  105



>ref|NP_001131944.1| uncharacterized protein LOC100193337 [Zea mays]
 gb|ACF80577.1| unknown [Zea mays]
Length=231

 Score =   147 bits (370),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFAN  105



>ref|XP_006339244.1| PREDICTED: syntaxin-51-like [Solanum tuberosum]
Length=231

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+RE+NEA KLAD++++MIS +SSLP++G E+QRH SA RRKITIL TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEVSSMISAKSSLPSSGPESQRHLSAARRKITILKTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL  LP+KQPL++KE+ RR DML  + +KANQ+A+TLNM+N AN
Sbjct  61   QSLLQTLPSKQPLSKKEMKRRHDMLDNMITKANQLATTLNMNNLAN  106



>gb|KCW66897.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=200

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKITIL TRLDSL
Sbjct  1    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A
Sbjct  61   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSA  104



>gb|ACG48507.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFAN
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFAN  105



>ref|XP_009407478.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   146 bits (369),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA S D W RE NEA KLA+DI+ MISER SLP +G + QRH +A+RRKITIL TRL+SL
Sbjct  1    MATSLDQWTRELNEASKLAEDISVMISERGSLPPSGPDTQRHLTAMRRKITILRTRLESL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ES+LSKLP+ QP+ +KE+N+R++MLA L+SKA+QMAS LNMSNF+N
Sbjct  61   ESILSKLPSLQPIKDKELNKRQEMLANLKSKADQMASELNMSNFSN  106



>ref|XP_006659260.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LLSK+P K  LT+KE+++R+D L+ L+SKA QMA++ NMSNFAN
Sbjct  61   EALLSKIPPK-TLTDKELHKRQDTLSNLKSKAKQMATSFNMSNFAN  105



>ref|XP_010060271.1| PREDICTED: syntaxin-51-like isoform X2 [Eucalyptus grandis]
Length=232

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKITIL TRLDSL
Sbjct  1    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A
Sbjct  61   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSA  104



>ref|XP_010063061.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 ref|XP_010063062.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 gb|KCW70249.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70250.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=233

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA S DSW++EYNEA KLADDI  MISE     ++G E QRH+S+IRRKITILGTRLDSL
Sbjct  1    MAYSADSWMKEYNEAAKLADDIGGMISEHDKSVSSGPENQRHASSIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSN  558
            +S+L+K+P  +P++EKE+NRR+DML++LR+K +QMAS LNMSN
Sbjct  61   QSVLTKMPGNRPISEKEMNRRRDMLSSLRTKKDQMASALNMSN  103



>gb|KCW66896.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=234

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKITIL TRLDSL
Sbjct  3    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  62

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A
Sbjct  63   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSA  106



>gb|ACG31926.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESL  ++P K  +T+KE+++R+DML++ +SKA QMA++ NMSNFAN
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSFKSKAKQMATSFNMSNFAN  105



>ref|XP_006416838.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 ref|XP_006416839.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35191.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35192.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
Length=232

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA+KL++DI  MISERS    TG +AQR +SAIRRKITI  TRL+SL
Sbjct  1    MASSSDSWMREYNEALKLSEDINGMISERSKSAVTGPDAQRRASAIRRKITIFSTRLESL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+KL  K P++EKE+NRRKDM+  LRS+ANQMA+ LNMSN AN
Sbjct  61   QSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMANALNMSNLAN  105



>ref|XP_010060270.1| PREDICTED: syntaxin-51-like isoform X1 [Eucalyptus grandis]
Length=242

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKITIL TRLDSL
Sbjct  11   MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  70

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A
Sbjct  71   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSA  114



>ref|NP_001077546.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29425.1| syntaxin-51 [Arabidopsis thaliana]
Length=228

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+R YNEA+KL+++I  MISERSS   TG +AQR +SAIRRKITI G +LDSL
Sbjct  1    MASSSDSWMRAYNEALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGNKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFAN
Sbjct  61   QSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFAN  105



>ref|NP_563994.1| syntaxin-51 [Arabidopsis thaliana]
 ref|NP_001031054.1| syntaxin-51 [Arabidopsis thaliana]
 sp|Q9SA23.1|SYP51_ARATH RecName: Full=Syntaxin-51; Short=AtSYP51 [Arabidopsis thaliana]
 gb|AAD34675.1|AC006341_3 ESTs gb|F15498, gb|H37515, gb|T41906, gb|T22448, gb|W43356 and 
gb|T20739 come from this gene [Arabidopsis thaliana]
 gb|AAK40223.1|AF355755_1 syntaxin of plants 51 [Arabidopsis thaliana]
 gb|AAL75885.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM19898.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM62551.1| unknown [Arabidopsis thaliana]
 dbj|BAH20194.1| AT1G16240 [Arabidopsis thaliana]
 gb|AEE29423.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29424.1| syntaxin-51 [Arabidopsis thaliana]
Length=232

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+R YNEA+KL+++I  MISERSS   TG +AQR +SAIRRKITI G +LDSL
Sbjct  1    MASSSDSWMRAYNEALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGNKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFAN
Sbjct  61   QSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFAN  105



>ref|XP_009343645.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343646.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK TILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  59

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN AN
Sbjct  60   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTAN  104



>ref|XP_009334173.1| PREDICTED: syntaxin-52-like isoform X3 [Pyrus x bretschneideri]
Length=231

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK TILGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  59

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN AN
Sbjct  60   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTAN  104



>ref|XP_009334172.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=240

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK TILGTRLDSL
Sbjct  10   MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  68

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN AN
Sbjct  69   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTAN  113



>ref|XP_009343644.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK TILGTRLDSL
Sbjct  10   MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  68

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN AN
Sbjct  69   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTAN  113



>ref|XP_006406341.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
 gb|ESQ47794.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
Length=215

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW+REYNEA+KL++DI  MISERS    TG +AQR +SAIRRKITI   RL+SL
Sbjct  1    MASSSDSWMREYNEALKLSEDINGMISERSKSAVTGPDAQRRASAIRRKITIFSIRLESL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+KL  K P++EKE+NRRKDM+  LRS+ANQM + LNMSN AN
Sbjct  61   QSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMVNALNMSNLAN  105



>ref|XP_009334171.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=287

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK TILGTRLDSL
Sbjct  57   MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  115

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN AN
Sbjct  116  QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTAN  160



>gb|EAZ06340.1| hypothetical protein OsI_28572 [Oryza sativa Indica Group]
Length=146

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKITIL TRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFAN
Sbjct  61   EALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFAN  105



>ref|XP_010476728.1| PREDICTED: syntaxin-51 [Camelina sativa]
Length=232

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M +S DSW++ YNEA+KL+++I  MISERSS   TG +AQR +SA+RRKITI GT+LDSL
Sbjct  1    MGSSSDSWMKAYNEALKLSEEINGMISERSSSAETGPDAQRRASALRRKITIFGTKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+++  K P++EKE+NRRKDM+  LRSK+NQMA+ LNMSNFAN
Sbjct  61   QSLLAQIHGK-PISEKEMNRRKDMVGNLRSKSNQMANALNMSNFAN  105



>ref|XP_010459159.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M +S DSW++ YNEA+KL+++I  M+SERSS   TG +AQR +SAIRRKIT+ GT+LDSL
Sbjct  1    MGSSSDSWMKAYNEALKLSEEINGMMSERSSSAETGPDAQRRASAIRRKITMFGTKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFAN
Sbjct  61   QSLLAQVHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFAN  105



>dbj|BAJ97107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WVRE+ EA +LADD+ +M+++R++LP +G EA RH+SAIRRKITILGTRLD+L
Sbjct  1    MASSADPWVREHGEAARLADDVASMVADRAALPQSGPEAMRHTSAIRRKITILGTRLDTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E +L++LP K  +T+KE+++R+DML+ L+S+A QMA + NMS FAN
Sbjct  61   EGMLARLPPK-SITDKELHKRRDMLSNLKSRAKQMAESFNMSTFAN  105



>ref|XP_007202519.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
 gb|EMJ03718.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
Length=230

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS DSW+RE+N+A KLAD+I  MIS RSSLP +G E QRH SA RRK+TIL T+L++L+S
Sbjct  2    ASPDSWMREFNDASKLADEINGMISGRSSLPPSGPETQRHMSATRRKVTILRTKLETLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLSKLP KQ +T KEINRRKDML  L SKA+QMA  LNMS+ AN
Sbjct  62   LLSKLPNKQSITGKEINRRKDMLTNLSSKADQMAIALNMSSLAN  105



>ref|XP_010497722.1| PREDICTED: syntaxin-51-like [Camelina sativa]
 ref|XP_010497725.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++ YNEA+KL+++I  M+SERSS   TG +AQR +SAIRRKIT+ GT+LDSL
Sbjct  1    MASSSDSWMKSYNEALKLSEEINGMMSERSSSAETGPDAQRRASAIRRKITMFGTKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+++  K P++EKE+NRRKDM+  LRSK+NQMA+ LNMSNFAN
Sbjct  61   QSLLAQIHGK-PVSEKEMNRRKDMVGNLRSKSNQMANALNMSNFAN  105



>ref|XP_008240610.1| PREDICTED: syntaxin-51-like [Prunus mume]
Length=230

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            AS DSW+RE+N+A KLAD+I  MIS RSSLP +G E QRH SA RRK+TIL T+L++L+S
Sbjct  2    ASPDSWMREFNDASKLADEINGMISGRSSLPPSGPETQRHMSATRRKVTILRTKLETLQS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LLSKLP KQ +T KEINRRKDML  L SKA+QMA  LNMS+ AN
Sbjct  62   LLSKLPNKQSITGKEINRRKDMLKNLSSKADQMAIALNMSSLAN  105



>gb|EMS60104.1| Syntaxin-51 [Triticum urartu]
Length=241

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D WVREY EA +LADD+ +M+++R++LP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSADPWVREYGEAARLADDVASMVADRAALPQSGPEVMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E +L++LP K  +T+KE+N+R+D L+ L+S+A QMA + NMS FAN
Sbjct  61   EGMLARLPPKS-ITDKELNKRRDTLSNLKSRAKQMAESFNMSTFAN  105



>ref|NP_001061436.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAC99744.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF23350.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAG93077.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKITIL TRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            E+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFAN
Sbjct  61   EALLSKIPPK-SLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFAN  105



>ref|XP_010673197.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  +SW+REYNEA KLADDI +M+SE S+LP TGT+ QRH SA RRKITIL T+L++L
Sbjct  1    MASLSESWMREYNEASKLADDINSMVSEASTLPATGTQTQRHFSATRRKITILNTKLENL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN  549
            ESLL+KLP+ Q +T KEINRR D+L  ++SK NQMA+TLN
Sbjct  61   ESLLAKLPSMQAITGKEINRRNDLLTNMKSKVNQMANTLN  100



>dbj|BAJ85147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95155.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS45154.1| Syntaxin-52 [Triticum urartu]
Length=232

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EY EA KL DDI++MI++RSSLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYTEASKLVDDISSMIADRSSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             +LLS++P K  LT+KE+++R+D L+ L+SKA QM ++ N+SNFAN
Sbjct  61   VTLLSRIPPK-SLTDKEMHKRQDALSNLKSKAKQMGTSFNVSNFAN  105



>ref|XP_008668816.1| PREDICTED: syntaxin-52-like [Zea mays]
Length=231

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIR   TILGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRXXXTILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNF N
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFTN  105



>gb|EEC83251.1| hypothetical protein OsI_28573 [Oryza sativa Indica Group]
Length=396

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  247  AMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDS  426
            AMA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKITIL TRLDS
Sbjct  164  AMASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDS  223

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFAN
Sbjct  224  LEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFAN  269



>gb|EEE68383.1| hypothetical protein OsJ_26713 [Oryza sativa Japonica Group]
Length=346

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  247  AMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDS  426
            AMA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKITIL TRLDS
Sbjct  114  AMASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDS  173

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFAN
Sbjct  174  LEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFAN  219



>gb|EMT28389.1| hypothetical protein F775_28894 [Aegilops tauschii]
Length=258

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W++EY EA KL DDI++MI++RSSLP +G E  RH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDPWMKEYTEASKLVDDISSMIADRSSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             +LLS++P K  LT+KE+++R+D L+ L+SKA QM ++ N+SNFAN
Sbjct  61   VTLLSRIPPKS-LTDKEMHKRQDALSNLKSKAKQMGTSFNVSNFAN  105



>ref|XP_009377637.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
 ref|XP_009377638.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
Length=234

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERSSLPTT--GTEAQRHSSAIRRKITILGTRLDSL  429
            AS DSW+RE+N+A KLAD+I  MIS RSSLP +  G E QRH SA RRK+TIL T+L++L
Sbjct  2    ASPDSWMREFNDASKLADEINGMISGRSSLPVSPSGPETQRHMSATRRKVTILRTKLETL  61

Query  430  ESLLSKLPTKQP--LTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
             SLLSKLPTKQ   +T KE+NRRKDMLA+L SKA+QMA+TLNMS+ AN
Sbjct  62   HSLLSKLPTKQKESITGKEMNRRKDMLASLSSKADQMATTLNMSSLAN  109



>ref|XP_006373682.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51479.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=243

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  247  AMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDS  426
            AM+    SW++E+NEA KL D+I  MIS ++SLP++G E QRH SA RRKITIL T+LD 
Sbjct  12   AMSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDI  71

Query  427  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            L+SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ AN
Sbjct  72   LQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAAN  118



>ref|XP_011041363.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M+    SW++E+NEA KL D+I  MIS ++SLP++G E QRH SA RRKITIL T+LD L
Sbjct  1    MSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ AN
Sbjct  61   QSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSVAN  106



>ref|XP_006373681.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51478.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=231

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M+    SW++E+NEA KL D+I  MIS ++SLP++G E QRH SA RRKITIL T+LD L
Sbjct  1    MSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ AN
Sbjct  61   QSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAAN  106



>ref|XP_007020672.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 ref|XP_007020674.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12197.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12199.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
Length=207

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +1

Query  322  MISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLSKLPTKQPLTEKEINRRKDM  501
            MIS+RSSLP +G E QRH+SAIRRKITILGTRLD L+SLLS+ PT +PLTEKE+NRRKDM
Sbjct  1    MISDRSSLPASGPETQRHASAIRRKITILGTRLDGLQSLLSR-PTGRPLTEKEMNRRKDM  59

Query  502  LATLRSKANQMASTLNMSNFAN  567
            +A LRSKANQMAS  NMSNFA+
Sbjct  60   VANLRSKANQMASAFNMSNFAS  81



>ref|XP_006373683.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
 gb|ERP51480.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
Length=231

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  + W++E+NEA KL D+I+NMIS ++SLP +G E QRH SAIRRK TIL T+LDSL
Sbjct  1    MASPSELWMQEFNEASKLGDEISNMISGKNSLPQSGPETQRHLSAIRRKATILTTKLDSL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL  LP KQP++ KEINRR++ML  L +K NQM++ LNM+  AN
Sbjct  61   QSLLLALPGKQPISGKEINRRQEMLKNLSTKVNQMSTALNMAGAAN  106



>gb|ABK92777.1| unknown [Populus trichocarpa]
Length=146

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA    SW++E+NEA KL D+I  MI+ ++SLP +G E QRH SA RRKI IL T+LD L
Sbjct  1    MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLN+S+ AN
Sbjct  61   QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAAN  106



>ref|XP_011040715.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011040716.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA    SW++E+NEA KL D+I  MI+ ++SLP +G E QRH SA RRKI IL T+LD L
Sbjct  1    MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLNMS+ AN
Sbjct  61   QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNMSSAAN  106



>ref|XP_002307951.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
 gb|EEE91474.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
Length=221

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA    SW++E+NEA KL D+I  MI+ ++SLP +G E QRH SA RRKI IL T+LD L
Sbjct  1    MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLN+S+ AN
Sbjct  61   QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAAN  106



>gb|ABK92902.1| unknown [Populus trichocarpa]
Length=231

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  +SW++E+NEA KL D+I+ MIS ++SLP +G E QR  SA RRK TIL T+LD L
Sbjct  1    MASPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPETQRQFSAARRKATILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS LP+KQPL+ KE+NRR++ML  L +K NQMAS LNM + AN
Sbjct  61   QSLLSALPSKQPLSGKEMNRRQEMLKNLSTKVNQMASALNMFSAAN  106



>ref|XP_011041367.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011041368.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  +SW++E+NEA KL D+I++MIS ++SLP +G E QRH SAIRRK TIL T+LD L
Sbjct  1    MASPSESWMQEFNEASKLGDEISDMISGKNSLPQSGPETQRHLSAIRRKATILTTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS LP+KQ ++ KEINRR++ML  L +K NQM++ L M+  AN
Sbjct  61   QSLLSALPSKQSISGKEINRRQEMLKNLSTKVNQMSTALKMAGAAN  106



>ref|XP_011040717.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            M++  +SW++E+NEA KL D+I+ MIS ++SLP +G + QR  SA RRK TIL T+LD L
Sbjct  1    MSSPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPDTQRQFSAARRKATILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLS LP+KQPL+ KE+NRR++ML  L +K NQMAS LNM + AN
Sbjct  61   QSLLSALPSKQPLSGKEMNRRQEMLKNLSTKVNQMASALNMFSAAN  106



>emb|CBI29594.3| unnamed protein product [Vitis vinifera]
Length=73

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S DSW++EY EA KLADDI  MIS+R SLPT+G+E QRH+SAIRRKITILGTRLDSL
Sbjct  1    MASSSDSWIKEYYEASKLADDINGMISQRISLPTSGSETQRHASAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPTKQPL  468
            +SLL KLP KQP+
Sbjct  61   QSLLLKLPGKQPM  73



>ref|XP_010111270.1| hypothetical protein L484_027923 [Morus notabilis]
 gb|EXC30748.1| hypothetical protein L484_027923 [Morus notabilis]
Length=182

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+S D W+RE ++A KLAD++ +MIS+RSSL  +G + QRH S  RRK+TIL T+L++L
Sbjct  1    MASSSDPWMRELSDASKLADEVRDMISQRSSLLPSGPQTQRHMSTARRKMTILRTKLETL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSKLP+KQ L+ KE NRR+DML  L  +A +MA TLNMS  A+
Sbjct  61   QSLLSKLPSKQILSAKETNRRRDMLDKLSVQAGEMAPTLNMSMSAD  106



>gb|KJB62826.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 14/106 (13%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  D+W++EYN+A+K+ADDI  MIS + SLP++G E QR             TRLD L
Sbjct  1    MASPSDTWIKEYNDAIKIADDINGMISGKGSLPSSGPETQR-------------TRLDGL  47

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +SLLSK  T +PLT+KE+NR KDM+  LRSK+NQMAS  NMSNFAN
Sbjct  48   QSLLSK-HTGKPLTDKEMNRCKDMVTNLRSKSNQMASAFNMSNFAN  92



>ref|XP_006836711.1| hypothetical protein AMTR_s00088p00114370 [Amborella trichopoda]
 gb|ERM99564.1| hypothetical protein AMTR_s00088p00114370 [Amborella trichopoda]
Length=83

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  DSW+RE+NEA KLADDI   I+ERSSLP +G E QRH SAIRRKITILGTRLDSL
Sbjct  1    MASPSDSWMREFNEASKLADDIGARIAERSSLPPSGPETQRHVSAIRRKITILGTRLDSL  60

Query  430  ESLLSKLPT  456
            ESLL+KLPT
Sbjct  61   ESLLAKLPT  69



>gb|AFW61958.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=124

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  241  LKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRL  420
            L AMA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKITILGTRL
Sbjct  42   LPAMASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRL  101

Query  421  DSLESLLSKLPTK  459
            DSLESLL ++P K
Sbjct  102  DSLESLLGRIPPK  114



>ref|XP_003573428.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233716.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233717.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
Length=231

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLS  444
            D W REY EA +LADD+  M++        G EA RH+SAIRRKITILGTRLDSLE  LS
Sbjct  7    DPWAREYGEAARLADDVGAMVAVGGG--GGGPEAMRHASAIRRKITILGTRLDSLEGSLS  64

Query  445  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            ++P K  +T+KE+++R+DML+ LRS+A QMAS+ NMS  AN
Sbjct  65   RVPPKS-ITDKELHKRQDMLSNLRSRAKQMASSFNMSTSAN  104



>gb|EYU33678.1| hypothetical protein MIMGU_mgv1a021393mg [Erythranthe guttata]
Length=230

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MAAS DSW +E +EA +LA++I+NMISERSS+P + TE+Q+H SAIR KI ILGT L+SL
Sbjct  1    MAASVDSWTKECDEAERLANEISNMISERSSMPNSSTESQQHLSAIRAKIVILGTMLESL  60

Query  430  ESLLSKLPT--KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +     LP+   +  T +E+  RKDM+  LR   N++   LNMSNFAN
Sbjct  61   Q---HSLPSALNESSTAEEMKIRKDMVTKLRLNVNEINYALNMSNFAN  105



>ref|NP_173073.2| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
 gb|AEE29422.1| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
Length=193

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  DSW+RE NE +KL+++I  MI ERSSL  T + A RH+S++RRKITIL TR+ +L
Sbjct  1    MASLCDSWIREQNETLKLSEEIDGMILERSSLAETSSYALRHASSMRRKITILATRVQTL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            + LL++   K  ++ KE++RRK     LRSKANQMAS L+M  F+N
Sbjct  61   KYLLAESQGK-SISGKEMSRRKGTFENLRSKANQMASALDMLKFSN  105



>ref|XP_006380963.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
 gb|ERP58760.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
Length=164

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA+  +SW++E+NEA KL D+I+ MIS ++SLP +G E QR  SA RRK TIL T+LD L
Sbjct  1    MASPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPETQRQFSAARRKATILRTKLDIL  60

Query  430  ESLLSKLPTKQPLTEKE  480
            +SLLS LP+KQPL   E
Sbjct  61   QSLLSALPSKQPLERDE  77



>ref|XP_001778077.1| predicted protein [Physcomitrella patens]
 gb|EDQ57083.1| predicted protein [Physcomitrella patens]
Length=223

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +1

Query  262  GDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLL  441
             DSW +E+ EAV+L +DI   I+E+++LP   +E+ R  S  RRK+ +L  +LD LESLL
Sbjct  2    ADSWTKEFQEAVRLTEDIEGRIAEKNALPPHSSESIRIVSVTRRKLAMLNNKLDRLESLL  61

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
                 K  L+EKE+ RR++ML  +R K+ QM+++L
Sbjct  62   QNGSLKSSLSEKELYRRQNMLVDIRYKSKQMSASL  96



>ref|XP_004987204.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=221

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTT-GTEAQRHSSAIRRKITILGTRLDSLESLL  441
            D W + + EA +L DD+   I+ER S+P +   + QR ++ IRRK+TILGTRLD L+  L
Sbjct  24   DQWTKRFQEAERLVDDVVERIAERDSVPPSLPRKLQRRTAEIRRKVTILGTRLDMLQEDL  83

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSN  558
            S LP KQ ++ K++N+  + L+ L SKA ++     M++
Sbjct  84   SDLPKKQNISLKQLNKLAEKLSGLSSKAKEVGGQFTMNH  122



>ref|XP_001751913.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
 gb|EDQ83348.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
Length=225

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +1

Query  262  GDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLL  441
             D+W RE++E   L ++I   I+E+++LP   +E+ R  S  RRK+ +L  +LD LESLL
Sbjct  2    ADAWAREFHETALLTEEIDGRIAEKNALPAHSSESIRVVSVSRRKLAVLNNKLDRLESLL  61

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
                 K  L EKE+NRR++ML  +R K  QM+ +L
Sbjct  62   QSDSLKSSLNEKELNRRQNMLVDIRFKFKQMSESL  96



>ref|XP_006399472.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
 gb|ESQ40925.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
Length=169

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  394  KITILGTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            +ITI   RL+SL+SLL+KL  K P++EKE+NRRKDM+  LRS+ANQMA+ LNMSN AN
Sbjct  3    EITIFSIRLESLQSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMANALNMSNLAN  59



>ref|NP_683311.2| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
 gb|AEE29421.1| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
Length=199

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +1

Query  322  MISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLSKLPTKQPLTEKEINRRKDM  501
            MI ERSSL  T + A+ H+S +RRKITIL   + +L++LL++   K  ++ KE++R KDM
Sbjct  1    MILERSSLAETSSYARGHASYMRRKITILANGVQTLKNLLAESQGK-SISAKEMSRCKDM  59

Query  502  LATLRSKANQMASTLNMSNFAN  567
            +  LRSKA QMAS L+M  F+N
Sbjct  60   VEDLRSKAYQMASALDMLKFSN  81



>gb|AAM52319.1|AC105363_8 Hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ25394.1| hypothetical protein OsJ_09212 [Oryza sativa Japonica Group]
Length=324

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSL-PTTGTEAQRHSSAIRRKITILGTRLDSLESLL  441
            + W++ + EA +L  D+   I+ER S+ P+   E QR ++ IRRK+ IL TRLD ++  L
Sbjct  96   EQWMKRFEEAERLVADVVERIAERESVSPSLPQELQRRTAEIRRKVAILETRLDMMQEDL  155

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            S+LP KQ ++ KE+N+     +TL SK  ++ +      F+N
Sbjct  156  SQLPNKQRISLKELNKLAAKHSTLSSKVKEVGAPFTRKRFSN  197



>ref|XP_002465967.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
 gb|EER92965.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
Length=251

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTT-GTEAQRHSSAIRRKITILGTRLDSLESLL  441
            D W +   EA +L D++   ++ER S+P +   E QR ++ IRRK+ I+GTRLD L+  L
Sbjct  26   DQWTKRLQEAQRLVDEVAERVAERESVPPSLPRELQRRTAEIRRKVAIVGTRLDMLKEDL  85

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNM  552
            S LP +Q ++ K++ +  + LA + SKA ++     M
Sbjct  86   SDLPKRQNISLKQLGKLAEKLAGVCSKAQEVGGQFTM  122



>ref|XP_011398897.1| Syntaxin-52 [Auxenochlorella protothecoides]
 gb|KFM26001.1| Syntaxin-52 [Auxenochlorella protothecoides]
Length=240

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 4/97 (4%)
 Frame = +1

Query  259  SGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            S DSW  EY +A + A ++ N+I ER+   P  G  A R ++  RRK+  LGT+LD+L S
Sbjct  2    SSDSWAEEYEQAKQAAGEVLNLIQERNLEHPDGGPGASRLTATARRKLGSLGTKLDALRS  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
             +   P    LTE E NRR+D +A LR+K   M ++L
Sbjct  62   GIEAAP---DLTENERNRRRDQVAALRNKREGMLTSL  95



>ref|XP_006650984.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=176

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTT--GTEAQRHSSAIRRKITILGTRLDSLESL  438
            D W++ ++EA +L       I+ER S+  +    E QR ++ IRRK+ IL TRLD ++  
Sbjct  34   DEWLKRFDEAERLGGGGGGRIAERESVSPSLLPHELQRRTAEIRRKVAILETRLDMMQEY  93

Query  439  LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            LS+LP KQ +  +E+N+    L+TL SK  ++ +   M   +N
Sbjct  94   LSQLPNKQRINLRELNKLAAKLSTLSSKVKEVGAPFTMKRSSN  136



>ref|XP_005649717.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25173.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
Length=236

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = +1

Query  256  ASGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITILGTRLDSLE  432
            A  D W  EY++A +LADD   +I ER+   P  G EA R ++  RRK+  LG  +DS+ 
Sbjct  2    AGTDRWTNEYDDAKQLADDTLALIQERNLKFPHGGQEASRVTATARRKLGTLGAAVDSMR  61

Query  433  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
            S L      + +TE E NRR+D++  L+S+  QM  +L
Sbjct  62   SSLES-SALENITENERNRRRDLVNALKSRREQMLQSL  98



>ref|XP_005850452.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
 gb|EFN58350.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
Length=242

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +1

Query  259  SGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
              D WV +Y  A + A++   +I ER+   P  G EA R ++  RRK+  LG+ LD+L S
Sbjct  3    GADQWVSDYEAAKQTANETLQLIQERNLKYPEGGPEASRITATSRRKLGTLGSLLDALRS  62

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
             L + P    LTE E NRR+D++A+LR +  QM ++L
Sbjct  63   SL-EAPQYAGLTENERNRRRDLVASLRMRREQMLASL  98



>gb|EAY88317.1| hypothetical protein OsI_09776 [Oryza sativa Indica Group]
Length=325

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSL-PTTGTEAQRHSSAIRRKITILGTRLDSLESLL  441
            + W++ + EA +L  D+   I+ER S+ P+   E QR ++ IRRK+ IL TRLD ++  L
Sbjct  96   EQWMKRFEEAERLVADVVERIAERESVSPSLPQELQRRTAEIRRKVAILETRLDMMQEDL  155

Query  442  SKLPTKQPLTE-KEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            S+LP K      KE+N+     +TL SK  ++ +      F+N
Sbjct  156  SQLPNKHACKSLKELNKLAAKHSTLSSKVKEVGAPFTRKRFSN  198



>ref|XP_004363668.1| hypothetical protein CAOG_03940 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93100.1| hypothetical protein CAOG_003940 [Capsaspora owczarzaki ATCC 
30864]
Length=250

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLS  444
            DSW+ +++     AD+I   I+ER+ +   GT A   +S IRRK+  L T + SLE  L 
Sbjct  17   DSWLLDHDNVTHAADEIMADINERNKVVRQGTNAATLNSGIRRKLGQLTTSIASLEQALD  76

Query  445  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN  549
            +   +  +T+KE++RR+ + + LRS+ +Q+ S  N
Sbjct  77   RAGRQYTITDKELSRRQGLTSALRSRRDQLNSMFN  111



>gb|KIZ07812.1| Syntaxin-51 [Monoraphidium neglectum]
Length=239

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITILGTRLDSLESLL  441
            DSW++EY    +L  +I  +I +R+ + P  G EA R ++A RRK+  LGT LDSL   L
Sbjct  4    DSWLKEYGVCKELTQEIVQLIQDRNVNHPDGGPEASRMTAAARRKLGTLGTTLDSLYRWL  63

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
                    L+E+E  RR+D+L  L+++  Q+  +L
Sbjct  64   DS-DDANSLSEQERFRRRDLLHVLKNRREQIQESL  97



>ref|XP_010646520.1| PREDICTED: syntaxin-52-like [Vitis vinifera]
Length=334

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 9/60 (15%)
 Frame = +1

Query  415  RLDSLESL---------LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            R+++LE+L            LP     TEKE+NRRKDML+ LRSK +QMASTLNMSNFAN
Sbjct  148  RVENLEALALEYYYYLKFFMLPFVSHRTEKEMNRRKDMLSNLRSKVSQMASTLNMSNFAN  207



>ref|XP_002730935.1| PREDICTED: syntaxin-8-like [Saccoglossus kowalevskii]
Length=237

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +1

Query  250  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSL  429
            MA SGD W+ +Y+   + A +I   I+ER+ L  TG+   + S  IR  +      L++L
Sbjct  1    MAPSGDVWLSDYDVCAREAQEIIEKINERNRLLRTGSSHSKISGEIRLALRQFSRYLNNL  60

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQM  534
            +  L +  T   LT++E +RR+DML  L SK  Q+
Sbjct  61   KQDLMRASTSYHLTQREFDRRQDMLDNLISKEKQL  95



>gb|ABR25694.1| syntaxin 51 [Oryza sativa Indica Group]
Length=174

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  424  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  567
            SLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFAN
Sbjct  1    SLEALLSKIPPK-SLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFAN  47



>ref|XP_004206098.1| PREDICTED: syntaxin-8-like [Hydra vulgaris]
Length=238

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTTGTE-AQRHSSAIRRKITILGTRLDSLESLL  441
            DSW ++Y++A ++  DI  +I+ER+SL  TG++ + +    IR+KIT     + S++  L
Sbjct  5    DSWQQDYDDANQIGQDIMELINERNSLQRTGSKNSAQIQCTIRKKITDFSNIIKSMKVQL  64

Query  442  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN  549
             K      +T KE+ RR++ + TL S+  Q+A   N
Sbjct  65   LKSAGGNVVTSKELERRQNQIDTLISREKQIAELFN  100



>gb|KDD75355.1| hypothetical protein H632_c726p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=191

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 6/103 (6%)
 Frame = +1

Query  259  SGDSWVREYNEAVKLADDITNMISERSS-LPTTGTEAQRHSSAIRRKITILGTRLDSLES  435
            S D W+ E+    + A++   +I ER++     G EA R ++A RRK+  LGT LD L+ 
Sbjct  2    SKDQWLEEFEAVRESANETHKLIQERNTQYGGEGPEASRITAAARRKLGTLGTILDRLKH  61

Query  436  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
             L       P +E E NRR+D+++ LR +  QM   L     A
Sbjct  62   GLDG-----PESENERNRRRDLISALRGRREQMLQALKRDGAA  99



>gb|KJB26468.1| hypothetical protein B456_004G245700 [Gossypium raimondii]
Length=200

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 55/98 (56%), Gaps = 13/98 (13%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAI-----RRKITILGTR  417
            A   D+W+RE  EA+KL +DI N ++ ++         Q H + +     R K+  +G +
Sbjct  5    ALMADAWIREAEEALKLVEDIENRVNNKNP------SLQHHGNCVIDIAARSKLLDVGIK  58

Query  418  LDSLESLLSKLPTKQPLTEKEINRRKDMLA--TLRSKA  525
            +D LESLL   P+K  LT ++I+ R  ML+   LR+KA
Sbjct  59   IDRLESLLRNPPSKPILTNEDIDYRWKMLSDMQLRTKA  96



>gb|KHG02271.1| Syntaxin-52 -like protein [Gossypium arboreum]
Length=200

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 11/100 (11%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAI-----RRKITILGTR  417
            A   D+W+RE  EA+KL +DI N ++ ++         Q H + +     R K+  +G +
Sbjct  5    ALMADAWLREAEEALKLVEDIENRVNNKNP------SLQNHGNCVIDIAARSKLLDVGIK  58

Query  418  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMA  537
            +D LESLL   P+K  LT ++I+ R  ML+ ++ +   +A
Sbjct  59   IDRLESLLRNPPSKPILTNEDIDYRWKMLSDMQLRIKALA  98



>ref|XP_007030625.1| Syntaxin of plants 52, putative isoform 2 [Theobroma cacao]
 gb|EOY11127.1| Syntaxin of plants 52, putative isoform 2 [Theobroma cacao]
Length=200

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 3/99 (3%)
 Frame = +1

Query  253  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAI-RRKITILGTRLDSL  429
            A  GD+W+RE  EA KL +DI   +  ++  P+   +  R      R K+   G +LD L
Sbjct  5    ALMGDAWIREAQEASKLVEDIETRVKNKN--PSLKHQENRLVDITARSKLLEAGIKLDRL  62

Query  430  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  546
            ESLL   P+K  LT ++++ R  ML+ L+ +   +A +L
Sbjct  63   ESLLRNPPSKPILTNEDLDYRWKMLSELQLRTKALALSL  101



>ref|XP_002531208.1| syntaxin, putative [Ricinus communis]
 gb|EEF31185.1| syntaxin, putative [Ricinus communis]
Length=147

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  481  INRRKDMLATLRSKANQMASTLNMSNFAN  567
            +NRRKDM+  LR+K NQMA+TLNMSNFAN
Sbjct  1    MNRRKDMVTNLRTKVNQMATTLNMSNFAN  29



>ref|XP_010041363.1| PREDICTED: uncharacterized protein LOC104430313 [Eucalyptus grandis]
Length=191

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLS  444
            D+W+RE  EA +L  ++ + +  ++       E  R S+A + K+  LGT+LD LESLL 
Sbjct  9    DAWMREAEEASELLKELESKVRNKNP-----QEMCRLSNATKSKLLELGTKLDRLESLLH  63

Query  445  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNM  552
              P+K  LT++++  R  ML  ++ +  ++A +L M
Sbjct  64   NPPSKPVLTDEDLGWRWKMLLDIQLRTREVAVSLLM  99



>ref|XP_003064731.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51065.1| predicted protein [Micromonas pusilla CCMP1545]
Length=246

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (55%), Gaps = 4/95 (4%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLS  444
            D+W++E++EA ++ ++   ++ ER      G    + + A+  K   L  +LD LE+LL 
Sbjct  10   DAWLKEFDEAEQILNEAFEIVYEREDGLMEGKNVSKLTEAVNAKARALDGKLDKLENLL-  68

Query  445  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN  549
               T+  + EKE  RR+D++  LR +  ++ S L 
Sbjct  69   ---TETRINEKETTRRRDLMRGLRVRGEEVVSLLG  100



>ref|XP_002970090.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
 gb|EFJ29214.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
Length=227

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = +1

Query  265  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITILGTRLDSLESLLS  444
            D+W +E +EA +LA+++   I   +S   +  E  R  S  +RKI IL  +++ L S L 
Sbjct  3    DAWAKELDEATRLAEEVKGSIVNANSGGMSRGERSRLLSTTKRKILILDNKVNRLTSTLE  62

Query  445  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  564
             L  +  L+EKE  RR+D + +L  +  Q+ S+   S  A
Sbjct  63   TL--RGQLSEKEFFRRQDAIISLGLRVKQLDSSYKSSQNA  100



>gb|KJB62825.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=155

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  481  INRRKDMLATLRSKANQMASTLNMSNFAN  567
            +NR KDM+  LRSK+NQMAS  NMSNFAN
Sbjct  1    MNRCKDMVTNLRSKSNQMASAFNMSNFAN  29



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960