BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF015I23

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343543.1|  PREDICTED: xylose isomerase-like                   176   2e-49   Solanum tuberosum [potatoes]
gb|KDP43806.1|  hypothetical protein JCGZ_23014                         172   8e-48   Jatropha curcas
ref|XP_004242672.1|  PREDICTED: xylose isomerase                        172   9e-48   Solanum lycopersicum
ref|XP_009801815.1|  PREDICTED: xylose isomerase                        171   2e-47   Nicotiana sylvestris
ref|XP_009606829.1|  PREDICTED: xylose isomerase                        171   2e-47   Nicotiana tomentosiformis
gb|EYU42440.1|  hypothetical protein MIMGU_mgv1a0056112mg               158   5e-45   Erythranthe guttata [common monkey flower]
ref|XP_002324488.1|  hypothetical protein POPTR_0018s10460g             164   7e-45   Populus trichocarpa [western balsam poplar]
gb|EYU34279.1|  hypothetical protein MIMGU_mgv1a005575mg                162   3e-44   Erythranthe guttata [common monkey flower]
ref|XP_011069881.1|  PREDICTED: xylose isomerase-like                   162   4e-44   Sesamum indicum [beniseed]
ref|XP_002277520.2|  PREDICTED: xylose isomerase                        161   1e-43   Vitis vinifera
ref|XP_011018165.1|  PREDICTED: xylose isomerase                        161   1e-43   Populus euphratica
emb|CBI17768.3|  unnamed protein product                                162   1e-43   Vitis vinifera
ref|XP_011079316.1|  PREDICTED: xylose isomerase                        158   2e-42   Sesamum indicum [beniseed]
emb|CDP02939.1|  unnamed protein product                                152   2e-40   Coffea canephora [robusta coffee]
ref|XP_007011130.1|  Xylose isomerase family protein isoform 4          150   4e-40   
ref|XP_007011129.1|  Xylose isomerase family protein isoform 3          150   6e-40   
ref|XP_007011127.1|  Xylose isomerase family protein isoform 1          151   9e-40   
ref|XP_004297371.1|  PREDICTED: xylose isomerase                        149   5e-39   Fragaria vesca subsp. vesca
ref|XP_002532409.1|  Xylose isomerase, putative                         148   5e-39   Ricinus communis
ref|XP_010102993.1|  Xylose isomerase                                   147   3e-38   
gb|KJB60238.1|  hypothetical protein B456_009G296100                    144   1e-37   Gossypium raimondii
gb|KJB60241.1|  hypothetical protein B456_009G296100                    144   1e-37   Gossypium raimondii
gb|KJB60239.1|  hypothetical protein B456_009G296100                    144   1e-37   Gossypium raimondii
ref|XP_010259769.1|  PREDICTED: xylose isomerase isoform X2             144   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010259768.1|  PREDICTED: xylose isomerase isoform X1             144   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010065877.1|  PREDICTED: xylose isomerase-like isoform X2        140   4e-37   
gb|KHG02217.1|  Xylose isomerase -like protein                          143   5e-37   Gossypium arboreum [tree cotton]
gb|KJB60240.1|  hypothetical protein B456_009G296100                    143   5e-37   Gossypium raimondii
ref|XP_010065878.1|  PREDICTED: xylose isomerase-like isoform X3        142   1e-36   Eucalyptus grandis [rose gum]
gb|KCW63564.1|  hypothetical protein EUGRSUZ_G01193                     142   2e-36   Eucalyptus grandis [rose gum]
ref|XP_010065874.1|  PREDICTED: xylose isomerase-like isoform X1        141   2e-36   
ref|XP_006845583.1|  hypothetical protein AMTR_s00019p00197750          141   2e-36   Amborella trichopoda
ref|XP_007222807.1|  hypothetical protein PRUPE_ppa005065mg             140   3e-36   Prunus persica
dbj|BAJ34093.1|  unnamed protein product                                139   9e-36   Eutrema halophilum
ref|XP_006401183.1|  hypothetical protein EUTSA_v10013406mg             139   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010414290.1|  PREDICTED: xylose isomerase-like                   133   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009417936.1|  PREDICTED: xylose isomerase-like                   139   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008223675.1|  PREDICTED: xylose isomerase                        139   2e-35   Prunus mume [ume]
ref|XP_008365436.1|  PREDICTED: xylose isomerase-like                   138   4e-35   Malus domestica [apple tree]
ref|NP_851203.1|  xylose isomerase                                      134   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864523.1|  xylose isomerase family protein                    137   4e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_006658089.1|  PREDICTED: xylose isomerase-like                   137   4e-35   Oryza brachyantha
gb|AGV54617.1|  xylose isomerase                                        137   5e-35   Phaseolus vulgaris [French bean]
ref|XP_008796227.1|  PREDICTED: xylose isomerase isoform X1             137   5e-35   Phoenix dactylifera
ref|XP_008452100.1|  PREDICTED: xylose isomerase                        137   6e-35   Cucumis melo [Oriental melon]
ref|XP_006453438.1|  hypothetical protein CICLE_v10008154mg             137   6e-35   Citrus clementina [clementine]
ref|XP_010102992.1|  Xylose isomerase                                   137   1e-34   
ref|XP_009336656.1|  PREDICTED: xylose isomerase-like                   136   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_009348411.1|  PREDICTED: xylose isomerase-like                   136   1e-34   Pyrus x bretschneideri [bai li]
dbj|BAE98492.1|  xylose isomerase                                       136   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568861.3|  xylose isomerase                                      136   1e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08802.1|  xylose isomerase                                       136   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154797.1|  hypothetical protein PHAVU_003G148700g             136   2e-34   Phaseolus vulgaris [French bean]
emb|CAN65150.1|  hypothetical protein VITISV_037086                     135   2e-34   Vitis vinifera
emb|CDY25894.1|  BnaC09g32660D                                          135   2e-34   Brassica napus [oilseed rape]
ref|XP_004149070.1|  PREDICTED: xylose isomerase-like                   135   2e-34   
gb|KGN61107.1|  hypothetical protein Csa_2G049960                       135   2e-34   Cucumis sativus [cucumbers]
ref|XP_009120281.1|  PREDICTED: xylose isomerase                        135   4e-34   Brassica rapa
ref|XP_006280396.1|  hypothetical protein CARUB_v10026323mg             135   5e-34   Capsella rubella
gb|AAM61519.1|  xylose isomerase                                        134   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452612.1|  PREDICTED: xylose isomerase-like                   134   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010483295.1|  PREDICTED: xylose isomerase-like                   134   5e-34   Camelina sativa [gold-of-pleasure]
gb|EEC82655.1|  hypothetical protein OsI_27268                          134   5e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001060585.1|  Os07g0669100                                       134   5e-34   
emb|CDY49729.1|  BnaA10g11590D                                          134   6e-34   Brassica napus [oilseed rape]
ref|XP_004958625.1|  PREDICTED: xylose isomerase-like                   134   8e-34   Setaria italica
ref|XP_010443465.1|  PREDICTED: xylose isomerase                        134   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003562496.1|  PREDICTED: xylose isomerase                        134   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_008650947.1|  PREDICTED: uncharacterized protein LOC100194...    134   1e-33   Zea mays [maize]
tpg|DAA64057.1|  TPA: putative xylose isomerase family protein          133   2e-33   
ref|XP_008796228.1|  PREDICTED: xylose isomerase isoform X2             132   4e-33   Phoenix dactylifera
gb|KDO62435.1|  hypothetical protein CISIN_1g0373932mg                  132   6e-33   Citrus sinensis [apfelsine]
ref|XP_010938719.1|  PREDICTED: xylose isomerase                        131   7e-33   Elaeis guineensis
ref|XP_004958079.1|  PREDICTED: xylose isomerase-like                   131   8e-33   Setaria italica
ref|XP_010688509.1|  PREDICTED: xylose isomerase isoform X2             130   2e-32   
ref|XP_010688508.1|  PREDICTED: xylose isomerase isoform X1             130   2e-32   
gb|ACU18251.1|  unknown                                                 125   3e-32   Glycine max [soybeans]
gb|ACG35698.1|  xylose isomerase                                        129   4e-32   Zea mays [maize]
ref|NP_001132653.1|  uncharacterized protein LOC100194128 precursor     129   4e-32   Zea mays [maize]
ref|XP_010688511.1|  PREDICTED: xylose isomerase isoform X3             129   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010539451.1|  PREDICTED: xylose isomerase                        129   7e-32   Tarenaya hassleriana [spider flower]
tpg|DAA64056.1|  TPA: putative xylose isomerase family protein          128   8e-32   
gb|EPS67638.1|  xylose isomerase                                        128   8e-32   Genlisea aurea
ref|XP_003549495.1|  PREDICTED: xylose isomerase                        128   9e-32   Glycine max [soybeans]
gb|KHN17567.1|  Xylose isomerase                                        128   1e-31   Glycine soja [wild soybean]
ref|NP_001132889.1|  putative xylose isomerase family protein pre...    128   1e-31   Zea mays [maize]
ref|XP_009391575.1|  PREDICTED: xylose isomerase-like                   128   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG42142.1|  xylose isomerase                                        127   1e-31   Zea mays [maize]
gb|AFK33995.1|  unknown                                                 122   2e-31   Lotus japonicus
ref|XP_003610179.1|  Xylose isomerase                                   127   3e-31   
gb|AES92376.2|  xylose isomerase                                        127   3e-31   Medicago truncatula
ref|XP_004507817.1|  PREDICTED: xylose isomerase-like isoform X3        125   7e-31   Cicer arietinum [garbanzo]
ref|XP_004507815.1|  PREDICTED: xylose isomerase-like isoform X1        125   7e-31   
gb|AFK39166.1|  unknown                                                 125   1e-30   Medicago truncatula
dbj|BAJ96683.1|  predicted protein                                      124   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA64544.1|  xylose isomerase                                       122   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q40082.1|XYLA_HORVU  RecName: Full=Xylose isomerase                  122   1e-29   Hordeum vulgare [barley]
emb|CDY58846.1|  BnaA02g35220D                                          116   9e-29   Brassica napus [oilseed rape]
ref|XP_007011128.1|  Xylose isomerase family protein isoform 2          119   1e-28   
gb|KJB68666.1|  hypothetical protein B456_010G217000                    117   5e-28   Gossypium raimondii
gb|KIZ04907.1|  xylose isomerase                                        108   2e-24   Monoraphidium neglectum
ref|XP_002991242.1|  hypothetical protein SELMODRAFT_229601             107   2e-24   
ref|XP_002991182.1|  hypothetical protein SELMODRAFT_161472             107   2e-24   
ref|XP_001774702.1|  predicted protein                                  107   5e-24   
emb|CDY02747.1|  BnaC02g11420D                                          101   2e-22   
gb|KHN34792.1|  Xylose isomerase                                      97.1    5e-22   Glycine soja [wild soybean]
gb|AFG69667.1|  hypothetical protein 2_5497_01                        91.3    1e-19   Pinus taeda
ref|XP_005646804.1|  xylose isomerase                                 94.4    2e-19   Coccomyxa subellipsoidea C-169
gb|EMT06905.1|  Xylose isomerase                                      93.6    3e-19   
emb|CDY03999.1|  BnaC02g37140D                                        87.0    9e-19   
ref|WP_013701478.1|  xylose isomerase                                 87.0    5e-17   Treponema succinifaciens
ref|WP_038172460.1|  xylose isomerase                                 85.5    2e-16   Verrucomicrobium sp. BvORR106
ref|XP_008362076.1|  PREDICTED: xylose isomerase-like                 84.7    8e-16   
ref|WP_009959507.1|  xylose isomerase                                 83.6    1e-15   Verrucomicrobium spinosum
emb|CBK25455.2|  unnamed protein product                              82.8    2e-15   Blastocystis hominis
ref|WP_015707713.1|  xylose isomerase                                 82.0    4e-15   Treponema primitia
ref|WP_013109552.1|  xylose isomerase                                 81.3    6e-15   Planctopirus limnophila
ref|XP_005764620.1|  hypothetical protein EMIHUDRAFT_214014           77.8    8e-15   Emiliania huxleyi CCMP1516
emb|CAB76571.1|  xylose isomerase                                     80.9    9e-15   Piromyces sp. E2
ref|WP_008761491.1|  MULTISPECIES: xylose isomerase                   80.5    1e-14   
ref|WP_024987508.1|  xylose isomerase                                 80.5    1e-14   Bacteroides acidifaciens
ref|WP_011107447.1|  xylose isomerase                                 80.5    1e-14   Bacteroides thetaiotaomicron
ref|WP_010538096.1|  MULTISPECIES: xylose isomerase                   80.5    1e-14   Bacteroides
ref|WP_004295876.1|  MULTISPECIES: xylose isomerase                   80.5    1e-14   Bacteroides
ref|WP_008765652.1|  xylose isomerase                                 80.5    1e-14   Bacteroides thetaiotaomicron
ref|WP_022138821.1|  xylose isomerase                                 80.5    1e-14   Bacteroides
ref|WP_016267511.1|  xylose isomerase                                 80.5    1e-14   Bacteroides thetaiotaomicron
ref|WP_005654109.1|  xylose isomerase                                 80.5    1e-14   Bacteroides stercoris
ref|WP_022103428.1|  xylose isomerase                                 80.5    1e-14   
ref|WP_034536238.1|  xylose isomerase                                 80.5    1e-14   Bacteroides stercoris
gb|EPH17343.1|  xylose isomerase                                      80.5    1e-14   Bacteroides stercoris CC31F
ref|WP_018666714.1|  xylose isomerase                                 80.5    1e-14   Bacteroides gallinarum
ref|WP_010255892.1|  xylose isomerase                                 80.1    2e-14   Treponema primitia
ref|WP_007748423.1|  MULTISPECIES: xylose isomerase                   80.1    2e-14   Bacteroides finegoldii
ref|WP_007760618.1|  xylose isomerase                                 80.1    2e-14   Bacteroides finegoldii
ref|WP_005675918.1|  xylose isomerase                                 80.1    2e-14   Bacteroides caccae
ref|WP_022042383.1|  xylose isomerase                                 80.1    2e-14   Bacteroides caccae
ref|WP_008655763.1|  xylose isomerase                                 80.1    2e-14   Rhodopirellula europaea
ref|WP_011118969.1|  xylose isomerase                                 80.1    2e-14   Rhodopirellula baltica
ref|WP_007335236.1|  xylose isomerase                                 80.1    2e-14   Rhodopirellula baltica
ref|WP_007324329.1|  xylose isomerase                                 80.1    2e-14   Rhodopirellula baltica
emb|CAD72762.1|  xylose isomerase                                     80.1    2e-14   Rhodopirellula baltica SH 1
ref|WP_002651869.1|  xylose isomerase                                 79.7    2e-14   Blastopirellula marina
ref|WP_007414259.1|  xylose isomerase                                 79.7    3e-14   Pedosphaera parvula
ref|XP_005779983.1|  hypothetical protein EMIHUDRAFT_59556            77.4    3e-14   Emiliania huxleyi CCMP1516
ref|WP_004290957.1|  MULTISPECIES: xylose isomerase                   79.7    3e-14   Bacteroides eggerthii
ref|WP_008618038.1|  xylose isomerase                                 79.7    3e-14   Paraprevotella clara
ref|WP_008626667.1|  xylose isomerase                                 79.7    3e-14   Paraprevotella xylaniphila
ref|WP_009125594.1|  xylose isomerase                                 79.3    3e-14   Bacteroides fluxus
ref|WP_007567790.1|  MULTISPECIES: xylose isomerase                   79.3    3e-14   Bacteroides coprocola
ref|WP_021969955.1|  xylose isomerase                                 79.3    3e-14   
ref|WP_009319331.1|  xylose isomerase                                 79.3    3e-14   Tannerella sp. 6_1_58FAA_CT1
ref|WP_022389541.1|  xylose isomerase                                 79.3    3e-14   Tannerella sp. AF04-6
ref|WP_022600970.1|  xylose isomerase                                 79.3    3e-14   Coprobacter fastidiosus
ref|WP_013564383.1|  xylose isomerase                                 79.3    3e-14   Isosphaera pallida
ref|WP_022231753.1|  xylose isomerase                                 79.0    4e-14   
ref|WP_025881085.1|  xylose isomerase                                 79.0    4e-14   Prevotella baroniae
ref|WP_020153617.1|  xylose isomerase                                 79.0    4e-14   Caldibacillus debilis
ref|WP_026475377.1|  xylose isomerase                                 79.0    5e-14   Alkaliflexus imshenetskii
ref|WP_024996964.1|  xylose isomerase                                 79.0    5e-14   Bacteroides graminisolvens
ref|WP_019538924.1|  xylose isomerase                                 78.6    5e-14   Proteiniphilum acetatigenes
gb|ACA65427.1|  xylose isomerase                                      78.6    6e-14   Orpinomyces sp. ukk1
ref|WP_022339343.1|  xylose isomerase                                 78.2    7e-14   
ref|WP_018709956.1|  xylose isomerase                                 78.2    8e-14   Bacteroides barnesiae
ref|WP_014856692.1|  xylose isomerase                                 78.2    8e-14   Melioribacter roseus
ref|WP_010528781.1|  xylose isomerase                                 78.2    9e-14   Thermophagus xiamenensis
ref|WP_002560285.1|  MULTISPECIES: xylose isomerase                   78.2    9e-14   Bacteroides
ref|WP_044302066.1|  xylose isomerase                                 77.8    1e-13   Rhodopirellula sallentina
gb|EMI56412.1|  xylose isomerase                                      78.2    1e-13   Rhodopirellula sallentina SM41
dbj|GAK49954.1|  xylose isomerase                                     77.8    1e-13   Candidatus Moduliflexus flocculans
ref|WP_013711740.1|  xylose isomerase                                 77.8    1e-13   Carnobacterium sp. 17-4
ref|WP_013618897.1|  xylose isomerase                                 77.8    1e-13   Bacteroides salanitronis
ref|WP_022164491.1|  xylose isomerase                                 77.8    1e-13   
ref|WP_005931926.1|  MULTISPECIES: xylose isomerase                   77.8    1e-13   Bacteroides salyersiae
ref|WP_010588344.1|  xylose isomerase                                 77.4    1e-13   Schlesneria paludicola
ref|WP_015358602.1|  MULTISPECIES: xylose isomerase XylA              77.4    1e-13   Thermoclostridium stercorarium
ref|WP_013547913.1|  xylose isomerase                                 77.4    1e-13   Bacteroides helcogenes
ref|WP_038607329.1|  xylose isomerase                                 77.4    2e-13   
ref|WP_016276408.1|  MULTISPECIES: xylose isomerase                   77.4    2e-13   Bacteroides sartorii
ref|WP_005843150.1|  xylose isomerase                                 77.4    2e-13   Bacteroides vulgatus
ref|WP_022508280.1|  xylose isomerase                                 77.4    2e-13   Bacteroides vulgatus
ref|WP_005851486.1|  MULTISPECIES: xylose isomerase                   77.4    2e-13   Bacteroides
ref|WP_006801274.1|  xylose isomerase                                 77.4    2e-13   Dysgonomonas gadei
ref|WP_005820227.1|  xylose isomerase                                 77.4    2e-13   Bacteroides fragilis
ref|WP_022386029.1|  xylose isomerase                                 77.0    2e-13   Bacteroides sp. Marseille-P3684
ref|WP_034838066.1|  xylose isomerase [                               77.0    2e-13   
ref|WP_021979384.1|  xylose isomerase                                 77.0    2e-13   
ref|WP_009120973.1|  MULTISPECIES: xylose isomerase                   77.0    2e-13   Bacteroides clarus
ref|WP_010040427.1|  xylose isomerase                                 77.0    2e-13   Gemmata obscuriglobus
ref|WP_028262068.1|  xylose isomerase                                 77.0    2e-13   
ref|WP_028986624.1|  xylose isomerase                                 77.0    2e-13   Thermicanus aegyptius
ref|WP_013711744.1|  xylose isomerase                                 77.0    2e-13   Carnobacterium sp. 17-4
ref|WP_002643822.1|  xylose isomerase                                 77.0    2e-13   Gimesia maris
ref|WP_005588920.1|  xylose isomerase                                 77.0    2e-13   
ref|WP_032531500.1|  xylose isomerase                                 77.0    2e-13   Bacteroides fragilis
ref|WP_008707454.1|  xylose isomerase                                 77.0    2e-13   Rhodopirellula maiorica
ref|WP_022039388.1|  xylose isomerase                                 76.6    2e-13   Bacteroides
ref|WP_005806049.1|  MULTISPECIES: xylose isomerase                   76.6    2e-13   Bacteroides
ref|WP_007557712.1|  xylose isomerase                                 76.6    3e-13   Bacteroides plebeius
ref|WP_020007900.1|  xylose isomerase                                 76.6    3e-13   Salinicoccus albus
ref|WP_023663756.1|  xylose isomerase                                 76.6    3e-13   
ref|WP_008101337.1|  xylose isomerase                                 76.6    3e-13   Verrucomicrobiae bacterium DG1235
ref|WP_032575525.1|  xylose isomerase                                 76.6    3e-13   Bacteroides fragilis
ref|WP_032600983.1|  xylose isomerase                                 76.6    3e-13   Bacteroides fragilis
ref|WP_044162815.1|  xylose isomerase                                 76.6    3e-13   Bacteroides reticulotermitis
ref|WP_032598317.1|  xylose isomerase                                 76.6    3e-13   Bacteroides fragilis
ref|WP_026561670.1|  xylose isomerase                                 76.6    3e-13   Bacillus sp. J37
ref|WP_027471746.1|  xylose isomerase                                 76.3    3e-13   Saccharicrinis fermentans
ref|WP_014225930.1|  xylose isomerase                                 76.3    3e-13   Tannerella forsythia
ref|WP_012913169.1|  xylose isomerase                                 76.3    3e-13   Pirellula staleyi
ref|WP_039847233.1|  xylose isomerase                                 72.0    4e-13   
ref|WP_021949211.1|  xylose isomerase                                 76.3    4e-13   
ref|WP_012924965.1|  xylose isomerase                                 76.3    4e-13   
ref|WP_029904902.1|  xylose isomerase                                 76.3    4e-13   Prevotella sp. 10(H)
ref|WP_006842491.1|  xylose isomerase                                 76.3    4e-13   Dysgonomonas mossii
ref|WP_007930953.1|  MULTISPECIES: xylose isomerase                   76.3    4e-13   Pelosinus
ref|WP_009127448.1|  xylose isomerase                                 76.3    4e-13   Bacteroides oleiciplenus
ref|WP_025658881.1|  xylose isomerase                                 75.9    4e-13   Rhizobium
ref|WP_044271094.1|  xylose isomerase                                 75.9    4e-13   Bacteroides timonensis
ref|WP_022210068.1|  xylose isomerase                                 75.9    4e-13   
ref|WP_031535720.1|  MULTISPECIES: xylose isomerase                   75.9    4e-13   Bacteroides
ref|WP_009095728.1|  xylose isomerase                                 75.9    5e-13   Rhodopirellula sp. SWK7
ref|WP_007214097.1|  MULTISPECIES: xylose isomerase                   75.9    5e-13   Bacteroides
ref|WP_018856526.1|  xylose isomerase                                 75.9    5e-13   Rhizobium sp. 42MFCr.1
ref|WP_013970119.1|  xylose isomerase                                 75.9    6e-13   Treponema caldarium
ref|WP_032539378.1|  xylose isomerase                                 75.5    6e-13   Bacteroides fragilis
ref|WP_021590663.1|  xylose isomerase                                 75.5    6e-13   Prevotella baroniae
ref|WP_019387009.1|  xylose isomerase                                 75.5    6e-13   Arenitalea lutea
ref|WP_022083252.1|  xylose isomerase                                 75.5    7e-13   
ref|WP_007218456.1|  xylose isomerase                                 75.5    7e-13   Bacteroides cellulosilyticus
ref|WP_026976161.1|  xylose isomerase                                 75.5    7e-13   Alicyclobacillus contaminans
ref|WP_029077449.1|  xylose isomerase                                 73.2    8e-13   
emb|CDZ23165.1|  Xylose isomerase [ [                                 75.5    8e-13   [Clostridium] cellulosi
ref|WP_022847921.1|  xylose isomerase                                 75.1    8e-13   Anaerolineaceae bacterium oral taxon 439
sp|Q6T6K9.1|XYLA_FERGO  RecName: Full=Xylose isomerase                75.1    8e-13   Fervidobacterium gondwanense
gb|KFH21249.1|  xylose isomerase                                      72.4    8e-13   Brucella abortus 544
ref|WP_037414339.1|  xylose isomerase                                 75.1    1e-12   Sinorhizobium
ref|WP_040994511.1|  xylose isomerase                                 75.1    1e-12   Chryseobacterium oranimense
ref|WP_022054239.1|  xylose isomerase                                 75.1    1e-12   Bacteroides plebeius
ref|WP_032556812.1|  xylose isomerase                                 75.1    1e-12   Bacteroides fragilis
ref|WP_014298921.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_005777710.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_010992983.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_005787643.1|  MULTISPECIES: xylose isomerase                   74.7    1e-12   Bacteroides
ref|WP_037179575.1|  xylose isomerase                                 74.7    1e-12   Rhizobium sp. YR519
ref|WP_025813316.1|  xylose isomerase                                 74.7    1e-12   
ref|WP_032562944.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_005803483.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_028120803.1|  xylose isomerase                                 74.7    1e-12   Chryseobacterium tenax
ref|WP_032599677.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_032564865.1|  xylose isomerase                                 74.7    1e-12   Bacteroides fragilis
ref|WP_018615189.1|  xylose isomerase                                 74.7    1e-12   Segetibacter koreensis
ref|WP_043618463.1|  xylose isomerase                                 74.7    1e-12   Ensifer sp. ZNC0028
ref|WP_037119675.1|  xylose isomerase                                 74.7    1e-12   Rhizobium sp. OV201
ref|WP_006500342.1|  xylose isomerase                                 74.7    1e-12   Lactobacillus mucosae
ref|WP_029292485.1|  xylose isomerase                                 74.7    1e-12   Chryseobacterium hispalense
ref|WP_034787018.1|  xylose isomerase                                 74.7    1e-12   Ensifer
ref|WP_013931484.1|  xylose isomerase                                 74.7    1e-12   Pseudothermotoga thermarum
ref|WP_040587903.1|  xylose isomerase                                 72.4    1e-12   
ref|WP_034673582.1|  xylose isomerase                                 74.7    1e-12   Chryseobacterium formosense
gb|ENS90163.1|  xylose isomerase                                      73.9    1e-12   Brucella melitensis UK31/99
ref|WP_007700780.1|  xylose isomerase                                 74.7    1e-12   Rhizobium sp. AP16
ref|WP_012652406.1|  MULTISPECIES: xylose isomerase                   74.7    1e-12   Rhizobium/Agrobacterium group
ref|WP_006195377.1|  xylose isomerase                                 74.3    1e-12   Brucella suis
gb|AIB17286.1|  Xylose isomerase                                      74.3    1e-12   Brucella suis bv. 2
ref|WP_009571734.1|  xylose isomerase                                 74.3    1e-12   Celeribacter baekdonensis
ref|WP_035527339.1|  xylose isomerase                                 74.3    1e-12   Hoeflea sp. BAL378
ref|WP_019986665.1|  xylose isomerase                                 74.3    2e-12   Rudanella lutea
ref|WP_041252697.1|  xylose isomerase                                 74.3    2e-12   Flavobacteriaceae bacterium 3519-10
ref|WP_012573538.1|  xylose isomerase                                 74.3    2e-12   Candidatus Azobacteroides pseudotrichonymphae
gb|KJF45546.1|  xylose isomerase                                      74.3    2e-12   Draconibacterium sediminis
ref|WP_038559919.1|  xylose isomerase                                 74.3    2e-12   Draconibacterium orientale
gb|ACU08186.1|  Xylose isomerase                                      74.7    2e-12   Flavobacteriaceae bacterium 3519-10
ref|WP_018096676.1|  xylose isomerase                                 74.3    2e-12   Sinorhizobium/Ensifer group
ref|WP_018387210.1|  xylose isomerase                                 74.3    2e-12   Ancylobacter sp. FA202
ref|WP_013626379.1|  xylose isomerase                                 74.3    2e-12   Rubinisphaera brasiliensis
dbj|GAE90252.1|  xylose isomerase [ [                                 73.9    2e-12   Hungateiclostridium straminisolvens JCM 21531
ref|WP_005825539.1|  MULTISPECIES: xylose isomerase                   74.3    2e-12   Bacteroides
ref|WP_012238060.1|  xylose isomerase                                 74.3    2e-12   Sorangium cellulosum
ref|WP_028752785.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_002978702.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_025835352.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_006189966.1|  MULTISPECIES: xylose isomerase                   74.3    2e-12   
ref|WP_008508460.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_025199606.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_025608026.1|  xylose isomerase                                 74.3    2e-12   
gb|EFM59199.1|  xylose isomerase                                      74.3    2e-12   
ref|WP_015917171.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_006144625.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_012783901.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_002966715.1|  MULTISPECIES: xylose isomerase                   74.3    2e-12   
ref|WP_006011751.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_026620694.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_036940898.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_008935467.1|  MULTISPECIES: xylose isomerase                   74.3    2e-12   
ref|WP_004689533.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_002963697.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_025763423.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_007802725.1|  xylose isomerase                                 74.3    2e-12   
gb|EEH14934.1|  xylose isomerase                                      74.3    2e-12   
dbj|BAP32351.1|  xylose isomerase                                     74.3    2e-12   
ref|WP_021846289.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_028748811.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_026679492.1|  xylose isomerase                                 74.3    2e-12   
ref|WP_007527764.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_016556986.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_026390872.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_004691947.1|  MULTISPECIES: xylose isomerase                   73.9    2e-12   
ref|WP_018901980.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_036876645.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_037133388.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_012709445.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_007173223.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_037998292.1|  xylose isomerase                                 73.9    2e-12   
ref|WP_015341171.1|  xylose isomerase                                 73.9    3e-12   
ref|WP_013430944.1|  xylose isomerase                                 73.9    3e-12   
gb|EFG37505.1|  xylose isomerase                                      73.9    3e-12   
ref|WP_015919215.1|  MULTISPECIES: xylose isomerase                   73.9    3e-12   
ref|WP_037151728.1|  xylose isomerase                                 73.9    3e-12   
ref|WP_008533378.1|  xylose isomerase                                 73.9    3e-12   
ref|WP_026626867.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_024270907.1|  xylose isomerase XylA                            73.6    3e-12   
ref|WP_025498145.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_009806706.1|  xylose isomerase                                 73.6    3e-12   
pdb|1A0E|A  Chain A, Xylose Isomerase From Thermotoga Neapolitana     73.6    3e-12   
ref|WP_043749125.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_011426861.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_020922312.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_008880082.1|  MULTISPECIES: xylose isomerase                   73.6    3e-12   
ref|WP_034968396.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_008907517.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_022019645.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_021854600.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_020471332.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_018328012.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_010094936.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_015814165.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_021962902.1|  xylose isomerase                                 73.6    3e-12   
ref|WP_024314898.1|  MULTISPECIES: xylose isomerase                   73.6    3e-12   
ref|WP_027382385.1|  xylose isomerase                                 73.6    3e-12   
gb|EYD75103.1|  Xylose isomerase                                      70.9    4e-12   
ref|WP_037100265.1|  xylose isomerase                                 73.6    4e-12   
ref|WP_037164623.1|  MULTISPECIES: xylose isomerase                   73.6    4e-12   
ref|WP_044225739.1|  xylose isomerase                                 73.6    4e-12   
ref|WP_017000400.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_025424906.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_029960838.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_013844860.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_010970273.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_003528875.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_021150351.1|  nylose isomerase                                 73.2    4e-12   
ref|WP_014766000.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_017270005.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_003125594.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_028009857.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_044627421.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_026350601.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_042834224.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_010664371.1|  xylose isomerase                                 73.2    4e-12   
gb|EKD61237.1|  hypothetical protein ACD_54C00334G0001                73.2    4e-12   
ref|WP_007817513.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_012811447.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_024268780.1|  Xylose isomerase                                 73.2    4e-12   
ref|WP_028555493.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_037103390.1|  xylose isomerase                                 73.2    4e-12   
ref|WP_029486454.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_036612660.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_005862810.1|  MULTISPECIES: xylose isomerase                   73.2    5e-12   
ref|WP_008779754.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_039365617.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_027092932.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_035468893.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_036631521.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_005857454.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_039848599.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_009275085.1|  MULTISPECIES: xylose isomerase                   73.2    5e-12   
ref|WP_011966163.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_028736674.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_026259381.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_008772359.1|  xylose isomerase                                 73.2    5e-12   
gb|EEU51936.1|  xylose isomerase                                      73.2    5e-12   
ref|WP_041695343.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_013238479.1|  MULTISPECIES: xylose isomerase                   73.2    5e-12   
gb|EED08196.1|  xylose isomerase                                      73.2    5e-12   
gb|AEJ44206.1|  xylose isomerase                                      73.2    5e-12   
ref|WP_020733663.1|  xylose isomerase                                 73.2    5e-12   
ref|WP_037389458.1|  xylose isomerase                                 72.8    5e-12   
ref|WP_005470534.1|  xylose isomerase                                 72.8    5e-12   
ref|WP_019206598.1|  xylose isomerase                                 72.8    5e-12   
ref|WP_024847494.1|  xylose isomerase                                 72.8    5e-12   
ref|WP_034503306.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_024897664.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_034483246.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_007877823.1|  xylose isomerase                                 72.8    6e-12   
gb|EMS46439.1|  Xylose isomerase                                      72.8    6e-12   
ref|WP_018199100.1|  hypothetical protein                             72.8    6e-12   
ref|WP_033164816.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_044731434.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_023634171.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_044745016.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_031409263.1|  xylose isomerase                                 72.8    6e-12   
gb|ABI49954.1|  xylose kinase                                         72.8    6e-12   
gb|AEG75765.1|  xylose isomerase                                      72.8    6e-12   
ref|WP_044737009.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_008507562.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_033008779.1|  xylose isomerase                                 72.8    6e-12   
ref|WP_021321588.1|  xylose isomerase                                 72.8    6e-12   
ref|XP_009537174.1|  hypothetical protein PHYSODRAFT_306712           73.2    6e-12   
ref|WP_028728399.1|  xylose isomerase                                 72.8    7e-12   
ref|WP_020009085.1|  MULTISPECIES: xylose isomerase                   72.8    7e-12   
ref|WP_034652848.1|  xylose isomerase                                 72.8    7e-12   
ref|WP_020812097.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_003505440.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_005470141.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_020594904.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_003128196.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_020605377.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_018072724.1|  xylose isomerase                                 72.4    7e-12   
ref|WP_027682832.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_017962162.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_021686300.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_037120987.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_020051693.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_018243620.1|  MULTISPECIES: xylose isomerase                   72.4    8e-12   
ref|WP_028733941.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_018235703.1|  xylose isomerase                                 72.4    8e-12   
gb|EFR67495.1|  xylose isomerase                                      72.4    8e-12   
ref|WP_029616624.1|  MULTISPECIES: xylose isomerase                   72.4    8e-12   
ref|WP_028510817.1|  xylose isomerase                                 72.4    8e-12   
dbj|GAL82396.1|  xylose isomerase                                     70.9    8e-12   
ref|WP_017967947.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_002299156.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_037196303.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_006726994.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_034264614.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_002322281.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_028974176.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_044150649.1|  xylose isomerase                                 72.4    8e-12   
ref|WP_037069736.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_016737302.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_003499121.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_012558995.1|  xylose isomerase                                 72.4    9e-12   
gb|ERE62367.1|  xylose isomerase                                      71.2    9e-12   
ref|WP_003590202.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_038052482.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_012896352.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_004433392.1|  xylose isomerase                                 72.4    9e-12   
emb|CCF20545.1|  D-xylose isomerase (D-xylulose keto-isomerase)       72.4    9e-12   
ref|WP_003582397.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_029683770.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_011943656.1|  xylose isomerase                                 72.4    9e-12   
ref|WP_025595050.1|  xylose isomerase                                 72.0    9e-12   
ref|WP_035228208.1|  xylose isomerase                                 72.0    9e-12   
ref|WP_003566656.1|  xylose isomerase                                 72.0    9e-12   
ref|WP_012485272.1|  xylose isomerase                                 72.0    9e-12   
ref|WP_003516221.1|  MULTISPECIES: xylose isomerase                   72.0    9e-12   
ref|WP_038033066.1|  MULTISPECIES: xylose isomerase                   72.0    9e-12   
ref|WP_038148004.1|  xylose isomerase                                 72.0    9e-12   
ref|WP_037141412.1|  xylose isomerase                                 72.0    9e-12   
ref|XP_005973117.1|  PREDICTED: xylose isomerase-like                 72.0    9e-12   
ref|WP_027381263.1|  xylose isomerase                                 72.0    9e-12   
gb|KHC94878.1|  xylose isomerase                                      72.0    1e-11   
gb|AEI87757.1|  xylose isomerase                                      72.0    1e-11   
ref|WP_029688173.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_004399926.1|  xylose isomerase                                 72.0    1e-11   
gb|EPH66201.1|  xylose isomerase                                      72.0    1e-11   
gb|EGC69929.1|  xylose isomerase                                      72.0    1e-11   
ref|WP_012310984.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_004677995.1|  xylose isomerase                                 72.0    1e-11   
gb|EFS04172.1|  xylose isomerase                                      67.0    1e-11   
ref|WP_022562745.1|  D-xylose isomerase (D-xylulose keto-isomerase)   72.0    1e-11   
ref|WP_004445208.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
gb|EPH88597.1|  xylose isomerase                                      72.0    1e-11   
ref|WP_012994345.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_013570854.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_003868244.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_009051955.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_013877022.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_038545395.1|  xylose isomerase                                 72.0    1e-11   
ref|XP_004356776.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_003869013.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_037092301.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_029715011.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_042505772.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_042890500.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_007956865.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_005228447.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_008380597.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_022829574.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_034872124.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_034858628.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_038538799.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_007841615.1|  MULTISPECIES: xylose isomerase                   72.0    1e-11   
ref|WP_006569355.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_018931128.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_042719664.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_021852289.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_026564802.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_042617651.1|  xylose isomerase                                 72.0    1e-11   
ref|WP_010245089.1|  xylose isomerase                                 72.0    1e-11   



>ref|XP_006343543.1| PREDICTED: xylose isomerase-like [Solanum tuberosum]
Length=481

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  375
            M +   GK L  L CLNV+S++V+AA PPTCPAD  SDC S SGEWEGEFFPGIPKI+YE
Sbjct  1    MRERNVGKCLLFLLCLNVVSSVVIAAAPPTCPADTGSDCGSDSGEWEGEFFPGIPKIEYE  60

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLSFKWYNAEEEILG+KMKDWMRFSVAFWHTFR
Sbjct  61   GPSSKNPLSFKWYNAEEEILGEKMKDWMRFSVAFWHTFR  99



>gb|KDP43806.1| hypothetical protein JCGZ_23014 [Jatropha curcas]
Length=477

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M  GK+L LLFCLN+++++V+A GPPTCPAD+  +C SGS EW+GEFFPG+PKIKYEGPS
Sbjct  1    MKGGKILLLLFCLNIVASLVIADGPPTCPADLGGEC-SGSDEWKGEFFPGVPKIKYEGPS  59

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL+FKWYNAEEEILGKKMKDWMRFSVAFWHTFR
Sbjct  60   SKNPLAFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  95



>ref|XP_004242672.1| PREDICTED: xylose isomerase [Solanum lycopersicum]
Length=481

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  375
            M +   GK    L CLNV+S++VMAA PPTCPAD  S C S SGEW+GEFFPGIPKIKYE
Sbjct  1    MRERNVGKCSLFLLCLNVVSSVVMAAAPPTCPADTGSGCGSDSGEWDGEFFPGIPKIKYE  60

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLSFKWYNAEEE+LG+KMKDWMRFSVAFWHTFR
Sbjct  61   GPSSKNPLSFKWYNAEEEVLGEKMKDWMRFSVAFWHTFR  99



>ref|XP_009801815.1| PREDICTED: xylose isomerase [Nicotiana sylvestris]
Length=481

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  375
            MI+   GK L LL CLN +SNIV AA PPTCPADI SDC S SGEWEGEFFPGIPKIKYE
Sbjct  1    MIERNLGKCLLLLLCLNAVSNIVTAAAPPTCPADIGSDCGSDSGEWEGEFFPGIPKIKYE  60

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR
Sbjct  61   GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  99



>ref|XP_009606829.1| PREDICTED: xylose isomerase [Nicotiana tomentosiformis]
Length=481

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  375
            MI+   GK L LL CLNV+SNIV AA PPTCPADI SDC   SGEWEGEFFPGIPKIKYE
Sbjct  1    MIERNLGKCLLLLLCLNVVSNIVTAAAPPTCPADIGSDCGGDSGEWEGEFFPGIPKIKYE  60

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR
Sbjct  61   GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  99



>gb|EYU42440.1| hypothetical protein MIMGU_mgv1a0056112mg, partial [Erythranthe 
guttata]
 gb|EYU42441.1| hypothetical protein MIMGU_mgv1a0056112mg, partial [Erythranthe 
guttata]
Length=216

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M   K L  L  LN +SN+V + GPPTCPADI S+C  GS EWEGEFFPGIP IKYEGPS
Sbjct  1    MKIAKFLLFLLSLNTVSNLVTSVGPPTCPADIESNCGGGS-EWEGEFFPGIPNIKYEGPS  59

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKN LSFKWYNAEEEILGKKMKDWMRFS+AFWHTFR
Sbjct  60   SKNHLSFKWYNAEEEILGKKMKDWMRFSIAFWHTFR  95



>ref|XP_002324488.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
 gb|EEF03053.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
Length=477

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M  G++L LL C +VI+  V AAGPPTCPAD+   C S SGEWEGEFFPGIPKIKYEGPS
Sbjct  1    MKGGRILLLLVCSSVITLGVFAAGPPTCPADLGGKC-SDSGEWEGEFFPGIPKIKYEGPS  59

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL+FKWYNAEEEILGKKMKDWMRFS+AFWHTFR
Sbjct  60   SKNPLAFKWYNAEEEILGKKMKDWMRFSIAFWHTFR  95



>gb|EYU34279.1| hypothetical protein MIMGU_mgv1a005575mg [Erythranthe guttata]
Length=478

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M + K + LL  LNV+ N V A GPPTCPA + SDC++ S EWEGEFFPG+PKIKYEGPS
Sbjct  1    MKSAKFVILLLTLNVVYNTVTAVGPPTCPATVGSDCSASSSEWEGEFFPGVPKIKYEGPS  60

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKN L+FKWYNAEEEILGK MKDWMRFSVAFWHTFR
Sbjct  61   SKNHLAFKWYNAEEEILGKTMKDWMRFSVAFWHTFR  96



>ref|XP_011069881.1| PREDICTED: xylose isomerase-like [Sesamum indicum]
Length=475

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 84/96 (88%), Gaps = 3/96 (3%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M + K L LL  LNV+SN+VMAA PPTCPA + SDCA+   EW+GEFFPGIPKIKYEGPS
Sbjct  1    MKSAKFLLLLISLNVVSNLVMAA-PPTCPAHLGSDCATD--EWKGEFFPGIPKIKYEGPS  57

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL+FKWYNAEEEILGKKMKDWMRFSVAFWHTFR
Sbjct  58   SKNPLAFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  93



>ref|XP_002277520.2| PREDICTED: xylose isomerase [Vitis vinifera]
 ref|XP_010656801.1| PREDICTED: xylose isomerase [Vitis vinifera]
Length=478

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            MMAGKV   L CLNV+S  V+A+ P TCPAD  S     S EWEGEFFPGIPKIKYEGPS
Sbjct  1    MMAGKVFLFLLCLNVVSFAVIASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPS  60

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPLS+KWYNA+EEILGKKMKDWMRFSVAFWHTFR
Sbjct  61   SKNPLSYKWYNADEEILGKKMKDWMRFSVAFWHTFR  96



>ref|XP_011018165.1| PREDICTED: xylose isomerase [Populus euphratica]
 ref|XP_011018166.1| PREDICTED: xylose isomerase [Populus euphratica]
Length=477

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M  G++L LL C +VI+  V AAGPPTCPAD+   C S S EWEGEFFPGIPKIKYEGPS
Sbjct  1    MKGGRILLLLVCSSVITLGVFAAGPPTCPADLGGKC-SDSEEWEGEFFPGIPKIKYEGPS  59

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL+FKWYNAEEEILGKKMKDWMRFS+AFWHTFR
Sbjct  60   SKNPLAFKWYNAEEEILGKKMKDWMRFSIAFWHTFR  95



>emb|CBI17768.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            MMAGKV   L CLNV+S  V+A+ P TCPAD  S     S EWEGEFFPGIPKIKYEGPS
Sbjct  49   MMAGKVFLFLLCLNVVSFAVIASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPS  108

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPLS+KWYNA+EEILGKKMKDWMRFSVAFWHTFR
Sbjct  109  SKNPLSYKWYNADEEILGKKMKDWMRFSVAFWHTFR  144



>ref|XP_011079316.1| PREDICTED: xylose isomerase [Sesamum indicum]
 ref|XP_011079317.1| PREDICTED: xylose isomerase [Sesamum indicum]
Length=477

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  253  SNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEI  432
            SNIV AA PPTCPADI SDCA+ SGEWEGEFFPGIP+IKYEGPSSKNPL+FKWYNAEEEI
Sbjct  17   SNIV-AAAPPTCPADIGSDCATSSGEWEGEFFPGIPEIKYEGPSSKNPLAFKWYNAEEEI  75

Query  433  LGKKMKDWMRFSVAFWHTFR  492
            LGKKMKDWMRFSVAFWHTFR
Sbjct  76   LGKKMKDWMRFSVAFWHTFR  95



>emb|CDP02939.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M A K+L L  CL+++ N+V+A GPPTCPAD+ S CAS S EW+GEFFPGIPKIKYEGP 
Sbjct  1    MKAWKILSLCLCLSLVLNVVIAVGPPTCPADVGSGCASDSDEWQGEFFPGIPKIKYEGPK  60

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL++KWYNA+EEILGKKMKDWMRFSVAFWHTFR
Sbjct  61   SKNPLAYKWYNADEEILGKKMKDWMRFSVAFWHTFR  96



>ref|XP_007011130.1| Xylose isomerase family protein isoform 4 [Theobroma cacao]
 gb|EOY19940.1| Xylose isomerase family protein isoform 4 [Theobroma cacao]
Length=414

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGEFFPGIPKIKYEG SS
Sbjct  8    MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGEFFPGIPKIKYEGTSS  65

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  66   KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  100



>ref|XP_007011129.1| Xylose isomerase family protein isoform 3 [Theobroma cacao]
 gb|EOY19939.1| Xylose isomerase family protein isoform 3 [Theobroma cacao]
Length=409

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGEFFPGIPKIKYEG SS
Sbjct  8    MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGEFFPGIPKIKYEGTSS  65

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  66   KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  100



>ref|XP_007011127.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY19937.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
Length=538

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGEFFPGIPKIKYEG SS
Sbjct  64   MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGEFFPGIPKIKYEGTSS  121

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  122  KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  156



>ref|XP_004297371.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
 ref|XP_011463128.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
Length=478

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 82/99 (83%), Gaps = 4/99 (4%)
 Frame = +1

Query  199  IDMMAGKVLFLLFCLNV-ISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  375
            + M A K+L LL C++  I  +   AGP TCPAD+ SDC + SGEW+GEFFP IPKIKYE
Sbjct  1    MKMKAEKILLLLVCVSFWIFGVT--AGPQTCPADLESDC-NDSGEWKGEFFPEIPKIKYE  57

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLS+KWYNAEEEILGKKMKDWMRFSVAFWHTFR
Sbjct  58   GPSSKNPLSYKWYNAEEEILGKKMKDWMRFSVAFWHTFR  96



>ref|XP_002532409.1| Xylose isomerase, putative [Ricinus communis]
 gb|EEF29973.1| Xylose isomerase, putative [Ricinus communis]
Length=477

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M  G +L LL CLN +++ V+AAGPPTCPAD+   CA  S EW+GEFFPGIPKIKYEGPS
Sbjct  1    MKGGWILLLLLCLNTVTSGVIAAGPPTCPADLGGKCAD-SDEWKGEFFPGIPKIKYEGPS  59

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL++KWYNAEEEILGKKMKDWMRFS+AFWHTFR
Sbjct  60   SKNPLAYKWYNAEEEILGKKMKDWMRFSIAFWHTFR  95



>ref|XP_010102993.1| Xylose isomerase [Morus notabilis]
 gb|EXB94560.1| Xylose isomerase [Morus notabilis]
Length=523

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  187  SRLMIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKI  366
            S   + M   ++L L+ CLN+++   +  GPPTCPA++ SDC   S EW+GEFFPGIPKI
Sbjct  42   SMRTMKMKPVEILLLVLCLNIVA-FGVNGGPPTCPANLESDCGD-SDEWKGEFFPGIPKI  99

Query  367  KYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KYEGPSSKNPL+FKWYNAEE ILGKKMKDW RFSVAFWHTFR
Sbjct  100  KYEGPSSKNPLAFKWYNAEEVILGKKMKDWFRFSVAFWHTFR  141



>gb|KJB60238.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
 gb|KJB60242.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=475

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L L+  +N    IV A  P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAAFLIVNAV-PETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  58

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFR  93



>gb|KJB60241.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=465

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L L+  +N    IV A  P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAAFLIVNAV-PETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  58

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFR  93



>gb|KJB60239.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L L+  +N    IV A  P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAAFLIVNAV-PETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  58

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFR  93



>ref|XP_010259769.1| PREDICTED: xylose isomerase isoform X2 [Nelumbo nucifera]
Length=479

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +1

Query  262  VMAAGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILG  438
            V+A GPPTCPAD  ++C+ S SGEWEGEFFPGIPKIKYEGPSSKNPL+FKWYNA EEILG
Sbjct  20   VIATGPPTCPADHITECSGSDSGEWEGEFFPGIPKIKYEGPSSKNPLAFKWYNANEEILG  79

Query  439  KKMKDWMRFSVAFWHTFR  492
            KKMKDW+RFSVAFWHTFR
Sbjct  80   KKMKDWLRFSVAFWHTFR  97



>ref|XP_010259768.1| PREDICTED: xylose isomerase isoform X1 [Nelumbo nucifera]
Length=515

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +1

Query  262  VMAAGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILG  438
            V+A GPPTCPAD  ++C+ S SGEWEGEFFPGIPKIKYEGPSSKNPL+FKWYNA EEILG
Sbjct  56   VIATGPPTCPADHITECSGSDSGEWEGEFFPGIPKIKYEGPSSKNPLAFKWYNANEEILG  115

Query  439  KKMKDWMRFSVAFWHTFR  492
            KKMKDW+RFSVAFWHTFR
Sbjct  116  KKMKDWLRFSVAFWHTFR  133



>ref|XP_010065877.1| PREDICTED: xylose isomerase-like isoform X2 [Eucalyptus grandis]
Length=308

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  372
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  373  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  98



>gb|KHG02217.1| Xylose isomerase -like protein [Gossypium arboreum]
Length=475

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L L+  +N +  IV A  P TCPAD+   C    GEWEGEFFP +PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAVFFIVNAV-PETCPADLGGKCGE-DGEWEGEFFPEVPKIKYEGPSS  58

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFR  93



>gb|KJB60240.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L L+  +N  +  ++ A P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMN--AAFLINAVPETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  57

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  58   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFR  92



>ref|XP_010065878.1| PREDICTED: xylose isomerase-like isoform X3 [Eucalyptus grandis]
Length=480

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  372
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  373  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  98



>gb|KCW63564.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
 gb|KCW63565.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
Length=495

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  372
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  373  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  98



>ref|XP_010065874.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065875.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065876.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
Length=467

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  372
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  373  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  98



>ref|XP_006845583.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
 gb|ERN07258.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
Length=477

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +1

Query  220  VLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPL  399
            +L LL  L  I    +AA PPTCPA+I+S CA     W+GEFFPGIPKIKYEGPSSKNPL
Sbjct  6    ILRLLLSLTCILFSAVAANPPTCPANIDSGCADDV--WKGEFFPGIPKIKYEGPSSKNPL  63

Query  400  SFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++KWYNA+EEILGKKMKDW+RFSVAFWHTFR
Sbjct  64   AYKWYNADEEILGKKMKDWLRFSVAFWHTFR  94



>ref|XP_007222807.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
 gb|EMJ24006.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
Length=479

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 85/99 (86%), Gaps = 3/99 (3%)
 Frame = +1

Query  199  IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYE  375
            + M AG++L LL CLNV++  V+A GP TCPA D+ S C S S EW+GEFFPGIPKIKYE
Sbjct  1    MKMKAGRILLLLLCLNVVTFGVIA-GPQTCPASDLESGC-SDSEEWKGEFFPGIPKIKYE  58

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLSFKWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   GPSSKNPLSFKWYNAEEEILGKKMKDWLRFSVAFWHTFR  97



>dbj|BAJ34093.1| unnamed protein product [Thellungiella halophila]
Length=482

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  253  SNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEI  432
            ++ +++A PPTCPAD+   C+ GS +WEGEFFP IP+IKYEGPSSKNPL+++WYNAEEEI
Sbjct  20   ASFLVSADPPTCPADLGGKCSDGSDDWEGEFFPEIPQIKYEGPSSKNPLAYRWYNAEEEI  79

Query  433  LGKKMKDWMRFSVAFWHTFR  492
            LGKKMKDW RFSVAFWHTFR
Sbjct  80   LGKKMKDWFRFSVAFWHTFR  99



>ref|XP_006401183.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
 gb|ESQ42636.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
Length=482

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  253  SNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEI  432
            ++ +++A PPTCPAD+   C+ GS +WEGEFFP IP+IKYEGPSSKNPL+++WYNAEEEI
Sbjct  20   ASFLVSADPPTCPADLGGKCSDGSDDWEGEFFPEIPQIKYEGPSSKNPLAYRWYNAEEEI  79

Query  433  LGKKMKDWMRFSVAFWHTFR  492
            LGKKMKDW RFSVAFWHTFR
Sbjct  80   LGKKMKDWFRFSVAFWHTFR  99



>ref|XP_010414290.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=171

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M   +   LL CL + ++ +++A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS
Sbjct  1    MKKVEFFILLLCL-IAASFLVSADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPS  58

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +KNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  59   TKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_009417936.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +1

Query  262  VMAAGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILG  438
            V+A GP TCPA++ + C  GS + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILG
Sbjct  19   VIAEGPHTCPANLEAKCDGGSSDGWEGEFFPGIPKIKYEGPTSKNPLSYKWYNAEEEILG  78

Query  439  KKMKDWMRFSVAFWHTFR  492
            KKMKDW+RFSVAFWHTFR
Sbjct  79   KKMKDWLRFSVAFWHTFR  96



>ref|XP_008223675.1| PREDICTED: xylose isomerase [Prunus mume]
Length=479

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 3/99 (3%)
 Frame = +1

Query  199  IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYE  375
            + M AG++L LL CLNV++  V+A  P TCPA D+ S C S S EW+GEFFPGIPKIKYE
Sbjct  1    MKMKAGRILLLLLCLNVVTFGVIAV-PQTCPASDLESGC-SDSEEWKGEFFPGIPKIKYE  58

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKNPLSFKWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   GPSSKNPLSFKWYNAEEEILGKKMKDWLRFSVAFWHTFR  97



>ref|XP_008365436.1| PREDICTED: xylose isomerase-like [Malus domestica]
 ref|XP_008365437.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=477

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYEGP  381
            M AG++L LL CLNVI+  V+A   PTCPA D+ S C   S EWEGEFFPGIPKIKYEGP
Sbjct  1    MRAGRILLLLLCLNVITFGVIA-DSPTCPASDLGSGCGD-SDEWEGEFFPGIPKIKYEGP  58

Query  382  SSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            S+KNPL+FKWYNA+EEILGKKMKDWMRFSVAFWHTFR
Sbjct  59   STKNPLAFKWYNADEEILGKKMKDWMRFSVAFWHTFR  95



>ref|NP_851203.1| xylose isomerase [Arabidopsis thaliana]
 gb|AED96931.1| xylose isomerase [Arabidopsis thaliana]
Length=287

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M   +   LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPS
Sbjct  1    MKKVEFFMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPS  58

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_002864523.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40782.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL CL + ++ +++A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPSSKNPL+
Sbjct  7    FMLLLCL-IAASFLVSADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPSSKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_006658089.1| PREDICTED: xylose isomerase-like [Oryza brachyantha]
Length=480

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 2/76 (3%)
 Frame = +1

Query  271  AGPPTCPADINSDC--ASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
              P TCPAD++S C  A+ SG+WEGEFFPGIPKIKYEGPSSKNPL++KWYNAEE ILGKK
Sbjct  22   GAPQTCPADLDSKCDDAAASGDWEGEFFPGIPKIKYEGPSSKNPLAYKWYNAEEVILGKK  81

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  82   MKDWMRFSVAFWHTFR  97



>gb|AGV54617.1| xylose isomerase [Phaseolus vulgaris]
Length=480

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +1

Query  196  MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  375
            M+ M  G+ L L  CL V    V+A  P TCPA     C    G WEGEFFPGIP IKYE
Sbjct  1    MMKMKLGRTLLLFLCLKVFCYAVIAT-PQTCPASNVDKCGDSDG-WEGEFFPGIPTIKYE  58

Query  376  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            GPSSKN LSFKWYN EEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   GPSSKNQLSFKWYNPEEEILGKKMKDWLRFSVAFWHTFR  97



>ref|XP_008796227.1| PREDICTED: xylose isomerase isoform X1 [Phoenix dactylifera]
Length=529

 Score =   137 bits (346),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A P TCPA++ + C   S + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILGKKM
Sbjct  72   AAPQTCPANLEAKCNDASSDDWEGEFFPGIPKIKYEGPTSKNPLSYKWYNAEEEILGKKM  131

Query  448  KDWMRFSVAFWHTFR  492
            KDW RFSVAFWHTFR
Sbjct  132  KDWFRFSVAFWHTFR  146



>ref|XP_008452100.1| PREDICTED: xylose isomerase [Cucumis melo]
 ref|XP_008452108.1| PREDICTED: xylose isomerase [Cucumis melo]
Length=476

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 79/93 (85%), Gaps = 4/93 (4%)
 Frame = +1

Query  217  KVLFLLFCLNVISNIVMA-AGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKN  393
            ++  L+ CL  +  +V A A   TCPAD+NS+C S SG+WEG+FFPGIPKIKYEGP+SKN
Sbjct  5    EISVLVLCL--LGFVVGAIADSHTCPADLNSEC-SHSGDWEGDFFPGIPKIKYEGPTSKN  61

Query  394  PLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            PL++KWYNA+EEILGKKMKDWMRFSVA+WHTFR
Sbjct  62   PLAYKWYNADEEILGKKMKDWMRFSVAYWHTFR  94



>ref|XP_006453438.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
 ref|XP_006474142.1| PREDICTED: xylose isomerase-like [Citrus sinensis]
 gb|ESR66678.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
Length=478

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M A K+L LLFCLN++S++V+A  PPTC A+++S CA  S EW+GEFFPGIPKIKYEGPS
Sbjct  2    MEAQKILLLLFCLNLVSSLVIAGAPPTCAANLDSKCAD-SDEWKGEFFPGIPKIKYEGPS  60

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKN L+FKWYN EE ILGKKMKDWMRFSVAFWHTFR
Sbjct  61   SKNHLAFKWYNPEEVILGKKMKDWMRFSVAFWHTFR  96



>ref|XP_010102992.1| Xylose isomerase [Morus notabilis]
 gb|EXB94559.1| Xylose isomerase [Morus notabilis]
Length=482

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +1

Query  262  VMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGK  441
            ++  GPPTCPA++ SDC   S EW+GEFFPGIPKIKYEGPSSKNPL+FKWYNAEE ILGK
Sbjct  25   MINGGPPTCPANLESDCGD-SDEWKGEFFPGIPKIKYEGPSSKNPLAFKWYNAEEVILGK  83

Query  442  KMKDWMRFSVAFWHTFR  492
            KMKDW RFSVAFWHTFR
Sbjct  84   KMKDWFRFSVAFWHTFR  100



>ref|XP_009336656.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYEGP  381
            M AG++L LL CLNV++  V+A   PTCPA D+ S C   S EWEGEFFPGIPKIKYEGP
Sbjct  1    MKAGRILLLLLCLNVVTFGVIA-DLPTCPASDLGSGCGD-SDEWEGEFFPGIPKIKYEGP  58

Query  382  SSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            S+KNPL+FKWYNA+EEILGKKMKDWMRFSVAFWHTFR
Sbjct  59   STKNPLAFKWYNADEEILGKKMKDWMRFSVAFWHTFR  95



>ref|XP_009348411.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYEGP  381
            M AG++L LL CLNV++  V+A   PTCPA D+ S C   S EWEGEFFPGIPKIKYEGP
Sbjct  1    MKAGRILLLLLCLNVVTFGVIA-DLPTCPASDLGSGCGD-SDEWEGEFFPGIPKIKYEGP  58

Query  382  SSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            S+KNPL+FKWYNA+EEILGKKMKDWMRFSVAFWHTFR
Sbjct  59   STKNPLAFKWYNADEEILGKKMKDWMRFSVAFWHTFR  95



>dbj|BAE98492.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPSSKNPL+
Sbjct  7    FMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPSSKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|NP_568861.3| xylose isomerase [Arabidopsis thaliana]
 sp|Q9FKK7.2|XYLA_ARATH RecName: Full=Xylose isomerase [Arabidopsis thaliana]
 gb|AAM97134.1| expressed protein; supported by full length cDNA: Ceres: 122798 
[Arabidopsis thaliana]
 gb|AAP31951.1| At5g57655 [Arabidopsis thaliana]
 gb|AED96932.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPSSKNPL+
Sbjct  7    FMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPSSKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>dbj|BAB08802.1| xylose isomerase [Arabidopsis thaliana]
Length=472

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPSSKNPL+
Sbjct  7    FMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPSSKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_007154797.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
 gb|ESW26791.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
Length=479

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +1

Query  199  IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEG  378
            + M  G+ L L  CL V    V+A  P TCPA     C    G WEGEFFPGIP IKYEG
Sbjct  1    MKMKLGRTLLLFLCLKVFCYAVIAT-PQTCPASNVDKCGDSDG-WEGEFFPGIPTIKYEG  58

Query  379  PSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            PSSKN LSFKWYN EEEILGKKMKDW+RFSVAFWHTFR
Sbjct  59   PSSKNQLSFKWYNPEEEILGKKMKDWLRFSVAFWHTFR  96



>emb|CAN65150.1| hypothetical protein VITISV_037086 [Vitis vinifera]
Length=462

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  265  MAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            +A+ P TCPAD  S     S EWEGEFFPGIPKIKYEGPSSKNPLS+KWYNA+EEILGKK
Sbjct  5    IASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPSSKNPLSYKWYNADEEILGKK  64

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  65   MKDWMRFSVAFWHTFR  80



>emb|CDY25894.1| BnaC09g32660D [Brassica napus]
Length=491

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 4/94 (4%)
 Frame = +1

Query  217  KVLFLLF--CLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSK  390
            KV F +F  CLN  S +V +A   TCPAD+   C S S EW+GEFFPGIP+IKYEGPSSK
Sbjct  17   KVCFFMFLLCLNAASFLV-SAESQTCPADLGGKC-SDSDEWQGEFFPGIPQIKYEGPSSK  74

Query  391  NPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            NPL+++WYNAEEEILGKKMK+W RFSVAFWHTFR
Sbjct  75   NPLAYRWYNAEEEILGKKMKEWFRFSVAFWHTFR  108



>ref|XP_004149070.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
 ref|XP_004166789.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
Length=476

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 1/74 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMK  450
            A   TCPAD++S+C S SG+WEGEFFPGIPKIKYEGP+SKNPL++KWYNA+EEILGKKMK
Sbjct  22   ANSHTCPADLSSEC-SHSGDWEGEFFPGIPKIKYEGPTSKNPLAYKWYNADEEILGKKMK  80

Query  451  DWMRFSVAFWHTFR  492
            DWMRFSVA+WHTFR
Sbjct  81   DWMRFSVAYWHTFR  94



>gb|KGN61107.1| hypothetical protein Csa_2G049960 [Cucumis sativus]
Length=476

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 1/74 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMK  450
            A   TCPAD++S+C S SG+WEGEFFPGIPKIKYEGP+SKNPL++KWYNA+EEILGKKMK
Sbjct  22   ANSHTCPADLSSEC-SHSGDWEGEFFPGIPKIKYEGPTSKNPLAYKWYNADEEILGKKMK  80

Query  451  DWMRFSVAFWHTFR  492
            DWMRFSVA+WHTFR
Sbjct  81   DWMRFSVAYWHTFR  94



>ref|XP_009120281.1| PREDICTED: xylose isomerase [Brassica rapa]
 ref|XP_009120282.1| PREDICTED: xylose isomerase [Brassica rapa]
Length=477

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  220  VLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPL  399
            +  +L CLN  S +V +A   TCPAD+   C S S +W+GEFFPGIP+I+YEGPSSKNPL
Sbjct  6    LFMILVCLNAASFLV-SAESQTCPADLGGKC-SDSDDWQGEFFPGIPQIRYEGPSSKNPL  63

Query  400  SFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +++WYNAEEE+LGKKMKDW RFSVAFWHTFR
Sbjct  64   AYRWYNAEEEVLGKKMKDWFRFSVAFWHTFR  94



>ref|XP_006280396.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
 gb|EOA13294.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
Length=477

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL CL + ++ ++ A PPTCPAD++  C S S +W+G+FFP IP IKYEGPSSKNPL+
Sbjct  7    FMLLLCL-IAASFLVCADPPTCPADLDGKC-SDSDDWKGDFFPEIPNIKYEGPSSKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>gb|AAM61519.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKY+GPSSKNPL+
Sbjct  7    FMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYKGPSSKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_010452612.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL CL + ++ +++A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS+KNPL+
Sbjct  7    FMLLLCL-IGASFLVSADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPSTKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_010483295.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL CL + ++ ++ A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS+KNPL+
Sbjct  7    FILLLCL-IAASFLVCADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPSTKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>gb|EEC82655.1| hypothetical protein OsI_27268 [Oryza sativa Indica Group]
 gb|EEE67782.1| hypothetical protein OsJ_25511 [Oryza sativa Japonica Group]
Length=478

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPAD++S C  + SG+WEGEFFPGIPKIKYEGPSSKNPL++KWYNAEE ILGKKM
Sbjct  21   ATQQTCPADLDSKCGDAASGDWEGEFFPGIPKIKYEGPSSKNPLAYKWYNAEEVILGKKM  80

Query  448  KDWMRFSVAFWHTFR  492
            KDWMRFSVAFWHTFR
Sbjct  81   KDWMRFSVAFWHTFR  95



>ref|NP_001060585.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAC83596.1| putative xylose isomerase [Oryza sativa Japonica Group]
 dbj|BAF22499.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAG92890.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPAD++S C  + SG+WEGEFFPGIPKIKYEGPSSKNPL++KWYNAEE ILGKKM
Sbjct  22   ATQQTCPADLDSKCGDAASGDWEGEFFPGIPKIKYEGPSSKNPLAYKWYNAEEVILGKKM  81

Query  448  KDWMRFSVAFWHTFR  492
            KDWMRFSVAFWHTFR
Sbjct  82   KDWMRFSVAFWHTFR  96



>emb|CDY49729.1| BnaA10g11590D [Brassica napus]
Length=477

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  220  VLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPL  399
            +  +L CLN  S +V +A   TCPAD+   C S S +W+GEFFPGIP+IKYEGP+SKNPL
Sbjct  6    LFMILVCLNAASFLV-SAESQTCPADLGGKC-SDSDDWQGEFFPGIPQIKYEGPASKNPL  63

Query  400  SFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +++WYNAEEE+LGKKMKDW RFSVAFWHTFR
Sbjct  64   AYRWYNAEEEVLGKKMKDWFRFSVAFWHTFR  94



>ref|XP_004958625.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPAD++S C  G SG+WEGEFFPGIPKI YEGP+SKNPL++KWYNAEE ILGKKM
Sbjct  23   AAQQTCPADLDSKCEDGASGDWEGEFFPGIPKINYEGPTSKNPLAYKWYNAEEVILGKKM  82

Query  448  KDWMRFSVAFWHTFR  492
            KDWMRFSVAFWHTFR
Sbjct  83   KDWMRFSVAFWHTFR  97



>ref|XP_010443465.1| PREDICTED: xylose isomerase [Camelina sativa]
Length=477

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
              LL CL + ++ ++ A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS+KNPL+
Sbjct  7    FMLLLCL-IGASFLVCADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPSTKNPLA  64

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            ++WYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFR  94



>ref|XP_003562496.1| PREDICTED: xylose isomerase [Brachypodium distachyon]
Length=479

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPS  384
            M G  L  L   + +      A   TCPAD+++ C  G S +WEGEFFPGIPKIKYEGP+
Sbjct  1    MKGAELLTLLVASFLCLSAAIAAQETCPADLDAKCGDGASDDWEGEFFPGIPKIKYEGPT  60

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SK PLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  61   SKKPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFR  96



>ref|XP_008650947.1| PREDICTED: uncharacterized protein LOC100194128 isoform X2 [Zea 
mays]
Length=533

 Score =   134 bits (336),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  75   AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  134

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  135  MKDWMRFSVAFWHTFR  150



>tpg|DAA64057.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=559

 Score =   133 bits (335),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  101  AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  160

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  161  MKDWMRFSVAFWHTFR  176



>ref|XP_008796228.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796229.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796230.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
Length=483

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A P TCPA++ + C   S + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILGKKM
Sbjct  26   AAPQTCPANLEAKCNDASSDDWEGEFFPGIPKIKYEGPTSKNPLSYKWYNAEEEILGKKM  85

Query  448  KDWMRFSVAFWHTFR  492
            KDW RFSVAFWHTFR
Sbjct  86   KDWFRFSVAFWHTFR  100



>gb|KDO62435.1| hypothetical protein CISIN_1g0373932mg, partial [Citrus sinensis]
Length=487

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +1

Query  262  VMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGK  441
            V+A  PPTC A+++S CA  S EW+GEFFPGIPKIKYEGPSSKN L+FKWYN EE ILGK
Sbjct  30   VIAGAPPTCAANLDSKCAD-SDEWKGEFFPGIPKIKYEGPSSKNHLAFKWYNPEEVILGK  88

Query  442  KMKDWMRFSVAFWHTFR  492
            KMKDWMRFSVAFWHTFR
Sbjct  89   KMKDWMRFSVAFWHTFR  105



>ref|XP_010938719.1| PREDICTED: xylose isomerase [Elaeis guineensis]
Length=479

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A P TCPA++ + C   S + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILGKKM
Sbjct  22   ATPQTCPANLEAKCNDASSDDWEGEFFPGIPKIKYEGPASKNPLSYKWYNAEEEILGKKM  81

Query  448  KDWMRFSVAFWHTFR  492
            KDW RFSVAFWHTFR
Sbjct  82   KDWFRFSVAFWHTFR  96



>ref|XP_004958079.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 68/87 (78%), Gaps = 6/87 (7%)
 Frame = +1

Query  235  FCLNVISNIVMAAGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPSSKNPLSFKW  411
             CL+ +      A   TCPAD++  C  G S +WEGEFFPGIPKIKYEGP SKNPL++KW
Sbjct  16   LCLSAV-----IAAQQTCPADLDRKCEGGASDDWEGEFFPGIPKIKYEGPKSKNPLAYKW  70

Query  412  YNAEEEILGKKMKDWMRFSVAFWHTFR  492
            YNAEE ILGKKMKDWMRFSVAFWHTFR
Sbjct  71   YNAEEVILGKKMKDWMRFSVAFWHTFR  97



>ref|XP_010688509.1| PREDICTED: xylose isomerase isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +1

Query  181  SHSRLMIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIP  360
            S +R+ I M     L LL C  ++   V+A GPPTCPA+  S C  G   WEGEFFP IP
Sbjct  8    SKNRMRIRMN----LLLLCCFTLVLTAVVAVGPPTCPAE-GSGC--GDDGWEGEFFPEIP  60

Query  361  KIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KIKYEGP SKN L+FK+YNAEE ILGKKMKDW RFSVAFWHTFR
Sbjct  61   KIKYEGPKSKNHLAFKYYNAEEVILGKKMKDWFRFSVAFWHTFR  104



>ref|XP_010688508.1| PREDICTED: xylose isomerase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = +1

Query  181  SHSRLMIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIP  360
            S +R+ I M     L LL C  ++   V+A GPPTCPA+  S C  G   WEGEFFP IP
Sbjct  39   SKNRMRIRMN----LLLLCCFTLVLTAVVAVGPPTCPAE-GSGC--GDDGWEGEFFPEIP  91

Query  361  KIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KIKYEGP SKN L+FK+YNAEE ILGKKMKDW RFSVAFWHTFR
Sbjct  92   KIKYEGPKSKNHLAFKYYNAEEVILGKKMKDWFRFSVAFWHTFR  135



>gb|ACU18251.1| unknown [Glycine max]
Length=203

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  235  FCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWY  414
            FC  VI        P TCPA+ N D    S EW+GEFFP IPKIKYEGPSSKN LSFKWY
Sbjct  19   FCYAVI------GAPQTCPAN-NEDKCGDSDEWKGEFFPDIPKIKYEGPSSKNVLSFKWY  71

Query  415  NAEEEILGKKMKDWMRFSVAFWHTFR  492
            NAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  72   NAEEEILGKKMKDWLRFSVAFWHTFR  97



>gb|ACG35698.1| xylose isomerase [Zea mays]
Length=484

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  26   AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  85

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  86   MKDWMRFSVAFWHTFR  101



>ref|NP_001132653.1| uncharacterized protein LOC100194128 precursor [Zea mays]
 ref|XP_008650948.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 ref|XP_008650949.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 gb|ACF81585.1| unknown [Zea mays]
Length=484

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  26   AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  85

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  86   MKDWMRFSVAFWHTFR  101



>ref|XP_010688511.1| PREDICTED: xylose isomerase isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +1

Query  223  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  402
            L LL C  ++   V+A GPPTCPA+  S C  G   WEGEFFP IPKIKYEGP SKN L+
Sbjct  7    LLLLCCFTLVLTAVVAVGPPTCPAE-GSGC--GDDGWEGEFFPEIPKIKYEGPKSKNHLA  63

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FK+YNAEE ILGKKMKDW RFSVAFWHTFR
Sbjct  64   FKYYNAEEVILGKKMKDWFRFSVAFWHTFR  93



>ref|XP_010539451.1| PREDICTED: xylose isomerase [Tarenaya hassleriana]
Length=477

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +1

Query  253  SNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEI  432
            ++ ++ A  PTCPAD+   C   S +W+GEFF GIPKIKYEGPSSKNPL+FKWYNAEEEI
Sbjct  16   ASFLVFAEAPTCPADLGGKC-DDSDDWKGEFFAGIPKIKYEGPSSKNPLAFKWYNAEEEI  74

Query  433  LGKKMKDWMRFSVAFWHTFR  492
            LGKKMKDW RFSVAFWHTFR
Sbjct  75   LGKKMKDWFRFSVAFWHTFR  94



>tpg|DAA64056.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=456

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  101  AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  160

Query  445  MKDWMRFSVAFWHTFR  492
            MKDWMRFSVAFWHTFR
Sbjct  161  MKDWMRFSVAFWHTFR  176



>gb|EPS67638.1| xylose isomerase [Genlisea aurea]
Length=472

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 9/94 (10%)
 Frame = +1

Query  217  KVLFLLFCLNVIS--NIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSK  390
            K +F +F +++++  N+  AA PPTCPAD+ S C       EGEFFPG+P I YEGPSS 
Sbjct  3    KAVFSVFIISLLAVPNVTNAAVPPTCPADLESSC-------EGEFFPGVPNILYEGPSSN  55

Query  391  NPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            NPL+FKWYNAEE ILGKKMK+W+RFSVAFWHTFR
Sbjct  56   NPLAFKWYNAEEVILGKKMKEWLRFSVAFWHTFR  89



>ref|XP_003549495.1| PREDICTED: xylose isomerase [Glycine max]
Length=480

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  235  FCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWY  414
            FC  VI        P TCPA+ N D    S EW+GEFFP IPKIKYEGPSSKN LSFKWY
Sbjct  19   FCYAVI------GAPQTCPAN-NEDKCGDSDEWKGEFFPDIPKIKYEGPSSKNVLSFKWY  71

Query  415  NAEEEILGKKMKDWMRFSVAFWHTFR  492
            NAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  72   NAEEEILGKKMKDWLRFSVAFWHTFR  97



>gb|KHN17567.1| Xylose isomerase [Glycine soja]
Length=480

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  235  FCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWY  414
            FC  VI        P TCPA+ N D    S EW+GEFFP IPKIKYEGPSSKN LSFKWY
Sbjct  19   FCYAVI------GAPQTCPAN-NEDKCGDSDEWKGEFFPDIPKIKYEGPSSKNVLSFKWY  71

Query  415  NAEEEILGKKMKDWMRFSVAFWHTFR  492
            NAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  72   NAEEEILGKKMKDWLRFSVAFWHTFR  97



>ref|NP_001132889.1| putative xylose isomerase family protein precursor [Zea mays]
 gb|ACF81922.1| unknown [Zea mays]
 gb|ACG41148.1| xylose isomerase [Zea mays]
 tpg|DAA41688.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=482

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +1

Query  283  TCPADINSDCASGS-GEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWM  459
            TCPAD++S C  G+  +WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKKMKDWM
Sbjct  29   TCPADLDSKCDGGAPDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKKMKDWM  88

Query  460  RFSVAFWHTFR  492
            RFSVAFWHTFR
Sbjct  89   RFSVAFWHTFR  99



>ref|XP_009391575.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  250  ISNIVMAAGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEE  426
            + + V A G  TC A++ + C  GS + W+GEFFPGI KIKYEGP+SKNPLS+KWYNAEE
Sbjct  15   VVSTVNAEGQQTCAANLEAKCDGGSSDGWKGEFFPGISKIKYEGPTSKNPLSYKWYNAEE  74

Query  427  EILGKKMKDWMRFSVAFWHTFR  492
            EILGKKMKDW RFSVAFWHTFR
Sbjct  75   EILGKKMKDWFRFSVAFWHTFR  96



>gb|ACG42142.1| xylose isomerase [Zea mays]
Length=484

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +1

Query  283  TCPADINSDCASGS-GEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWM  459
            TCPAD++S C  G+  +WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKKMKDWM
Sbjct  31   TCPADLDSKCDGGAPDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKKMKDWM  90

Query  460  RFSVAFWHTFR  492
            RFSVAFWHTFR
Sbjct  91   RFSVAFWHTFR  101



>gb|AFK33995.1| unknown [Lotus japonicus]
Length=173

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +1

Query  199  IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEG  378
            + M  G++L LL CL V    V+ A P TCPA+    C   S EW+GEFFPGI KIKYEG
Sbjct  1    MKMKPGEILLLLLCLKVFIYAVIDA-PETCPANDLGKCGD-SDEWKGEFFPGISKIKYEG  58

Query  379  PSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            PSSKNPLSFKWYNAEEEILGKKMKDW RFSVAFWHTFR
Sbjct  59   PSSKNPLSFKWYNAEEEILGKKMKDWFRFSVAFWHTFR  96



>ref|XP_003610179.1| Xylose isomerase [Medicago truncatula]
Length=478

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M +GK+L LL   NV     +   P TCPA  ++ C   S +W+ EFFPGI KIKYEGPS
Sbjct  1    MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGD-SDDWKAEFFPGISKIKYEGPS  59

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPLSFKWYN EEEILGKKMKDW RFSVAFWHTFR
Sbjct  60   SKNPLSFKWYNPEEEILGKKMKDWFRFSVAFWHTFR  95



>gb|AES92376.2| xylose isomerase [Medicago truncatula]
Length=480

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M +GK+L LL   NV     +   P TCPA  ++ C   S +W+ EFFPGI KIKYEGPS
Sbjct  3    MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGD-SDDWKAEFFPGISKIKYEGPS  61

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPLSFKWYN EEEILGKKMKDW RFSVAFWHTFR
Sbjct  62   SKNPLSFKWYNPEEEILGKKMKDWFRFSVAFWHTFR  97



>ref|XP_004507817.1| PREDICTED: xylose isomerase-like isoform X3 [Cicer arietinum]
Length=479

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  277  PPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDW  456
            P TCPA  N   +  S EWEGEFFPGI KIKYEGPSSKNPLSFKWYNAEEEI+GKKMKDW
Sbjct  26   PQTCPA-TNVGKSGDSDEWEGEFFPGISKIKYEGPSSKNPLSFKWYNAEEEIIGKKMKDW  84

Query  457  MRFSVAFWHTFR  492
             RFSVAFWHTFR
Sbjct  85   FRFSVAFWHTFR  96



>ref|XP_004507815.1| PREDICTED: xylose isomerase-like isoform X1 [Cicer arietinum]
 ref|XP_004507816.1| PREDICTED: xylose isomerase-like isoform X2 [Cicer arietinum]
Length=491

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  277  PPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDW  456
            P TCPA  N   +  S EWEGEFFPGI KIKYEGPSSKNPLSFKWYNAEEEI+GKKMKDW
Sbjct  26   PQTCPA-TNVGKSGDSDEWEGEFFPGISKIKYEGPSSKNPLSFKWYNAEEEIIGKKMKDW  84

Query  457  MRFSVAFWHTFR  492
             RFSVAFWHTFR
Sbjct  85   FRFSVAFWHTFR  96



>gb|AFK39166.1| unknown [Medicago truncatula]
Length=480

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M +GK+L LL   NV     +   P TCPA  ++ C   S +W+ EFFPGI KIKYEGPS
Sbjct  3    MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGD-SDDWKAEFFPGISKIKYEGPS  61

Query  385  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            SKNPLSFKW+N EEEILGKKMKDW RFSVAFWHTFR
Sbjct  62   SKNPLSFKWHNPEEEILGKKMKDWFRFSVAFWHTFR  97



>dbj|BAJ96683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPADI + C  + S +WEGEFFPGI KI YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  22   AAQETCPADIGAKCGDAASDDWEGEFFPGIAKINYEGPTSKKPLSYKWYNAEEVILGKKM  81

Query  448  KDWMRFSVAFWHTFR  492
            KDW+RFSVAFWHTFR
Sbjct  82   KDWLRFSVAFWHTFR  96



>emb|CAA64544.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
 prf||2209268A xylose isomerase
Length=479

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPADI + C  + S +WEGEFFPGI KI YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  22   AAQETCPADIGAKCTDAASDDWEGEFFPGIDKINYEGPTSKKPLSYKWYNAEEVILGKKM  81

Query  448  KDWMRFSVAFWHTFR  492
            KDW RFSVAFWHTFR
Sbjct  82   KDWFRFSVAFWHTFR  96



>sp|Q40082.1|XYLA_HORVU RecName: Full=Xylose isomerase [Hordeum vulgare]
 emb|CAA64545.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  271  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPADI + C  + S +WEGEFFPGI KI YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  22   AAQETCPADIGAKCTDAASDDWEGEFFPGIDKINYEGPTSKKPLSYKWYNAEEVILGKKM  81

Query  448  KDWMRFSVAFWHTFR  492
            KDW RFSVAFWHTFR
Sbjct  82   KDWFRFSVAFWHTFR  96



>emb|CDY58846.1| BnaA02g35220D [Brassica napus]
Length=221

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 70/104 (67%), Gaps = 10/104 (10%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE---  375
            M   K+  +  C N  +  +++A P TCPAD    C SGS +WEGEFFP IP IKYE   
Sbjct  1    MKKVKIFMIFLCFNA-AFFLVSAEPQTCPADSGGKC-SGSDDWEGEFFPEIPHIKYELSD  58

Query  376  -----GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
                 GP+S NPL++KWYNAEEEILGKKM DW RFSVAFW TFR
Sbjct  59   QNHFFGPNSSNPLAYKWYNAEEEILGKKMNDWFRFSVAFWLTFR  102



>ref|XP_007011128.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
 gb|EOY19938.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
Length=471

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 68/95 (72%), Gaps = 13/95 (14%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGE           G SS
Sbjct  8    MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGE-----------GTSS  54

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFR
Sbjct  55   KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFR  89



>gb|KJB68666.1| hypothetical protein B456_010G217000 [Gossypium raimondii]
Length=369

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +1

Query  208  MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  387
            MAGK+ ++  C+NVI  ++ AA    C A  ++ C S +GEW GEFFPGIPKIKYEGP +
Sbjct  1    MAGKISYIFLCMNVIP-LLAAAASQACSAQSDAKC-SQTGEWNGEFFPGIPKIKYEGPYT  58

Query  388  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KN  ++K YNAEE ILGKKMKDW+RFSVAFWHTFR
Sbjct  59   KNKFAYKSYNAEEVILGKKMKDWLRFSVAFWHTFR  93



>gb|KIZ04907.1| xylose isomerase [Monoraphidium neglectum]
Length=472

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +1

Query  268  AAGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  444
            +A PP   +  +  C+    GEW GEFFPGIPKIKYEGP S NPL+F++YNAEE I GK 
Sbjct  22   SAEPPADGSKADCGCSGDFKGEWYGEFFPGIPKIKYEGPKSTNPLAFRYYNAEEVISGKT  81

Query  445  MKDWMRFSVAFWHTFR  492
            MKDW+RFSVAFWHTFR
Sbjct  82   MKDWLRFSVAFWHTFR  97



>ref|XP_002991242.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
 gb|EFJ07670.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
Length=476

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  301  NSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFW  480
            +  C SG  E E EFFP I KI+YEGPSSKNPL+FKWYN EEEI GKKMKDW+RFSVAFW
Sbjct  30   DQTCGSGFQEGEVEFFPNISKIEYEGPSSKNPLAFKWYNPEEEIYGKKMKDWLRFSVAFW  89

Query  481  HTFR  492
            HTFR
Sbjct  90   HTFR  93



>ref|XP_002991182.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
 gb|EFJ07726.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
Length=478

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  301  NSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFW  480
            +  C SG  E E EFFP I KI+YEGPSSKNPL+FKWYN EEEI GKKMKDW+RFSVAFW
Sbjct  32   DQTCGSGFQEGEVEFFPNISKIEYEGPSSKNPLAFKWYNPEEEIYGKKMKDWLRFSVAFW  91

Query  481  HTFR  492
            HTFR
Sbjct  92   HTFR  95



>ref|XP_001774702.1| predicted protein [Physcomitrella patens]
 gb|EDQ60517.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +1

Query  229  LLFCLNVISNIVMAAGPPTCPADINSDCASGSG--EWEGEFFPGIPKIKYEGPSSKNPLS  402
            LLF + ++  ++  +G          D + GS   EWEGEFFP I  IKYEGP+S NPL+
Sbjct  4    LLFSVVLLVAVLSCSGQRVADITCGVDGSLGSDFQEWEGEFFPNISYIKYEGPASHNPLA  63

Query  403  FKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +K+YNAEE I GKKMKDW+RFSVAFWHTFR
Sbjct  64   YKYYNAEELIFGKKMKDWLRFSVAFWHTFR  93



>emb|CDY02747.1| BnaC02g11420D [Brassica napus]
Length=309

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  205  MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  384
            M   K+  +  C N  S +V +A P TCPAD    C SG  +WEGEFFP IP IKYEGP 
Sbjct  1    MKKVKIFMIFLCFNAASFLV-SADPQTCPADSGGKC-SGPDDWEGEFFPEIPHIKYEGPK  58

Query  385  SKNPLSFKWYNAEEEILGKKMK  450
            S NPL++KWYNAEEEILGKKMK
Sbjct  59   SSNPLTYKWYNAEEEILGKKMK  80



>gb|KHN34792.1| Xylose isomerase [Glycine soja]
Length=153

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  250  ISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEE  429
            ++N  M   P TC A+    C   S EWEGEFFPGIPKIKYEGPSSK+PLSFKWYNAEEE
Sbjct  1    MANKQMIGAPQTCAANDADKCGD-SDEWEGEFFPGIPKIKYEGPSSKSPLSFKWYNAEEE  59

Query  430  ILGKKMK  450
            ILGKKMK
Sbjct  60   ILGKKMK  66



>gb|AFG69667.1| hypothetical protein 2_5497_01, partial [Pinus taeda]
Length=164

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  361  KIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            KIKYEGP SKNPL+FKWYNAEEEILGKKMKDW+RFSV+FWHTFR
Sbjct  1    KIKYEGPLSKNPLAFKWYNAEEEILGKKMKDWLRFSVSFWHTFR  44



>ref|XP_005646804.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE22260.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
Length=471

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +1

Query  250  ISNIVMAAGPPTCPA--DINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAE  423
            ++ I++A    T PA   I  +C S  G +EGEFFPG+ KI YEGP S NP++F +YNA+
Sbjct  3    LTYILVALMLCTAPAWAAIQGECDS-RGLYEGEFFPGVGKIPYEGPDSTNPMAFHYYNAD  61

Query  424  EEILGKKMKDWMRFSVAFWHTFR  492
            E I+GK MK+W+RFSVAFWHT R
Sbjct  62   EVIMGKPMKEWLRFSVAFWHTMR  84



>gb|EMT06905.1| Xylose isomerase [Aegilops tauschii]
Length=450

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  271  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  447
            A   TCPADI++ C   + + WEGEFFPGI KI+YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  23   AAQETCPADIDAKCGDAASDGWEGEFFPGITKIRYEGPTSKKPLSYKWYNAEEVILGKKM  82

Query  448  K  450
            K
Sbjct  83   K  83



>emb|CDY03999.1| BnaC02g37140D [Brassica napus]
Length=101

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +1

Query  217  KVLFLLFCLNVISNI-VMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKN  393
            KV   + CL   + + +++A P TCPA+  + C SGSG+WEGEFFP IP IKYE   S N
Sbjct  3    KVEIFMICLCSYTALFLVSADPQTCPAESGAKC-SGSGDWEGEFFPEIPHIKYERLKSSN  61

Query  394  PLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            PLS+KWY+AEEEILG     +  FS   ++  R
Sbjct  62   PLSYKWYSAEEEILGSNPLAYKCFSTPIFNARR  94



>ref|WP_013701478.1| xylose isomerase [Treponema succinifaciens]
 gb|AEB14191.1| Xylose isomerase [Treponema succinifaciens DSM 2489]
Length=437

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI +IKYEGP SKNPL+FK+Y+AE+ ++GKKMKDW++F+VA+WH+F
Sbjct  9    EYFPGIGQIKYEGPESKNPLAFKYYDAEKVVMGKKMKDWLKFTVAYWHSF  58



>ref|WP_038172460.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=436

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            E FP IPKIKYEGP SKNPLSFK YNA+E + GKKMKD MRF VA+WH  R
Sbjct  3    EAFPDIPKIKYEGPKSKNPLSFKHYNADEVVAGKKMKDHMRFGVAYWHAMR  53



>ref|XP_008362076.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=571

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +1

Query  373  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            EGPS+KNPL+FKWYNA+EEILGKKMK+WMRFSVAFWHTFR
Sbjct  215  EGPSTKNPLAFKWYNADEEILGKKMKEWMRFSVAFWHTFR  254



>ref|WP_009959507.1| xylose isomerase [Verrucomicrobium spinosum]
Length=436

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            E FP IPKIKYEGP SKNPLSFK Y+A+E + GKKMKD MRF VA+WH  R
Sbjct  3    EAFPDIPKIKYEGPKSKNPLSFKHYHADEVVAGKKMKDHMRFGVAYWHAMR  53



>emb|CBK25455.2| unnamed protein product [Blastocystis hominis]
Length=435

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI  IKYEG +S N LSFKWYNAE+ +LGKKMKD +RF+V +WHTF
Sbjct  2    EYFPGISNIKYEGSASMNDLSFKWYNAEQVVLGKKMKDHLRFAVCYWHTF  51



>ref|WP_015707713.1| xylose isomerase [Treponema primitia]
 gb|AEF85442.1| xylose isomerase [Treponema primitia ZAS-2]
Length=446

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KI YEG  SKNPL+FK+Y+AE+ I GKK++DW+RF++A+WH+F
Sbjct  10   EFFPGIGKIPYEGSGSKNPLAFKYYDAEKTIRGKKLRDWLRFAIAYWHSF  59



>ref|WP_013109552.1| xylose isomerase [Planctomyces limnophilus]
 gb|ADG67121.1| xylose isomerase [Planctomyces limnophilus DSM 3776]
Length=437

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +FP I KI YEGP SKNPL+FK YNA+E+I G+ MKD +R+SVA+WHTFR
Sbjct  3    YFPEISKIVYEGPKSKNPLAFKHYNADEQIEGQSMKDLLRYSVAYWHTFR  52



>ref|XP_005764620.1| hypothetical protein EMIHUDRAFT_214014 [Emiliania huxleyi CCMP1516]
 gb|EOD12191.1| hypothetical protein EMIHUDRAFT_214014 [Emiliania huxleyi CCMP1516]
Length=147

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FFP I K++YEGPSS+NPL+FK Y  +E + G+ MK+W+RFS+A+WHT+R
Sbjct  34   FFPDIDKVRYEGPSSRNPLAFKQYAEDEVVAGRTMKEWLRFSIAYWHTWR  83



>emb|CAB76571.1| xylose isomerase [Piromyces sp. E2]
Length=437

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FP I KIK+EG  SKNPL+F +Y+AE+E++GKKMKDW+RF++A+WHT 
Sbjct  4    EYFPQIQKIKFEGKDSKNPLAFHYYDAEKEVMGKKMKDWLRFAMAWWHTL  53



>ref|WP_008761491.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EFI04598.1| xylose isomerase [Bacteroides sp. 1_1_14]
 emb|CDE80101.1| xylose isomerase [Bacteroides thetaiotaomicron CAG:40]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_024987508.1| xylose isomerase [Bacteroides acidifaciens]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_011107447.1| xylose isomerase [Bacteroides thetaiotaomicron]
 ref|NP_809706.1| xylose isomerase [Bacteroides thetaiotaomicron VPI-5482]
 sp|Q8A9M2.1|XYLA_BACTN RecName: Full=Xylose isomerase [Bacteroides thetaiotaomicron 
VPI-5482]
 gb|AAO75900.1| xylose isomerase [Bacteroides thetaiotaomicron VPI-5482]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_010538096.1| MULTISPECIES: xylose isomerase [Bacteroides]
 emb|CDC90990.1| xylose isomerase [Bacteroides faecis CAG:32]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_004295876.1| MULTISPECIES: xylose isomerase [Bacteroides]
 ref|YP_007791408.1| D-xylose isomerase [Bacteroides xylanisolvens XB1A]
 gb|EDO12033.1| xylose isomerase [Bacteroides ovatus ATCC 8483]
 gb|EEO52538.1| xylose isomerase [Bacteroides sp. D1]
 gb|EEO57842.1| xylose isomerase [Bacteroides sp. 2_2_4]
 gb|EEZ04374.1| xylose isomerase [Bacteroides sp. 2_1_22]
 gb|EFF53135.1| xylose isomerase [Bacteroides ovatus SD CMC 3f]
 gb|EFF55785.1| xylose isomerase [Bacteroides xylanisolvens SD CC 2a]
 gb|EFG12983.1| xylose isomerase [Bacteroides xylanisolvens SD CC 1b]
 emb|CBK65827.1| D-xylose isomerase [Bacteroides xylanisolvens XB1A]
 gb|EFI10988.1| xylose isomerase [Bacteroides sp. D22]
 gb|EFI40282.1| xylose isomerase [Bacteroides sp. 3_1_23]
 gb|EFS33825.1| xylose isomerase [Bacteroides sp. D2]
 gb|EGN00349.1| xylose isomerase [Bacteroides ovatus 3_8_47FAA]
 gb|EGN06270.1| xylose isomerase [Bacteroides sp. 1_1_30]
 gb|EIY63641.1| xylose isomerase [Bacteroides ovatus CL03T12C18]
 gb|EIY68776.1| xylose isomerase [Bacteroides ovatus CL02T12C04]
 gb|EIY86839.1| xylose isomerase [Bacteroides xylanisolvens CL03T12C04]
 emb|CDB59241.1| xylose isomerase [Bacteroides ovatus CAG:22]
 emb|CDM01605.1| Xylose isomerase [Bacteroides xylanisolvens SD CC 2a]
 emb|CDM03469.1| Xylose isomerase [Bacteroides xylanisolvens SD CC 1b]
 gb|KDS13894.1| xylose isomerase [Bacteroides ovatus str. 3725 D1 iv]
 gb|KDS19139.1| xylose isomerase [Bacteroides fragilis str. 3725 D9 ii]
 gb|KDS22170.1| xylose isomerase [Bacteroides ovatus str. 3725 D9 iii]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_008765652.1| xylose isomerase [Bacteroides sp. 1_1_6]
 gb|EES70518.1| xylose isomerase [Bacteroides sp. 1_1_6]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_022138821.1| xylose isomerase [Bacteroides acidifaciens]
 emb|CDA83943.1| xylose isomerase [Bacteroides sp. CAG:754]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_016267511.1| xylose isomerase [Bacteroides thetaiotaomicron]
 gb|EOS01935.1| xylose isomerase [Bacteroides thetaiotaomicron dnLKV9]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTL  54



>ref|WP_005654109.1| xylose isomerase [Bacteroides stercoris]
 gb|EDS15937.1| xylose isomerase [Bacteroides stercoris ATCC 43183]
 gb|AEK21499.1| xylose isomerase [Bacteroides stercoris]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTL  54



>ref|WP_022103428.1| xylose isomerase [Bacteroides stercoris CAG:120]
 emb|CDA49117.1| xylose isomerase [Bacteroides stercoris CAG:120]
Length=455

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT 
Sbjct  22   EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTL  71



>ref|WP_034536238.1| xylose isomerase [Bacteroides stercoris]
 gb|ADD61712.1| putative protein [uncultured organism]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTL  54



>gb|EPH17343.1| xylose isomerase [Bacteroides stercoris CC31F]
Length=456

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT 
Sbjct  23   EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTL  72



>ref|WP_018666714.1| xylose isomerase [Bacteroides gallinarum]
Length=438

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTL  54



>ref|WP_010255892.1| xylose isomerase [Treponema primitia]
Length=446

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KI YEG  SKNPL+FK+Y+AE+ + GKK KDW+RF++A+WH+F
Sbjct  10   EYFPGIGKIPYEGSGSKNPLAFKYYDAEKTVRGKKTKDWLRFAIAYWHSF  59



>ref|WP_007748423.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EEX47182.1| xylose isomerase [Bacteroides finegoldii DSM 17565]
 emb|CDC51974.1| xylose isomerase [Bacteroides finegoldii CAG:203]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTL  54



>ref|WP_007760618.1| xylose isomerase [Bacteroides finegoldii]
 gb|EKJ92327.1| xylose isomerase [Bacteroides finegoldii CL09T03C10]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTL  54



>ref|WP_005675918.1| xylose isomerase [Bacteroides caccae]
 gb|EDM22268.1| xylose isomerase [Bacteroides caccae ATCC 43185]
 gb|EIY22176.1| xylose isomerase [Bacteroides caccae CL03T12C61]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTL  54



>ref|WP_022042383.1| xylose isomerase [Bacteroides caccae CAG:21]
 emb|CCZ72091.1| xylose isomerase [Bacteroides caccae CAG:21]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT 
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTL  54



>ref|WP_008655763.1| xylose isomerase [Rhodopirellula europaea]
 gb|EMB17313.1| xylose isomerase [Rhodopirellula europaea 6C]
 gb|EMI28379.1| xylose isomerase [Rhodopirellula europaea SH398]
Length=439

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFR
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFR  52



>ref|WP_011118969.1| xylose isomerase [Rhodopirellula baltica]
 ref|NP_865078.2| xylose isomerase [Rhodopirellula baltica SH 1]
 sp|Q7UVG2.2|XYLA_RHOBA RecName: Full=Xylose isomerase [Rhodopirellula baltica SH 1]
Length=439

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFR
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFR  52



>ref|WP_007335236.1| xylose isomerase [Rhodopirellula baltica]
 gb|EKJ98851.1| xylose isomerase [Rhodopirellula baltica SH28]
 gb|ELP31267.1| xylose isomerase [Rhodopirellula baltica SWK14]
Length=439

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFR
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFR  52



>ref|WP_007324329.1| xylose isomerase [Rhodopirellula baltica]
 gb|EGF29596.1| xylose isomerase [Rhodopirellula baltica WH47]
Length=439

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFR
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFR  52



>emb|CAD72762.1| xylose isomerase [Rhodopirellula baltica SH 1]
Length=454

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFR
Sbjct  19   FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFR  67



>ref|WP_002651869.1| xylose isomerase [Blastopirellula marina]
 gb|EAQ80286.1| xylose isomerase [Blastopirellula marina DSM 3645]
Length=436

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP + KI+YEGP SKNPL+F+WYN +E + GK M+D MRFSV +WHTFR
Sbjct  4    FPEVDKIQYEGPESKNPLAFRWYNPDEVVEGKTMRDHMRFSVVYWHTFR  52



>ref|WP_007414259.1| xylose isomerase [Pedosphaera parvula]
 gb|EEF61725.1| xylose isomerase [bacterium Ellin514]
Length=437

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP I KI++EGP SKNPL+FK YN  E I GK MKDW+RFSV +WHTFR
Sbjct  5    FPKISKIQFEGPQSKNPLAFKHYNESEIIEGKTMKDWLRFSVVYWHTFR  53



>ref|XP_005779983.1| hypothetical protein EMIHUDRAFT_59556, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD27554.1| hypothetical protein EMIHUDRAFT_59556, partial [Emiliania huxleyi 
CCMP1516]
Length=226

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FFP I K++YEGPSS+NPL+FK Y  +E + G+ MK+W+RFS+A+WHT+R
Sbjct  1    FFPDIDKVRYEGPSSRNPLAFKQYAEDEVVAGRTMKEWLRFSIAYWHTWR  50



>ref|WP_004290957.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EEC53078.1| xylose isomerase [Bacteroides eggerthii DSM 20697]
 gb|EFV28579.1| xylose isomerase [Bacteroides eggerthii 1_2_48FAA]
 emb|CCY57543.1| xylose isomerase [Bacteroides eggerthii CAG:109]
Length=438

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_008618038.1| xylose isomerase [Paraprevotella clara]
 gb|EHH01123.1| xylose isomerase [Paraprevotella clara YIT 11840]
Length=438

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  334  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            + E+FPGI KIK+EG  SKNPL++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  3    QKEYFPGIGKIKFEGKESKNPLAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_008626667.1| xylose isomerase [Paraprevotella xylaniphila]
 gb|EGG54729.1| xylose isomerase [Paraprevotella xylaniphila YIT 11841]
Length=438

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  334  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            + E+FPGI KIK+EG  SKNPL++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  3    QKEYFPGIGKIKFEGKESKNPLAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_009125594.1| xylose isomerase [Bacteroides fluxus]
 gb|EGF56331.1| xylose isomerase [Bacteroides fluxus YIT 12057]
Length=438

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_007567790.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EDU98713.1| xylose isomerase [Bacteroides coprocola DSM 17136]
 emb|CDA71534.1| xylose isomerase [Bacteroides coprocola CAG:162]
Length=438

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_021969955.1| xylose isomerase [Bacteroides sp. CAG:1076]
 emb|CCY89918.1| xylose isomerase [Bacteroides sp. CAG:1076]
Length=438

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE  ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAERVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_009319331.1| xylose isomerase [Tannerella sp. 6_1_58FAA_CT1]
 gb|EHL81684.1| xylose isomerase [Tannerella sp. 6_1_58FAA_CT1]
Length=438

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_022389541.1| xylose isomerase [Tannerella sp. CAG:51]
 emb|CDD88353.1| xylose isomerase [Tannerella sp. CAG:51]
Length=438

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_022600970.1| xylose isomerase [Coprobacter fastidiosus]
 gb|ERM89420.1| xylose isomerase [Coprobacter fastidiosus NSB1]
Length=438

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_013564383.1| xylose isomerase [Isosphaera pallida]
 gb|ADV62095.1| D-xylose isomerase [Isosphaera pallida ATCC 43644]
Length=437

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFP +PKI+Y GP+SKNPL FK YN +E + GK M+D +RFSV +WHTF
Sbjct  3    EFFPDVPKIRYGGPTSKNPLEFKHYNPDEVVAGKTMRDHLRFSVVYWHTF  52



>ref|WP_022231753.1| xylose isomerase [Bacteroides sp. CAG:443]
 emb|CDB99617.1| xylose isomerase [Bacteroides sp. CAG:443]
Length=438

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE  ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAERVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_025881085.1| xylose isomerase [Prevotella baroniae]
Length=439

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFP I KI +EG  SKNPL+F +Y+AE+EILGKKMKDW++F++A+WHT 
Sbjct  4    EFFPQIGKIPFEGMESKNPLTFHYYDAEKEILGKKMKDWLKFAIAWWHTL  53



>ref|WP_020153617.1| xylose isomerase [Caldibacillus debilis]
Length=440

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +F  + KI+YEG  SKNPLSFK+YN EE+I  +KMKDW+RFSVA+WHTF
Sbjct  3    YFENVSKIQYEGADSKNPLSFKFYNPEEKIGDRKMKDWLRFSVAYWHTF  51



>ref|WP_026475377.1| xylose isomerase [Alkaliflexus imshenetskii]
Length=442

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI +IKYEG  SKNP++FKWYN E+ I GK MK+ +RF+V++WHTF
Sbjct  9    EYFPGIGEIKYEGRDSKNPMAFKWYNPEQVIAGKTMKEHLRFAVSYWHTF  58



>ref|WP_024996964.1| xylose isomerase [Bacteroides graminisolvens]
 dbj|GAK37242.1| xylose isomerase [Bacteroides graminisolvens DSM 19988 = JCM 
15093]
Length=438

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP++F++Y+ E+EI GKKMKDW +FS+A+WHT 
Sbjct  5    EFFPGIGKIKFEGKESKNPMAFRYYDPEKEINGKKMKDWFKFSMAWWHTL  54



>ref|WP_019538924.1| xylose isomerase [Proteiniphilum acetatigenes]
Length=443

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KI++EG  SKNPL+F++Y+AE+ + G+KMKDW +FS+A+WHT 
Sbjct  9    EFFPGIGKIEFEGKESKNPLAFRYYDAEKVVYGRKMKDWFKFSMAYWHTL  58



>gb|ACA65427.1| xylose isomerase [Orpinomyces sp. ukk1]
Length=437

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FP I KI++EG  SKNP++F +Y+AE+E++GKKMKDW+RF++A+WHT 
Sbjct  4    EYFPTIGKIRFEGKDSKNPMAFHYYDAEKEVMGKKMKDWLRFAMAWWHTL  53



>ref|WP_022339343.1| xylose isomerase [Bacteroides sp. CAG:714]
 emb|CDD32747.1| xylose isomerase [Bacteroides sp. CAG:714]
Length=438

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KI++EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIQFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_018709956.1| xylose isomerase [Bacteroides barnesiae]
Length=438

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFAMAWWHTL  54



>ref|WP_014856692.1| xylose isomerase [Melioribacter roseus]
 gb|AFN75260.1| xylose isomerase [Melioribacter roseus P3M-2]
Length=442

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+F GI KIKYEGP SKNPL+FKWY+  + + GK MK++ RFS A+WHTF
Sbjct  9    EYFTGIGKIKYEGPDSKNPLAFKWYDENKVVFGKTMKEYFRFSAAYWHTF  58



>ref|WP_010528781.1| xylose isomerase [Thermophagus xiamenensis]
Length=441

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNPL+FKWYN +E + GK MKD  RF++A+WHT 
Sbjct  9    EYFPGIGKIKFEGKDSKNPLAFKWYNEDEVVAGKTMKDHFRFAMAYWHTL  58



>ref|WP_002560285.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EIY49934.1| xylose isomerase [Bacteroides nordii CL02T12C05]
 gb|EOA57940.1| xylose isomerase [Bacteroides sp. HPS0048]
Length=438

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_044302066.1| xylose isomerase [Rhodopirellula sallentina]
Length=438

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP + KI+YEGP S NPL+F+WYN +E + GK MKD +RF+V +WHTFR
Sbjct  4    FPEVSKIQYEGPQSDNPLAFRWYNPDEVVAGKTMKDHLRFTVTYWHTFR  52



>gb|EMI56412.1| xylose isomerase [Rhodopirellula sallentina SM41]
Length=456

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP + KI+YEGP S NPL+F+WYN +E + GK MKD +RF+V +WHTFR
Sbjct  22   FPEVSKIQYEGPQSDNPLAFRWYNPDEVVAGKTMKDHLRFTVTYWHTFR  70



>dbj|GAK49954.1| xylose isomerase [bacterium UASB14]
Length=444

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KI+YEGP SKNPL+FK+Y+  + + GK MKD  RF++A+WHTF
Sbjct  11   EYFPGISKIQYEGPQSKNPLAFKYYDENKVVAGKPMKDHFRFAIAYWHTF  60



>ref|WP_013711740.1| xylose isomerase [Carnobacterium sp. 17-4]
 gb|AEB30798.1| xylose isomerase [Carnobacterium sp. 17-4]
Length=436

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +FP I KI+YEGP S NP +F++YN EE +LGK MK+ +RFSVA+WHTF
Sbjct  3    YFPAINKIQYEGPESTNPFAFRYYNPEEVVLGKTMKEQLRFSVAYWHTF  51



>ref|WP_013618897.1| xylose isomerase [Bacteroides salanitronis]
 gb|ADY37524.1| Xylose isomerase [Bacteroides salanitronis DSM 18170]
Length=438

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNPL+F++Y+ E  ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPLAFRYYDPERVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_022164491.1| xylose isomerase [Bacteroides sp. CAG:633]
 emb|CDB11822.1| xylose isomerase [Bacteroides sp. CAG:633]
Length=438

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S+NPL+F++Y+ E+ I+GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESRNPLAFRYYDPEKVIMGKKMKDWLKFSMAWWHTL  54



>ref|WP_005931926.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EIY61146.1| xylose isomerase [Bacteroides salyersiae CL02T12C01]
 gb|EOA48558.1| xylose isomerase [Bacteroides salyersiae WAL 10018 = DSM 18765 
= JCM 12988]
 emb|CCY48397.1| xylose isomerase [Bacteroides sp. CAG:189]
Length=438

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_010588344.1| xylose isomerase [Schlesneria paludicola]
Length=436

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +FP + KI YEGP+SKNPL+F+ YN EE + GKK+KD +RF+V +WHTFR
Sbjct  3    YFPEVSKIAYEGPTSKNPLAFRHYNPEEVVEGKKLKDLLRFTVCYWHTFR  52



>ref|WP_015358602.1| MULTISPECIES: xylose isomerase XylA [Ruminiclostridium]
 ref|YP_007678969.1| Xyi [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
 gb|AGC67911.1| xylose isomerase XylA [ [[Clostridium] stercorarium subsp. stercorarium 
DSM 8532]
 gb|AGI38951.1| Xyi [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
Length=441

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            EFF  IPKIKYEGP S NPL+FK+YN +E I GK MK+ +RFSVA+WHT +
Sbjct  3    EFFKNIPKIKYEGPKSDNPLAFKFYNPDEVIGGKTMKEHLRFSVAYWHTLQ  53



>ref|WP_013547913.1| xylose isomerase [Bacteroides helcogenes]
 gb|ADV44323.1| D-xylose isomerase [Bacteroides helcogenes P 36-108]
Length=438

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+A++ I+GKKM+DW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDADKVIMGKKMRDWLKFAMAWWHTL  54



>ref|WP_038607329.1| xylose isomerase [Bacteroides dorei]
 gb|AII69993.1| xylose isomerase [Bacteroides dorei]
Length=438

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_016276408.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EOS12208.1| xylose isomerase [Bacteroides massiliensis dnLKV3]
Length=438

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_005843150.1| xylose isomerase [Bacteroides vulgatus]
 gb|EFG17645.1| xylose isomerase [Bacteroides vulgatus PC510]
Length=438

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_022508280.1| xylose isomerase [Bacteroides vulgatus CAG:6]
 emb|CDF19135.1| xylose isomerase [Bacteroides vulgatus CAG:6]
Length=438

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_005851486.1| MULTISPECIES: xylose isomerase [Bacteroides]
 sp|A6L792.1|XYLA_BACV8 RecName: Full=Xylose isomerase [Bacteroides vulgatus ATCC 8482]
 gb|ABR41556.1| xylose isomerase [Bacteroides vulgatus ATCC 8482]
 gb|EEB26700.1| xylose isomerase [Bacteroides dorei DSM 17855]
 gb|EEO44931.1| xylose isomerase [Bacteroides dorei 5_1_36/D4]
 gb|EEO59223.1| xylose isomerase [Bacteroides sp. 9_1_42FAA]
 gb|EET14751.1| xylose isomerase [Bacteroides sp. 4_3_47FAA]
 gb|EEZ22134.1| xylose isomerase [Bacteroides sp. 3_1_33FAA]
 gb|EFV66343.1| hypothetical protein HMPREF9011_03268 [Bacteroides sp. 3_1_40A]
 gb|EIY27735.1| xylose isomerase [Bacteroides dorei CL02T00C15]
 gb|EIY33278.1| xylose isomerase [Bacteroides dorei CL02T12C06]
 gb|EIY38098.1| xylose isomerase [Bacteroides dorei CL03T12C01]
 gb|EIY77029.1| xylose isomerase [Bacteroides vulgatus CL09T03C04]
 gb|EOS04420.1| xylose isomerase [Bacteroides vulgatus dnLKV7]
 gb|KDS29271.1| xylose isomerase [Bacteroides vulgatus str. 3775 SR(B) 19]
 gb|KDS31817.1| xylose isomerase [Bacteroides vulgatus str. 3775 SL(B) 10 (iv)]
 gb|KDS55976.1| xylose isomerase [Bacteroides vulgatus str. 3975 RP4]
 gb|AII64187.1| xylose isomerase [Bacteroides dorei]
Length=438

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVINGKKMKDWLKFAMAWWHTL  54



>ref|WP_006801274.1| xylose isomerase [Dysgonomonas gadei]
 gb|EGJ99870.1| xylose isomerase [Dysgonomonas gadei ATCC BAA-286]
Length=442

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNPL++++Y+  + ++GK MKDWMRF++A+WHT 
Sbjct  9    EFFPGIGKIKFEGKESKNPLAYRFYDENKVVMGKSMKDWMRFAMAYWHTL  58



>ref|WP_005820227.1| xylose isomerase [Bacteroides fragilis]
 gb|EKA81889.1| xylose isomerase [Bacteroides fragilis HMW 616]
Length=439

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+KMKDW++F++A+WHT 
Sbjct  5    EYFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGRKMKDWLKFAMAWWHTL  54



>ref|WP_022386029.1| xylose isomerase [Bacteroides sp. CAG:462]
 emb|CDD83478.1| xylose isomerase [Bacteroides sp. CAG:462]
Length=438

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP+++ +Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAYHYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_034838066.1| xylose isomerase [[Clostridium] cellulosi]
Length=439

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFF  IPK+KYEGP SKNP +FK+YN EE+I GK M++ ++FS+A+WHT 
Sbjct  3    EFFSNIPKVKYEGPDSKNPFAFKFYNPEEKIAGKTMREQLKFSLAYWHTL  52



>ref|WP_021979384.1| xylose isomerase [Paraprevotella clara CAG:116]
 emb|CCZ01726.1| xylose isomerase [Paraprevotella clara CAG:116]
Length=438

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  334  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            + E+FP I KIK+EG  SKNPL++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  3    QKEYFPSIGKIKFEGKESKNPLAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_009120973.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EGF54042.1| xylose isomerase [Bacteroides clarus YIT 12056]
 emb|CDB82037.1| xylose isomerase [Bacteroides clarus CAG:160]
Length=438

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP++F++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAFRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_010040427.1| xylose isomerase [Gemmata obscuriglobus]
Length=437

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FFP +PKIKYEGP S NPL+++ YN +E + GK MKD +RF+V +WHTFR
Sbjct  3    FFPDVPKIKYEGPDSTNPLAYRHYNPDELVEGKSMKDHLRFAVCYWHTFR  52



>ref|WP_028262068.1| xylose isomerase [Verrucomicrobia bacterium SCGC AAA027-I19]
Length=435

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            +FP IPKI+YEGP S+NPL+FK YN +E I GK M+D MRF+ A+WH  R
Sbjct  3    YFPDIPKIQYEGPGSRNPLAFKHYNPDELIEGKTMRDHMRFAAAYWHVMR  52



>ref|WP_028986624.1| xylose isomerase [Thermicanus aegyptius]
Length=440

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +F  + KI+YEGP+SKNPL+FK+YN+EE+I  + M++W+RFSVA+WHTF
Sbjct  3    YFENVSKIQYEGPTSKNPLAFKFYNSEEKIGDRTMEEWLRFSVAYWHTF  51



>ref|WP_013711744.1| xylose isomerase [Carnobacterium sp. 17-4]
 gb|AEB30802.1| xylose isomerase [Carnobacterium sp. 17-4]
Length=436

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +FP I KIKYEGP S NP +F+ YN EE +LGK MK+ +RFSVA+WHTF
Sbjct  3    YFPSIDKIKYEGPESTNPFAFRHYNPEEIVLGKTMKEQLRFSVAYWHTF  51



>ref|WP_002643822.1| xylose isomerase [Planctomyces maris]
 gb|EDL61873.1| xylose isomerase [Planctomyces maris DSM 8797]
Length=436

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            E+F  +PKI+YEGP SKNPL+FK Y  EEEI G+ M+D  RFS+ +WHTFR
Sbjct  2    EYFADVPKIEYEGPQSKNPLAFKHYCPEEEIEGQTMRDLFRFSICYWHTFR  52



>ref|WP_005588920.1| xylose isomerase [Clostridium ultunense]
 emb|CCQ98538.1| xylose isomerase [Clostridium ultunense Esp]
Length=440

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +F  + KI+YEGP+SKNPL+FK+YN+EE+I  + M++W+RFSVA+WHTF
Sbjct  3    YFENVSKIQYEGPTSKNPLAFKFYNSEEKIGDRTMEEWLRFSVAYWHTF  51



>ref|WP_032531500.1| xylose isomerase [Bacteroides fragilis]
 gb|KER49021.1| xylose isomerase [Bacteroides fragilis]
Length=439

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+KMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKVINGRKMKDWLKFAMAWWHTL  54



>ref|WP_008707454.1| xylose isomerase [Rhodopirellula maiorica]
 gb|EMI16129.1| xylose isomerase [Rhodopirellula maiorica SM1]
Length=437

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP + KIKYEGP S NPL+F+WYN +E + GK MK+ +RF+V +WHTFR
Sbjct  4    FPEVSKIKYEGPDSDNPLAFRWYNPDEVVAGKTMKEHLRFTVTYWHTFR  52



>ref|WP_022039388.1| xylose isomerase [Bacteroides sp. CAG:702]
 emb|CCZ71414.1| xylose isomerase [Bacteroides sp. CAG:702]
Length=438

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+ E+ ++GKKMKDW++FS+A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDPEKVVMGKKMKDWLKFSMAWWHTL  54



>ref|WP_005806049.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EKA91650.1| xylose isomerase [Bacteroides fragilis HMW 610]
 gb|KER59376.1| xylose isomerase [Bacteroides fragilis]
 gb|KER79268.1| xylose isomerase [Bacteroides fragilis]
 gb|KFX74111.1| xylose isomerase [Bacteroides fragilis]
Length=439

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+KMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKVINGRKMKDWLKFAMAWWHTL  54



>ref|WP_007557712.1| xylose isomerase [Bacteroides plebeius]
 gb|EDY95162.1| xylose isomerase [Bacteroides plebeius DSM 17135]
Length=438

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++YNAE+ ILGK MK+W++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYNAEKVILGKPMKEWLKFAMAWWHTL  54



>ref|WP_020007900.1| xylose isomerase [Salinicoccus albus]
Length=441

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +FP I KI YEGP S NP +FK+YN +E+I GK+M+D++RF+VA+WHTF
Sbjct  3    YFPNIQKINYEGPKSANPYAFKYYNPDEKIGGKRMEDYLRFAVAYWHTF  51



>ref|WP_023663756.1| xylose isomerase [Rhodobacter sp. CACIA14H1]
 gb|ESW62486.1| xylose isomerase [Rhodobacter sp. CACIA14H1]
Length=433

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +FF GIP+I+YEGPSS N  +F+ YN +E ILGK+M+D MRF+VA+WH+F
Sbjct  3    DFFKGIPQIRYEGPSSTNEFAFRHYNPDEVILGKRMEDHMRFAVAYWHSF  52



>ref|WP_008101337.1| xylose isomerase [Verrucomicrobiae bacterium DG1235]
 gb|EDY83174.1| xylose isomerase [Verrucomicrobiae bacterium DG1235]
Length=443

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI +IK+EG  S NPL+FKWYN ++EI GK MK+  RF++A+WHTF
Sbjct  9    EYFPGIGEIKFEGRDSDNPLAFKWYNPDQEIGGKSMKELFRFAIAYWHTF  58



>ref|WP_032575525.1| xylose isomerase [Bacteroides fragilis]
 gb|EYA95877.1| xylose isomerase [Bacteroides fragilis str. S38L5]
 gb|EYB14335.1| xylose isomerase [Bacteroides fragilis str. S38L3]
Length=439

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++YNAE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYNAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_032600983.1| xylose isomerase [Bacteroides fragilis]
 gb|EXZ14014.1| xylose isomerase [Bacteroides fragilis str. Ds-233]
Length=439

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++YNAE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYNAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_044162815.1| xylose isomerase [Bacteroides reticulotermitis]
 dbj|GAE84268.1| xylose isomerase [Bacteroides reticulotermitis JCM 10512]
Length=438

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPG+ KIK+EG  SKNP++F++Y+AE+ + GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGVGKIKFEGKESKNPMAFRYYDAEKVVNGKKMKDWLKFAMAWWHTL  54



>ref|WP_032598317.1| xylose isomerase [Bacteroides fragilis]
 gb|EXZ73169.1| xylose isomerase [Bacteroides fragilis str. 3976T8]
Length=439

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++YNAE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYNAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_026561670.1| xylose isomerase [Bacillus sp. J37]
Length=443

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +F  + +IKYEGP S NPL+FK+YN EE I GKKM+D +RFSVA+WHTF
Sbjct  3    YFENVNQIKYEGPGSANPLAFKYYNPEEVINGKKMEDLLRFSVAYWHTF  51



>ref|WP_027471746.1| xylose isomerase [Saccharicrinis fermentans]
 dbj|GAF04594.1| xylose isomerase [Saccharicrinis fermentans DSM 9555 = JCM 21142]
Length=441

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+F GI KIK+EGP SKNPL+FKWY+    + GK MK+ +RF++A+WHTF
Sbjct  9    EYFKGIDKIKFEGPESKNPLAFKWYDENRVVAGKTMKEHLRFAIAYWHTF  58



>ref|WP_014225930.1| xylose isomerase [Tannerella forsythia]
 gb|AEW20165.1| xylose isomerase [Tannerella forsythia ATCC 43037]
Length=438

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP++F++Y+AE+ ++GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAFRYYDAEKVVMGKKMKDWLKFAMAWWHTL  54



>ref|WP_012913169.1| xylose isomerase [Pirellula staleyi]
 gb|ADB18910.1| xylose isomerase [Pirellula staleyi DSM 6068]
Length=437

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP I KI+YEGP SKNPL+F+WYN +E I GK M + +RFSV +WHTFR
Sbjct  5    FPEIEKIRYEGPKSKNPLAFRWYNPDEVIEGKTMAEHLRFSVVYWHTFR  53



>ref|WP_039847233.1| xylose isomerase, partial [Brucella neotomae]
Length=88

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I K++YEGP S NPL+F+ YNA+E +LGK+M+D +RF+VA+WH+F
Sbjct  5    FFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRFAVAYWHSF  53



>ref|WP_021949211.1| xylose isomerase [Prevotella sp. CAG:1124]
 emb|CCY65512.1| xylose isomerase [Prevotella sp. CAG:1124]
Length=438

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FP I KIKYEG  S NPL+F +Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  4    EYFPQIGKIKYEGADSTNPLAFHYYDAEKVIMGKKMKDWLKFAMAWWHTL  53



>ref|WP_012924965.1| xylose isomerase [Spirosoma linguale]
 gb|ADB36413.1| xylose isomerase [Spirosoma linguale DSM 74]
Length=443

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI  I YEGP+SKNPLSFKWYN +  I GK +++ +RF++++WHTF
Sbjct  10   EFFPGIGAIAYEGPTSKNPLSFKWYNPDLVIGGKTLREQLRFAISYWHTF  59



>ref|WP_029904902.1| xylose isomerase [Prevotella sp. 10(H)]
Length=442

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNP+++++Y+  + ++GK MKDWMRF++A+WHT 
Sbjct  9    EFFPGIGKIKFEGKESKNPMAYRFYDENKVVMGKTMKDWMRFAMAYWHTL  58



>ref|WP_006842491.1| xylose isomerase [Dysgonomonas mossii]
 gb|EGK04092.1| xylose isomerase [Dysgonomonas mossii DSM 22836]
Length=442

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI KIK+EG  SKNPL+F++Y+  + ++GK MKDW RF++A+WHT 
Sbjct  9    EFFPGIGKIKFEGKESKNPLAFRFYDENKVVMGKTMKDWTRFAMAYWHTL  58



>ref|WP_007930953.1| MULTISPECIES: xylose isomerase [Pelosinus]
 gb|EIW20574.1| xylose isomerase [Pelosinus fermentans B4]
 gb|EIW25711.1| Xylose isomerase [Pelosinus fermentans A11]
 gb|EIW33123.1| Xylose isomerase [Pelosinus fermentans DSM 17108]
Length=437

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+F GI KI YEGP S+NPL+FK+YN +E + GK M++ +RFSVA+WHTF
Sbjct  2    EYFSGIKKITYEGPKSQNPLAFKYYNPQELVAGKTMEEHLRFSVAYWHTF  51



>ref|WP_009127448.1| xylose isomerase [Bacteroides oleiciplenus]
 gb|EKU92659.1| xylose isomerase [Bacteroides oleiciplenus YIT 12058]
Length=438

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP+++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_025658881.1| xylose isomerase [Rhizobium sp. IBUN]
Length=436

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I KIKYEGP SKNPL+F+ YN +E +LGK+++D +RF+VA+WHTF
Sbjct  5    FFGDIQKIKYEGPDSKNPLAFRHYNKDEVVLGKRLEDHLRFAVAYWHTF  53



>ref|WP_044271094.1| xylose isomerase [Candidatus Bacteroides timonensis]
Length=438

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP+++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_022210068.1| xylose isomerase [Bacteroides cellulosilyticus CAG:158]
 emb|CDB71823.1| xylose isomerase [Bacteroides cellulosilyticus CAG:158]
Length=438

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP+++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_031535720.1| MULTISPECIES: xylose isomerase [Bacteroides]
Length=437

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPG+ KI++EG  SKNP+++ +Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  4    EYFPGVKKIQFEGKDSKNPMAYHYYDAEKVIMGKKMKDWLKFAMAWWHTL  53



>ref|WP_009095728.1| xylose isomerase [Rhodopirellula sp. SWK7]
 gb|EMI45512.1| xylose isomerase [Rhodopirellula sp. SWK7]
Length=438

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  346  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFR  492
            FP + KI+YEGP S NPL+F+WYN +E + GK MK+ +RF+V +WHTFR
Sbjct  4    FPEVSKIQYEGPQSDNPLAFRWYNPDEVVAGKTMKEHLRFTVTYWHTFR  52



>ref|WP_007214097.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EDV03057.1| xylose isomerase [Bacteroides intestinalis DSM 17393]
 gb|EEF87639.1| xylose isomerase [Bacteroides cellulosilyticus DSM 14838]
Length=438

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP+++++Y+AE+ I+GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAYRYYDAEKVIMGKKMKDWLKFAMAWWHTL  54



>ref|WP_018856526.1| xylose isomerase [Rhizobium sp. 42MFCr.1]
Length=436

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I KIKYEGP SKNPL+F+ YN +E +LGK+++D +RF+VA+WHTF
Sbjct  5    FFGDIQKIKYEGPDSKNPLAFRHYNKDEVVLGKRLEDHLRFAVAYWHTF  53



>ref|WP_013970119.1| xylose isomerase [Treponema caldaria]
 gb|AEJ20841.1| Xylose isomerase [Treponema caldaria DSM 7334]
Length=447

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIKYEGP S NPL+FK+Y+ ++++ GK MK+ +RF+VA+WH+F
Sbjct  10   EYFPGIGKIKYEGPKSDNPLAFKYYDPDKKVGGKTMKEHLRFAVAYWHSF  59



>ref|WP_032539378.1| xylose isomerase [Bacteroides fragilis]
 gb|KER56374.1| xylose isomerase [Bacteroides fragilis]
Length=439

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            ++FPGI KIK+EG  SKNP++F++Y+AE+ I G+KMKDW++F++A+WHT 
Sbjct  5    DYFPGIGKIKFEGKDSKNPMAFRYYDAEKVINGRKMKDWLKFAMAWWHTL  54



>ref|WP_021590663.1| xylose isomerase [Prevotella baroniae]
 gb|ERK38401.1| xylose isomerase [Prevotella baroniae F0067]
Length=439

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFP I KI +EG  SKNP +F +Y+AE+EILGKKMKDW++F++A+WHT 
Sbjct  4    EFFPQIGKIPFEGMESKNPQAFHYYDAEKEILGKKMKDWLKFAMAWWHTL  53



>ref|WP_019387009.1| xylose isomerase [Arenitalea lutea]
Length=438

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+F GI KIK+EG  S NPL+FK+YN ++ + GK MKDW +FS+A+WHTF
Sbjct  5    EYFKGIDKIKFEGKESDNPLAFKYYNPDQVVAGKTMKDWFKFSIAYWHTF  54



>ref|WP_022083252.1| xylose isomerase [Bacteroides sp. CAG:144]
 emb|CDA21770.1| xylose isomerase [Bacteroides sp. CAG:144]
Length=438

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FP I KIK+EG  SKNPL+F++Y+ E+ I GKKMKDW+RFS+A+WHT 
Sbjct  5    EYFPQIGKIKFEGKESKNPLAFRYYDPEKVINGKKMKDWLRFSMAWWHTL  54



>ref|WP_007218456.1| xylose isomerase [Bacteroides cellulosilyticus]
 gb|EIY26028.1| xylose isomerase [Bacteroides cellulosilyticus CL02T12C19]
Length=438

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  S NP+++++Y+AE+ ++GKKMKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKESMNPMAYRYYDAEKVVMGKKMKDWLKFAMAWWHTL  54



>ref|WP_026976161.1| xylose isomerase [Alicyclobacillus contaminans]
Length=437

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            +FP + K++YEGP S+NPL+FK+YN +E +LGK M + +RF+V++WHTF
Sbjct  3    YFPEVSKVEYEGPKSRNPLAFKYYNPQERVLGKTMAEHLRFAVSYWHTF  51



>ref|WP_029077449.1| xylose isomerase, partial [Brucella melitensis]
Length=228

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I K++YEGP S NPL+F+ YNA+E +LGK+M+D +RF+VA+WH+F
Sbjct  5    FFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRFAVAYWHSF  53



>emb|CDZ23165.1| Xylose isomerase [ [[Clostridium] cellulosi]
Length=439

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+F  IPK++YEGP SKNP +FK+YN EE+I GK M++ ++FS+A+WHT 
Sbjct  3    EYFSNIPKVRYEGPDSKNPFAFKFYNPEEKIAGKTMREQLKFSLAYWHTL  52



>ref|WP_022847921.1| xylose isomerase [Chloroflexi bacterium oral taxon 439]
Length=439

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHT  486
            ++P IP++KYEGP S+NPL+FK+YN +E + GKKMKD ++FS A+WHT
Sbjct  4    YYPEIPQVKYEGPKSENPLAFKFYNPDEIVAGKKMKDQLKFSAAYWHT  51



>sp|Q6T6K9.1|XYLA_FERGO RecName: Full=Xylose isomerase [Fervidobacterium gondwanense]
 gb|AAR07504.1| glucose isomerase [Fervidobacterium gondwanense]
Length=433

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  355  IPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            + K+ YEGPSSKN L++K+YN EEEI GKKM+DW RF+VA+WHTF
Sbjct  5    VEKVVYEGPSSKNLLAYKFYNPEEEIAGKKMRDWFRFAVAYWHTF  49



>gb|KFH21249.1| xylose isomerase, partial [Brucella abortus 544]
Length=163

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I K++YEGP S NPL+F+ YNA+E +LGK+M+D +RF+VA+WH+F
Sbjct  5    FFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRFAVAYWHSF  53



>ref|WP_037414339.1| xylose isomerase [Sinorhizobium sp. CCBAU 05631]
Length=436

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I KIKYEGP S NPL+F+ YNA+E +LGK+M+D +RF+VA+WH+F
Sbjct  5    FFGDIAKIKYEGPESTNPLAFRHYNADEVVLGKRMEDHLRFAVAYWHSF  53



>ref|WP_040994511.1| xylose isomerase [Chryseobacterium oranimense]
 emb|CEJ68933.1| Xylose isomerase [Chryseobacterium oranimense G311]
Length=442

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFF GI KIK+EG  SKNPL+F++Y+AE+ ++GK MKDW RF++A+WHT 
Sbjct  9    EFFTGIEKIKFEGKESKNPLAFRYYDAEKIVMGKPMKDWTRFAMAWWHTL  58



>ref|WP_022054239.1| xylose isomerase [Bacteroides plebeius CAG:211]
 emb|CCZ87265.1| xylose isomerase [Bacteroides plebeius CAG:211]
Length=438

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ILGK MK+W++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVILGKPMKEWLKFAMAWWHTL  54



>ref|WP_032556812.1| xylose isomerase [Bacteroides fragilis]
 gb|EXZ00446.1| xylose isomerase [Bacteroides fragilis str. DS-166]
 gb|EXZ28485.1| xylose isomerase [Bacteroides fragilis str. S36L11]
 gb|EYA04584.1| xylose isomerase [Bacteroides fragilis str. S6L3]
 gb|EYA09354.1| xylose isomerase [Bacteroides fragilis str. S6R6]
 gb|EYA85367.1| xylose isomerase [Bacteroides fragilis str. S36L12]
 gb|EYA90784.1| xylose isomerase [Bacteroides fragilis str. S36L5]
 gb|EYB00265.1| xylose isomerase [Bacteroides fragilis str. S6L8]
 gb|EYB04862.1| xylose isomerase [Bacteroides fragilis str. S6R5]
 gb|EYE49700.1| xylose isomerase [Bacteroides fragilis str. S6L5]
 gb|EYE53671.1| xylose isomerase [Bacteroides fragilis str. S6R8]
Length=439

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_014298921.1| xylose isomerase [Bacteroides fragilis]
 emb|CBW22878.1| putative xylose isomerase [Bacteroides fragilis 638R]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_005777710.1| xylose isomerase [Bacteroides fragilis]
 gb|EFR53194.1| xylose isomerase [Bacteroides fragilis 3_1_12]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_010992983.1| xylose isomerase [Bacteroides fragilis]
 sp|Q5LCV9.1|XYLA_BACFN RecName: Full=Xylose isomerase [Bacteroides fragilis NCTC 9343]
 emb|CAH08054.1| putative xylose isomerase [Bacteroides fragilis NCTC 9343]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_005787643.1| MULTISPECIES: xylose isomerase [Bacteroides]
 ref|YP_099543.1| xylose isomerase [Bacteroides fragilis YCH46]
 sp|Q64U20.1|XYLA_BACFR RecName: Full=Xylose isomerase [Bacteroides fragilis YCH46]
 dbj|BAD49009.1| xylose isomerase [Bacteroides fragilis YCH46]
 gb|EES86229.1| xylose isomerase [Bacteroides sp. 3_2_5]
 gb|EEZ27830.1| xylose isomerase [Bacteroides sp. 2_1_16]
 gb|EGN08096.1| xylose isomerase [Bacteroides sp. 2_1_56FAA]
 gb|EIK40859.1| xylose isomerase [Bacteroides fragilis CL07T00C01]
 gb|EIY44115.1| xylose isomerase [Bacteroides fragilis CL03T12C07]
 gb|EIY47378.1| xylose isomerase [Bacteroides fragilis CL03T00C08]
 gb|EIY96544.1| xylose isomerase [Bacteroides fragilis CL07T12C05]
 gb|EKA84740.1| xylose isomerase [Bacteroides fragilis HMW 615]
 emb|CDD40607.1| xylose isomerase [Bacteroides fragilis CAG:47]
 gb|EXY13078.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #8]
 gb|EXY18169.1| xylose isomerase [Bacteroides fragilis str. 2-F-2 #5]
 gb|EXY22017.1| xylose isomerase [Bacteroides fragilis str. 2-F-2 #7]
 gb|EXY27467.1| xylose isomerase [Bacteroides fragilis str. 3397 T10]
 gb|EXY35769.1| xylose isomerase [Bacteroides fragilis str. 34-F-2 #13]
 gb|EXY40816.1| xylose isomerase [Bacteroides fragilis str. 3774 T13]
 gb|EXY46343.1| xylose isomerase [Bacteroides fragilis str. 3783N1-2]
 gb|EXY51135.1| xylose isomerase [Bacteroides fragilis str. 3783N2-1]
 gb|EXY55932.1| xylose isomerase [Bacteroides fragilis str. 3976T7]
 gb|EXY70095.1| xylose isomerase [Bacteroides fragilis str. 3986 T(B)9]
 gb|EXY74237.1| xylose isomerase [Bacteroides fragilis str. 3988T(B)14]
 gb|EXY80221.1| xylose isomerase [Bacteroides fragilis str. 3988 T1]
 gb|EXY84523.1| xylose isomerase [Bacteroides fragilis str. 3996 N(B) 6]
 gb|EXY90562.1| xylose isomerase [Bacteroides fragilis str. 3998T(B)3]
 gb|EXY95479.1| xylose isomerase [Bacteroides fragilis str. 3998 T(B) 4]
 gb|EXZ09874.1| xylose isomerase [Bacteroides fragilis str. DS-71]
 gb|EXZ24240.1| xylose isomerase [Bacteroides fragilis str. S13 L11]
 gb|EXZ33727.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #4]
 gb|EXZ39689.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #7]
 gb|EXZ44543.1| xylose isomerase [Bacteroides fragilis str. 2-F-2 #4]
 gb|EXZ50338.1| xylose isomerase [Bacteroides fragilis str. 3397 N2]
 gb|EXZ53956.1| xylose isomerase [Bacteroides fragilis str. 3397 T14]
 gb|EXZ58133.1| xylose isomerase [Bacteroides fragilis str. 3719 A10]
 gb|EXZ63747.1| xylose isomerase [Bacteroides fragilis str. 3725 D9(v)]
 gb|EXZ68154.1| xylose isomerase [Bacteroides fragilis str. 3783N1-8]
 gb|EXZ78562.1| xylose isomerase [Bacteroides fragilis str. 3-F-2 #6]
 gb|EXZ82989.1| xylose isomerase [Bacteroides fragilis str. B1 (UDC16-1)]
 gb|EXZ89273.1| xylose isomerase [Bacteroides fragilis str. J38-1]
 gb|EXZ94470.1| xylose isomerase [Bacteroides fragilis str. Korea 419]
 gb|EYA14686.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #10]
 gb|EYA19367.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #3]
 gb|EYA24989.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #9]
 gb|EYA28325.1| xylose isomerase [Bacteroides fragilis str. 1009-4-F #10]
 gb|EYA34098.1| xylose isomerase [Bacteroides fragilis str. 1009-4-F #7]
 gb|EYA38937.1| xylose isomerase [Bacteroides fragilis str. 20793-3]
 gb|EYA43724.1| xylose isomerase [Bacteroides fragilis str. 3397 N3]
 gb|EYA53051.1| xylose isomerase [Bacteroides fragilis str. 3986 N(B)22]
 gb|EYA57747.1| xylose isomerase [Bacteroides fragilis str. 3986 T(B)13]
 gb|EYA71359.1| xylose isomerase [Bacteroides fragilis str. S24L15]
 gb|EYA76202.1| xylose isomerase [Bacteroides fragilis str. S24L26]
 gb|EYA80458.1| xylose isomerase [Bacteroides fragilis str. S24L34]
 gb|EYB10047.1| xylose isomerase [Bacteroides fragilis str. 3783N1-6]
 gb|EYE54773.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #5]
 gb|EYE64273.1| xylose isomerase [Bacteroides fragilis str. 1007-1-F #6]
 gb|EYE68435.1| xylose isomerase [Bacteroides fragilis str. 3986 N3]
 gb|KER48342.1| xylose isomerase [Bacteroides fragilis]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_037179575.1| xylose isomerase [Rhizobium sp. YR519]
Length=436

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  343  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            FF  I KIKYEGP S NPL+++ YN +E +LGK+M+D +RF+VA+WHTF
Sbjct  5    FFGDIQKIKYEGPDSTNPLAYRHYNKDEVVLGKRMEDHLRFAVAYWHTF  53



>ref|WP_025813316.1| xylose isomerase [Bacteroides fragilis]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_032562944.1| xylose isomerase [Bacteroides fragilis]
 gb|EYA00248.1| xylose isomerase [Bacteroides fragilis str. S23 R14]
 gb|EYA66375.1| xylose isomerase [Bacteroides fragilis str. S23L24]
 gb|EYE45134.1| xylose isomerase [Bacteroides fragilis str. S23L17]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_005803483.1| xylose isomerase [Bacteroides fragilis]
 gb|EIY90395.1| xylose isomerase [Bacteroides fragilis CL05T00C42]
 gb|EIY94408.1| xylose isomerase [Bacteroides fragilis CL05T12C13]
 gb|EXY65526.1| xylose isomerase [Bacteroides fragilis str. 3986 N(B)19]
 gb|EXZ05467.1| xylose isomerase [Bacteroides fragilis str. DS-208]
 gb|EYA48550.1| xylose isomerase [Bacteroides fragilis str. 3719 T6]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



>ref|WP_028120803.1| xylose isomerase [Epilithonimonas tenax]
Length=442

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            EFFPGI +IK+EG  S+NPL+F++Y A+  ++GK MK+WMRF++A+WHT 
Sbjct  9    EFFPGIEQIKFEGKESRNPLAFRYYEADRMVMGKPMKEWMRFAMAWWHTL  58



>ref|WP_032599677.1| xylose isomerase [Bacteroides fragilis]
 gb|EXY60432.1| xylose isomerase [Bacteroides fragilis str. 3986T(B)10]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  340  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTF  489
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I G+ MKDW++F++A+WHT 
Sbjct  5    EYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTL  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780