BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF015B15

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAS65426.1|  Kunitz-type trypsin inhibitor                           115   2e-29   Ipomoea batatas [batate]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            94.0    4e-21   Nicotiana tomentosiformis
dbj|BAA95697.1|  thionin like protein                                 94.0    5e-21   Nicotiana tabacum [American tobacco]
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            92.8    1e-20   Nicotiana sylvestris
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            90.9    7e-20   Nicotiana sylvestris
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            90.5    7e-20   Nicotiana sylvestris
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    87.8    8e-19   Nicotiana tomentosiformis
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    87.8    8e-19   Nicotiana tomentosiformis
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            87.4    1e-18   Nicotiana tomentosiformis
ref|XP_004297786.1|  PREDICTED: defensin Ec-AMP-D2-like               87.4    1e-18   Fragaria vesca subsp. vesca
ref|XP_004297787.1|  PREDICTED: defensin Ec-AMP-D2-like               87.0    2e-18   Fragaria vesca subsp. vesca
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       86.7    2e-18   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            86.7    2e-18   Cicer arietinum [garbanzo]
ref|XP_003628979.1|  Defensin                                         86.3    3e-18   Medicago truncatula
gb|ACJ26760.1|  protease inhibitor-related protein                    86.3    4e-18   Solanum tuberosum [potatoes]
gb|ACB32234.1|  gamma-thionin/defensin                                85.9    4e-18   Solanum chacoense
gb|AIT42148.1|  defensin-like protein                                 85.5    5e-18   Solanum tuberosum [potatoes]
gb|AFW90621.1|  protease inhibitor-related protein                    85.5    5e-18   Solanum tuberosum [potatoes]
gb|ABO36641.1|  defensin protein                                      85.5    7e-18   Solanum pimpinellifolium [currant tomato]
gb|ABO36637.1|  defensin protein                                      85.1    7e-18   Solanum lycopersicum
ref|NP_001234872.1|  gamma-thionin precursor                          85.1    7e-18   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    85.1    8e-18   Nicotiana sylvestris
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        84.7    1e-17   Sorghum bicolor [broomcorn]
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  84.7    1e-17   Solanum tuberosum [potatoes]
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      84.7    1e-17   Castanea sativa
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        84.0    2e-17   Sorghum bicolor [broomcorn]
gb|AAL35366.1|AF442388_1  defensin protein precursor                  84.0    3e-17   Capsicum annuum
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            83.6    3e-17   Solanum tuberosum [potatoes]
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    83.6    4e-17   Vitis vinifera
gb|AIT42147.1|  defensin-like protein                                 83.2    4e-17   Solanum tuberosum [potatoes]
gb|AFK44299.1|  unknown                                               83.2    4e-17   Lotus japonicus
gb|AIT42153.1|  defensin-like protein                                 83.2    4e-17   Solanum tuberosum [potatoes]
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           83.2    4e-17   Phaseolus vulgaris [French bean]
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    83.2    5e-17   
gb|AIT42152.1|  defensin-like protein                                 83.2    5e-17   Solanum tuberosum [potatoes]
ref|XP_003628977.1|  Defensin                                         82.8    6e-17   Medicago truncatula
gb|AIT42150.1|  defensin-like protein                                 82.4    6e-17   Solanum tuberosum [potatoes]
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       82.4    7e-17   Cicer arietinum [garbanzo]
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 82.4    8e-17   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            82.4    9e-17   
ref|XP_003630421.1|  Defensin                                         82.0    9e-17   Medicago truncatula
ref|NP_001048853.1|  Os03g0130300                                     82.0    1e-16   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               81.6    2e-16   Elaeis guineensis
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       81.6    2e-16   Jatropha curcas
gb|KHN06998.1|  Defensin-like protein                                 81.6    2e-16   Glycine soja [wild soybean]
emb|CDP10468.1|  unnamed protein product                              81.3    2e-16   Coffea canephora [robusta coffee]
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    80.9    2e-16   Solanum tuberosum [potatoes]
gb|ABK93231.1|  unknown                                               80.9    2e-16   Populus trichocarpa [western balsam poplar]
gb|ACN93800.1|  defensin precursor                                    80.9    3e-16   Vigna unguiculata
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         80.9    3e-16   Nicotiana sylvestris
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         80.9    3e-16   Nicotiana tomentosiformis
gb|AFM82500.1|  defensin                                              80.9    3e-16   Nicotiana tabacum [American tobacco]
gb|AIT42149.1|  defensin-like protein                                 80.5    4e-16   Solanum tuberosum [potatoes]
dbj|BAK07043.1|  predicted protein                                    81.3    5e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325734.2|  defensin-like family protein                     80.5    5e-16   
emb|CDP10467.1|  unnamed protein product                              80.9    5e-16   Coffea canephora [robusta coffee]
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    80.1    5e-16   Cucumis sativus [cucumbers]
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 80.1    6e-16   Nelumbo nucifera [Indian lotus]
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  80.1    6e-16   Capsicum annuum
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        79.7    7e-16   Sorghum bicolor [broomcorn]
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     80.5    8e-16   Cucumis sativus [cucumbers]
gb|AGT51229.1|  defensin                                              79.7    8e-16   Brassica napus [oilseed rape]
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   80.1    9e-16   Jatropha curcas
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               79.3    9e-16   Nelumbo nucifera [Indian lotus]
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               79.3    9e-16   Populus euphratica
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            79.7    9e-16   Solanum tuberosum [potatoes]
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               79.3    1e-15   Sesamum indicum [beniseed]
gb|AIA67012.1|  defensin                                              79.3    1e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    79.3    1e-15   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 79.3    1e-15   Jatropha curcas
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           79.3    1e-15   Citrus clementina [clementine]
ref|XP_003628978.1|  Defensin                                         79.3    1e-15   Medicago truncatula
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               79.3    1e-15   Elaeis guineensis
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               79.0    1e-15   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            80.5    1e-15   Glycine max [soybeans]
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 79.0    2e-15   Nicotiana tomentosiformis
gb|KHN23780.1|  Defensin SD2                                          79.0    2e-15   Glycine soja [wild soybean]
gb|AAL85480.1|  defensin protein 1                                    79.0    2e-15   Prunus persica
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  78.6    2e-15   
ref|NP_001234987.1|  protease inhibitor precursor                     78.6    2e-15   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           78.6    2e-15   Prunus persica
ref|XP_003629332.1|  Defensin                                         78.6    2e-15   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            78.6    2e-15   
gb|ACS96442.1|  defensin                                              78.6    2e-15   Jatropha curcas
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      78.2    3e-15   Nicotiana sylvestris
gb|ADK36631.1|  defensin-like protein                                 77.4    3e-15   Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               78.2    3e-15   Brassica rapa
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              77.8    4e-15   Erythranthe guttata [common monkey flower]
gb|AAS13434.1|  defensin                                              77.0    4e-15   Nicotiana attenuata
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           77.8    4e-15   Populus trichocarpa [western balsam poplar]
ref|NP_176302.2|  defensin-like protein                               77.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               77.8    5e-15   Eucalyptus grandis [rose gum]
gb|ABK28445.1|  unknown                                               77.4    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               77.4    6e-15   Malus domestica [apple tree]
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 77.0    6e-15   Nicotiana tomentosiformis
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           77.4    6e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               77.4    6e-15   Pyrus x bretschneideri [bai li]
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      77.4    6e-15   Nicotiana sylvestris
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    77.0    7e-15   
gb|EMS65298.1|  Defensin-like protein 1                               77.4    7e-15   Triticum urartu
dbj|BAK07823.1|  predicted protein                                    77.8    7e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 76.6    9e-15   Vernicia fordii [tung oil tree]
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               76.6    9e-15   Solanum lycopersicum
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    76.6    9e-15   Vitis vinifera
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  77.0    9e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 76.6    9e-15   Nicotiana sylvestris
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               76.3    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            76.6    1e-14   Solanum tuberosum [potatoes]
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  76.6    1e-14   Helianthus annuus
ref|XP_010088525.1|  Defensin-like protein 2                          76.6    1e-14   Morus notabilis
ref|NP_001148158.1|  LOC100281766 precursor                           76.6    1e-14   
ref|XP_002886566.1|  protease inhibitor II                            76.3    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    76.3    1e-14   Phoenix dactylifera
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           78.2    1e-14   Phaseolus vulgaris [French bean]
gb|AHA50468.1|  defensin-like protein 2                               76.3    1e-14   Citrullus lanatus [wild melon]
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    75.9    2e-14   Vitis vinifera
gb|ADK87340.1|  defensin                                              75.9    2e-14   Pyrus pyrifolia [sha li]
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    75.9    2e-14   Phoenix dactylifera
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               75.9    2e-14   Pyrus x bretschneideri [bai li]
gb|ABA81896.1|  putative defensin                                     75.5    2e-14   Aquilegia formosa
emb|CAH58740.1|  defensin                                             75.5    2e-14   Plantago major [cart-track plant]
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    75.9    2e-14   Sesamum indicum [beniseed]
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  75.9    2e-14   Petunia integrifolia [violet-flowered petunia]
gb|AAM62652.1|  protease inhibitor II                                 75.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               75.5    2e-14   Populus euphratica
ref|XP_003630422.1|  Defensin                                         75.5    3e-14   Medicago truncatula
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            74.7    3e-14   Medicago truncatula
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    3e-14   Pyrus x bretschneideri [bai li]
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   75.1    3e-14   Torenia fournieri [bluewings]
gb|KEH35661.1|  Defensin                                              75.1    4e-14   Medicago truncatula
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    4e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            74.7    4e-14   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           74.7    4e-14   Phaseolus vulgaris [French bean]
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    4e-14   Malus domestica [apple tree]
ref|NP_178319.1|  defensin-like protein 2                             74.7    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               75.1    5e-14   Brachypodium distachyon [annual false brome]
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          74.3    6e-14   Glycine max [soybeans]
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    74.3    6e-14   
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     74.3    6e-14   Cucumis sativus [cucumbers]
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  76.3    6e-14   
ref|XP_011462172.1|  PREDICTED: uncharacterized protein LOC105350880  75.9    6e-14   Fragaria vesca subsp. vesca
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               74.3    7e-14   Brassica rapa
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           74.3    7e-14   Eutrema salsugineum [saltwater cress]
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     74.3    7e-14   Setaria italica
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           74.3    8e-14   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   73.9    8e-14   Vitis vinifera
ref|NP_178321.1|  defensin-like protein 1                             74.3    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    73.9    8e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|ABS72000.1|  putative defensin protein 1                           73.6    8e-14   Olea europaea
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           73.9    8e-14   Capsella rubella
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               73.9    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               73.9    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               73.9    9e-14   Nicotiana tomentosiformis
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  73.9    9e-14   Cicer arietinum [garbanzo]
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               73.9    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               73.9    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           73.6    1e-13   Phaseolus vulgaris [French bean]
ref|NP_178320.1|  defensin-like protein 4                             73.6    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ADK91098.1|  PCP17C2                                               73.2    1e-13   Arabidopsis halleri
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           73.6    1e-13   Phaseolus vulgaris [French bean]
gb|ABA86586.1|  putative defensin 1                                   73.6    1e-13   Aquilegia formosa
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 73.6    1e-13   
gb|AHA50472.1|  defensin-like protein 5                               73.6    1e-13   Citrullus lanatus [wild melon]
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  73.2    2e-13   Cicer arietinum [garbanzo]
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        73.2    2e-13   Sorghum bicolor [broomcorn]
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           73.2    2e-13   Eutrema salsugineum [saltwater cress]
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  73.2    2e-13   Glycine max [soybeans]
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           73.2    2e-13   Capsella rubella
gb|ADQ43196.1|  unknown                                               73.2    2e-13   Schrenkiella parvula
gb|EMT03365.1|  Defensin-like protein 1                               73.2    2e-13   
gb|AIA67010.1|  defensin                                              73.2    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           72.8    2e-13   Capsella rubella
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  72.4    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            72.8    3e-13   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               72.4    3e-13   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               72.4    3e-13   Nicotiana sylvestris
gb|KHN09675.1|  Defensin-like protein                                 72.0    3e-13   Glycine soja [wild soybean]
ref|XP_007045354.1|  Defensin-like protein isoform 2                  72.4    3e-13   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    72.0    4e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|ABA86587.1|  putative defensin 1                                   72.0    4e-13   Aquilegia chrysantha
gb|AHA50470.1|  defensin-like protein 1                               72.0    4e-13   Citrullus lanatus [wild melon]
gb|KJB30731.1|  hypothetical protein B456_005G157500                  72.0    4e-13   Gossypium raimondii
gb|ABA86589.1|  putative defensin 1                                   71.6    5e-13   Aquilegia pyrenaica
gb|AGT51227.1|  defensin                                              71.6    6e-13   Brassica napus [oilseed rape]
ref|XP_003599384.1|  Defensin                                         71.6    6e-13   
emb|CDY48618.1|  BnaC09g20670D                                        71.6    7e-13   Brassica napus [oilseed rape]
ref|XP_007045353.1|  Defensin-like protein isoform 1                  71.6    7e-13   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  71.2    8e-13   Arabis alpina [alpine rockcress]
gb|AHA50471.1|  defensin-like protein 4                               71.2    9e-13   Citrullus lanatus [wild melon]
gb|AFE88173.1|  g-thionin                                             70.9    1e-12   Panax ginseng [Asiatic ginseng]
gb|AGT51228.1|  defensin                                              70.9    1e-12   Brassica napus [oilseed rape]
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               70.9    1e-12   Brassica rapa
gb|KJB11914.1|  hypothetical protein B456_002G029700                  70.9    1e-12   Gossypium raimondii
gb|KJB11913.1|  hypothetical protein B456_002G029700                  70.9    1e-12   Gossypium raimondii
gb|AHA50473.1|  defensin-like protein 6                               70.5    1e-12   Citrullus lanatus [wild melon]
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  70.5    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              70.5    1e-12   Erythranthe guttata [common monkey flower]
gb|EYU18232.1|  hypothetical protein MIMGU_mgv1a015502mg              72.4    2e-12   Erythranthe guttata [common monkey flower]
gb|AIA67013.1|  defensin                                              70.1    2e-12   Triticum aestivum [Canadian hard winter wheat]
gb|ADK91116.1|  PCP17C2                                               69.3    2e-12   Arabidopsis halleri
gb|EEC76838.1|  hypothetical protein OsI_14993                        69.7    3e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001052199.1|  Os04g0189400                                     70.5    3e-12   
gb|KHN16909.1|  Defensin J1-2                                         69.3    4e-12   Glycine soja [wild soybean]
ref|XP_006384382.1|  hypothetical protein POPTR_0004s14520g           69.3    4e-12   
gb|ACV84385.1|  defensin precursor                                    69.3    5e-12   Triticum turgidum subsp. durum
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               68.9    6e-12   Nicotiana sylvestris
gb|AFK47422.1|  unknown                                               68.6    7e-12   Lotus japonicus
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            68.6    7e-12   Glycine max [soybeans]
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  67.8    9e-12   Spinacia oleracea
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  68.2    1e-11   Triticum urartu
gb|AIA67009.1|  defensin                                              68.2    1e-11   Triticum aestivum [Canadian hard winter wheat]
gb|AAA91049.1|  protease inhibitor II                                 68.2    1e-11   Brassica rapa
gb|AAG38520.1|AF283535_1  proteinase inhibitor se60-like protein      67.8    1e-11   Citrus x paradisi [grapefruit]
gb|AGC82207.1|  defensin                                              68.2    1e-11   Persea americana var. drymifolia [Mexican avocado]
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           67.8    1e-11   Eutrema salsugineum [saltwater cress]
gb|EMT11359.1|  Defensin-like protein P322                            67.8    1e-11   
gb|EMT03363.1|  hypothetical protein F775_43918                       68.2    1e-11   
gb|ACV84379.1|  defensin precursor                                    67.8    2e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EMS49334.1|  Defensin-like protein                                 67.8    2e-11   Triticum urartu
gb|AAL14240.1|  proteinase inhibitor                                  67.0    2e-11   Musa acuminata AAA Group [Cavendish banana]
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  67.4    2e-11   
sp|P86518.1|DEF1_ECHCG  RecName: Full=Defensin Ec-AMP-D1              66.6    2e-11   Echinochloa crus-galli [barnyard grass]
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  67.8    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      67.0    3e-11   
gb|KJB11873.1|  hypothetical protein B456_002G043900                  67.0    3e-11   Gossypium raimondii
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             67.0    3e-11   Brachypodium distachyon [annual false brome]
gb|EMT03364.1|  Defensin SD2                                          67.0    3e-11   
sp|P86519.1|DEF2_ECHCG  RecName: Full=Defensin Ec-AMP-D2              66.2    3e-11   Echinochloa crus-galli [barnyard grass]
gb|EMS65297.1|  Defensin SD2                                          67.0    3e-11   Triticum urartu
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           67.0    3e-11   Prunus persica
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           67.0    3e-11   Prunus persica
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           67.0    3e-11   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       67.0    3e-11   Cicer arietinum [garbanzo]
gb|EMT00351.1|  Defensin-like protein                                 67.0    3e-11   
sp|P83399.1|DEF1_VIGUN  RecName: Full=Defensin-like protein 1; Al...  65.9    4e-11   Vigna unguiculata
ref|XP_006466198.1|  PREDICTED: defensin-like protein 6-like          66.6    4e-11   
gb|ACB20518.1|  defensin precursor                                    66.6    4e-11   Saccharum officinarum [noble cane]
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           66.6    5e-11   Prunus persica
gb|KJB12908.1|  hypothetical protein B456_002G043800                  67.0    5e-11   Gossypium raimondii
gb|AIA67004.1|  defensin                                              66.2    6e-11   Triticum aestivum [Canadian hard winter wheat]
gb|AIA66990.1|  defensin                                              66.2    6e-11   Triticum aestivum [Canadian hard winter wheat]
gb|KHG09995.1|  Defensin-like protein 1                               65.9    6e-11   Gossypium arboreum [tree cotton]
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               65.9    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426419.1|  hypothetical protein CICLE_v10026887mg           65.5    8e-11   
gb|ACV84382.1|  defensin precursor                                    65.9    9e-11   Triticum turgidum subsp. durum
ref|XP_006426420.1|  hypothetical protein CICLE_v10026887mg           65.5    9e-11   Citrus clementina [clementine]
gb|ACV84384.1|  defensin precursor                                    65.5    1e-10   Triticum turgidum subsp. durum
gb|ABX84378.1|  amylase inhibitor-like protein                        65.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ABX84377.1|  amylase inhibitor-like protein                        65.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|AIA67015.1|  defensin                                              65.1    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               65.1    1e-10   
gb|EPS67569.1|  gamma-thionin                                         64.3    1e-10   Genlisea aurea
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      64.7    2e-10   Genlisea aurea
gb|ABK21016.1|  unknown                                               65.1    2e-10   Picea sitchensis
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    64.3    2e-10   
gb|ABK23037.1|  unknown                                               64.7    2e-10   Picea sitchensis
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             64.7    2e-10   Brachypodium distachyon [annual false brome]
gb|EMT30046.1|  Defensin-like protein P322                            64.7    2e-10   
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    63.9    3e-10   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  63.9    3e-10   Capsicum annuum
gb|ACM50880.1|  defensin                                              63.5    3e-10   Capsicum frutescens [bird pepper]
gb|AIA66999.1|  defensin                                              63.9    4e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           63.9    4e-10   Phaseolus vulgaris [French bean]
gb|AIA67000.1|  defensin                                              63.9    4e-10   Triticum aestivum [Canadian hard winter wheat]
gb|AAW33979.1|  proteinase inhibitor SE60-like protein                63.5    4e-10   Ammopiptanthus mongolicus
gb|KJB11874.1|  hypothetical protein B456_002G044000                  63.2    5e-10   Gossypium raimondii
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            63.5    5e-10   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       63.5    5e-10   Oryza brachyantha
gb|AFD01290.1|  defensin 3                                            63.5    5e-10   Pinus sylvestris [Scotch pine]
emb|CEJ09690.1|  Defensin protein                                     63.5    6e-10   Zea mays [maize]
ref|NP_001047493.1|  Os02g0629800                                     63.5    6e-10   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             63.2    6e-10   Erythranthe guttata [common monkey flower]
gb|KJB11911.1|  hypothetical protein B456_002G029500                  63.2    7e-10   Gossypium raimondii
gb|KJB75524.1|  hypothetical protein B456_012G045400                  63.2    7e-10   Gossypium raimondii
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  63.2    7e-10   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           63.2    7e-10   Zea mays [maize]
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               63.2    8e-10   Sesamum indicum [beniseed]
ref|NP_201171.1|  defensin-like protein 6                             62.8    8e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AIA66989.1|  defensin                                              62.8    9e-10   Triticum aestivum [Canadian hard winter wheat]
sp|Q07502.1|DEF_SOYBN  RecName: Full=Defensin-like protein; AltNa...  62.8    9e-10   
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  63.9    1e-09   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        62.8    1e-09   
gb|ABK23404.1|  unknown                                               62.8    1e-09   
sp|A4L7R7.1|DEF1_PINSY  RecName: Full=Defensin-1; Flags: Precursor    62.8    1e-09   
gb|KJB11872.1|  hypothetical protein B456_002G044200                  62.4    1e-09   
gb|ABM89231.1|  defensin                                              62.8    1e-09   
gb|KHG06821.1|  Defensin-like protein                                 62.4    1e-09   
sp|A4L7R8.1|DEF2_PINSY  RecName: Full=Defensin-2; Flags: Precursor    62.4    1e-09   
gb|EAY86781.1|  hypothetical protein OsI_08161                        67.0    1e-09   
gb|AIA67014.1|  defensin                                              62.4    1e-09   
dbj|BAK07467.1|  predicted protein                                    62.4    1e-09   
gb|AAR84643.1|  defensin                                              62.4    1e-09   
ref|XP_011070575.1|  PREDICTED: defensin Ec-AMP-D2-like               62.4    1e-09   
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   62.0    2e-09   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  62.0    2e-09   
ref|XP_008780828.1|  PREDICTED: defensin-like protein 1               61.6    2e-09   
dbj|BAD25113.1|  hypothetical protein                                 62.4    2e-09   
gb|AIC35288.1|  defensin 4                                            62.0    2e-09   
gb|AIA67011.1|  defensin                                              61.6    2e-09   
gb|ACV84383.1|  defensin precursor                                    61.6    3e-09   
emb|CAA62761.1|  putative gamma-thionin protein                       61.2    3e-09   
gb|ABK25062.1|  unknown                                               61.2    4e-09   
ref|XP_008669654.1|  PREDICTED: defensin Ec-AMP-D1-like               60.8    4e-09   
gb|ACV84381.1|  defensin precursor                                    61.2    4e-09   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           61.2    4e-09   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               61.2    4e-09   
emb|CEJ09689.1|  Defensin protein                                     60.8    5e-09   
sp|P84965.1|DEF11_TRIKH  RecName: Full=Defensin Tk-AMP-D1.1           60.1    5e-09   
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    60.5    5e-09   
gb|AIA66987.1|  defensin                                              60.8    5e-09   
gb|ABK20960.1|  unknown                                               60.8    5e-09   
dbj|BAB64929.1|  defensin-like protein                                60.8    5e-09   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           60.8    5e-09   
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               60.8    5e-09   
ref|XP_002864860.1|  predicted protein                                60.5    6e-09   
ref|XP_010038383.1|  PREDICTED: uncharacterized protein LOC104426904  62.8    7e-09   
ref|XP_004972594.1|  PREDICTED: defensin-like protein 21-like         60.5    7e-09   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           60.1    7e-09   
gb|AAF72043.1|  defensin CUA1                                         59.3    7e-09   
gb|EMT18782.1|  Defensin-like protein                                 64.3    7e-09   
gb|AAF66592.1|  defensin                                              59.3    8e-09   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  60.1    9e-09   
emb|CAD41436.1|  OSJNBa0019D11.21                                     60.1    9e-09   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              59.7    9e-09   
gb|EMT16291.1|  Defensin SD2                                          60.1    1e-08   
emb|CDY39856.1|  BnaC02g42620D                                        59.7    1e-08   
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               60.1    1e-08   
emb|CEJ09688.1|  Defensin protein                                     59.7    1e-08   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           59.7    1e-08   
dbj|BAD25504.1|  hypothetical protein                                 59.7    1e-08   
dbj|BAK06284.1|  predicted protein                                    60.1    1e-08   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           59.7    1e-08   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  59.3    1e-08   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       59.7    1e-08   
gb|ADQ43197.1|  unknown                                               59.3    2e-08   
gb|AIA66994.1|  defensin                                              59.3    2e-08   
gb|AGT51230.1|  defensin                                              58.5    2e-08   
gb|EMS54459.1|  Defensin Tk-AMP-D5                                    58.9    2e-08   
gb|EMS53152.1|  Defensin-like protein 2                               58.9    2e-08   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           58.9    2e-08   
gb|EMT06279.1|  Defensin-like protein 2                               58.9    2e-08   
gb|AIA67007.1|  defensin                                              58.5    3e-08   
gb|AIA66992.1|  defensin                                              58.9    3e-08   
gb|EMT11361.1|  Defensin Tk-AMP-D6                                    58.5    3e-08   
gb|AAN40688.1|  putative plant defensin SPI1B                         58.5    3e-08   
ref|XP_003581056.1|  PREDICTED: defensin Ec-AMP-D1-like               58.2    3e-08   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               58.5    4e-08   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               58.2    4e-08   
gb|ACU13843.1|  unknown                                               58.5    4e-08   
gb|AIA66993.1|  defensin                                              58.2    4e-08   
ref|NP_001240040.1|  uncharacterized protein LOC100787787             58.5    4e-08   
gb|ACV84380.1|  defensin precursor                                    58.2    4e-08   
gb|ABW99097.1|  defensin                                              57.8    4e-08   
gb|AAU04859.1|  defensin precursor                                    58.2    5e-08   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               57.8    5e-08   
ref|NP_001147137.1|  LOC100280744 precursor                           57.8    5e-08   
gb|EMT19618.1|  hypothetical protein F775_43215                       57.4    5e-08   
gb|KHN31219.1|  Defensin-like protein 1                               57.0    5e-08   
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            57.8    6e-08   
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  57.8    6e-08   
ref|NP_178322.1|  defensin-like protein 10                            57.4    6e-08   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           57.4    6e-08   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    57.4    7e-08   
dbj|BAJ89304.1|  predicted protein                                    57.4    7e-08   
emb|CAA65045.1|  defensin                                             57.4    8e-08   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               57.4    8e-08   
ref|XP_004250638.1|  PREDICTED: defensin-like protein                 57.8    9e-08   
sp|P81457.1|DEF2_VICFA  RecName: Full=Defensin-like protein 2; Al...  56.6    9e-08   
sp|P81456.1|DEF1_VICFA  RecName: Full=Defensin-like protein 1; Al...  56.6    9e-08   
gb|AIA67016.1|  defensin                                              57.4    9e-08   
dbj|BAC10287.1|  defensin                                             57.4    9e-08   
dbj|BAK04173.1|  predicted protein                                    57.0    1e-07   
ref|XP_007213203.1|  hypothetical protein PRUPE_ppb011708mg           57.0    1e-07   
gb|ACI02057.1|  fabatin precursor                                     56.6    1e-07   
emb|CDM85870.1|  unnamed protein product                              56.6    1e-07   
gb|EMT03877.1|  Defensin Tk-AMP-D3                                    56.6    1e-07   
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               56.6    1e-07   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  57.0    1e-07   
gb|AFQ69079.1|  defensin precursor                                    56.6    2e-07   
ref|XP_006339360.1|  PREDICTED: defensin-like protein-like            57.0    2e-07   
gb|EYU27578.1|  hypothetical protein MIMGU_mgv1a026683mg              56.2    2e-07   
dbj|BAK04559.1|  predicted protein                                    56.6    2e-07   
gb|EMT17852.1|  hypothetical protein F775_43789                       56.2    2e-07   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      56.2    2e-07   
gb|EMT26158.1|  Defensin-like protein                                 56.2    2e-07   
ref|XP_004242654.1|  PREDICTED: defensin-like protein                 56.6    2e-07   
ref|XP_011070576.1|  PREDICTED: defensin Ec-AMP-D1-like               56.2    2e-07   
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  55.8    3e-07   
gb|EAY84990.1|  hypothetical protein OsI_06352                        56.2    3e-07   
sp|P84968.1|DEF2_TRIKH  RecName: Full=Defensin Tk-AMP-D2              55.1    3e-07   
ref|XP_009351648.1|  PREDICTED: defensin-like protein 1               55.8    3e-07   
gb|EMS54457.1|  Defensin Tk-AMP-D4                                    55.8    3e-07   
gb|EMT02837.1|  Defensin J1-2                                         55.5    3e-07   
gb|AIA67003.1|  defensin                                              55.5    3e-07   
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    55.8    3e-07   
gb|AIC35289.1|  defensin 5.1                                          55.5    4e-07   
sp|P21924.1|DEF2_SORBI  RecName: Full=Defensin-like protein 2; Al...  54.7    4e-07   
ref|XP_003581053.1|  PREDICTED: defensin Tk-AMP-D5-like               55.5    4e-07   
ref|XP_004250637.1|  PREDICTED: defensin-like protein                 55.5    7e-07   
gb|KHN17432.1|  Defensin-like protein                                 54.3    7e-07   
gb|AEW08922.1|  hypothetical protein CL2287Contig1_03                 54.3    7e-07   
ref|XP_003525155.1|  PREDICTED: uncharacterized LOC100306228          54.7    8e-07   
dbj|BAD25507.1|  hypothetical protein                                 55.1    9e-07   
ref|XP_010246429.1|  PREDICTED: defensin-like protein                 54.7    9e-07   
gb|EMT11360.1|  Defensin Tk-AMP-D4                                    54.3    9e-07   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           54.3    9e-07   
ref|XP_006395807.1|  hypothetical protein EUTSA_v10005233mg           54.3    1e-06   
sp|P84966.1|DEF5_TRIKH  RecName: Full=Defensin Tk-AMP-D5              53.5    1e-06   
ref|NP_001148374.1|  LOC100281986 precursor                           54.3    1e-06   
gb|KFK33429.1|  hypothetical protein AALP_AA5G012100                  55.1    1e-06   
emb|CDY04774.1|  BnaC05g18150D                                        55.1    1e-06   
ref|XP_010229304.1|  PREDICTED: defensin Tk-AMP-D1.1-like             53.9    1e-06   
ref|NP_001172824.1|  Os02g0172500                                     54.3    1e-06   
ref|NP_001149230.1|  LOC100282852 precursor                           53.9    1e-06   
gb|EMS62517.1|  Defensin SD2                                          54.3    1e-06   
ref|NP_001150374.1|  low-molecular-weight cysteine-rich protein L...  53.9    1e-06   
dbj|BAJ86109.1|  predicted protein                                    53.9    2e-06   
sp|P84969.1|DEF61_TRIKH  RecName: Full=Defensin Tk-AMP-D6.1           53.1    2e-06   
ref|XP_004976260.1|  PREDICTED: defensin-like protein-like            53.9    2e-06   
gb|AIC35290.1|  defensin 5.2                                          53.5    2e-06   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  53.5    2e-06   
emb|CDP16306.1|  unnamed protein product                              53.1    3e-06   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        53.1    3e-06   
ref|XP_010245186.1|  PREDICTED: defensin-like protein 1               52.8    3e-06   
ref|XP_007214706.1|  hypothetical protein PRUPE_ppb018272mg           52.8    3e-06   
gb|KJB11912.1|  hypothetical protein B456_002G029600                  52.8    3e-06   
ref|XP_011086331.1|  PREDICTED: putative defensin-like protein 3      53.5    4e-06   
sp|P20159.1|DEF2_WHEAT  RecName: Full=Defensin-like protein 2; Al...  52.4    4e-06   
sp|P81008.1|DEF1_MAIZE  RecName: Full=Defensin-like protein 1; Al...  52.0    4e-06   
ref|XP_002446148.1|  hypothetical protein SORBIDRAFT_06g002510        52.8    4e-06   
emb|CAH65876.1|  OSIGBa0160I04.2                                      52.8    5e-06   
sp|P84967.1|DEF6_TRIKH  RecName: Full=Defensin Tk-AMP-D6              52.0    5e-06   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             52.8    5e-06   
ref|XP_011070572.1|  PREDICTED: defensin J1-2-like                    52.4    6e-06   
sp|P20230.1|DEF1_HORVU  RecName: Full=Defensin-like protein 1; Al...  51.6    6e-06   
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           52.4    7e-06   
gb|EMT32128.1|  Defensin-like protein                                 52.8    7e-06   
gb|ADQ43198.1|  unknown                                               52.0    7e-06   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               52.0    9e-06   
sp|Q09198.1|DEF21_SORBI  RecName: Full=Defensin-like protein 21; ...  51.2    1e-05   
ref|XP_009137059.1|  PREDICTED: LOW QUALITY PROTEIN: defensin-lik...  51.2    1e-05   
ref|XP_007203110.1|  hypothetical protein PRUPE_ppa023889mg           51.2    1e-05   
ref|XP_006364006.1|  PREDICTED: defensin-like protein 10-like         51.2    1e-05   
sp|P20158.1|DEF1_WHEAT  RecName: Full=Defensin-like protein 1; Al...  50.8    1e-05   
ref|XP_006365640.1|  PREDICTED: defensin-like protein-like            52.0    1e-05   
sp|P21925.2|DEF3_SORBI  RecName: Full=Defensin-like protein 3; Al...  50.8    1e-05   
ref|XP_004975163.1|  PREDICTED: defensin-like protein-like            51.2    1e-05   
ref|XP_008667949.1|  PREDICTED: LOC100281986 isoform X1               54.7    1e-05   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          51.2    2e-05   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  51.2    2e-05   
emb|CDO99915.1|  unnamed protein product                              51.2    2e-05   
gb|EMS56168.1|  Defensin-like protein 6                               51.2    2e-05   
gb|ACU14316.1|  unknown                                               50.8    2e-05   
ref|XP_009761334.1|  PREDICTED: uncharacterized protein LOC104213512  51.6    2e-05   
gb|EPS59162.1|  defensin                                              50.4    2e-05   
ref|XP_002879355.1|  hypothetical protein ARALYDRAFT_482123           50.1    3e-05   
dbj|BAD25506.1|  hypothetical protein                                 50.8    3e-05   
ref|XP_004975165.1|  PREDICTED: defensin-like protein 2-like          50.4    3e-05   
gb|ACG49007.1|  hypothetical protein                                  49.7    4e-05   
ref|XP_010240717.1|  PREDICTED: uncharacterized protein LOC104585502  50.8    5e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               49.7    5e-05   
ref|XP_009342667.1|  PREDICTED: defensin-like protein 2               50.1    5e-05   
sp|P84964.1|DEF12_TRIMO  RecName: Full=Defensin Tm-AMP-D1.2           49.3    5e-05   
ref|XP_009793541.1|  PREDICTED: defensin-like protein                 50.1    5e-05   
gb|KDO61571.1|  hypothetical protein CISIN_1g029977mg                 51.6    6e-05   
ref|XP_002451983.1|  hypothetical protein SORBIDRAFT_04g012170        49.7    6e-05   
dbj|BAB64931.1|  defensin-like protein                                49.7    7e-05   
ref|XP_011095738.1|  PREDICTED: extensin-like                         52.0    7e-05   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               49.7    7e-05   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               49.7    7e-05   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             49.7    7e-05   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               49.3    8e-05   
sp|P84970.1|DEF3_TRIKH  RecName: Full=Defensin Tk-AMP-D3              48.5    8e-05   
ref|XP_004954814.1|  PREDICTED: defensin SD2-like                     49.3    8e-05   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             49.3    8e-05   
ref|XP_006422269.1|  hypothetical protein CICLE_v10005867mg           51.2    1e-04   
ref|XP_009598624.1|  PREDICTED: defensin-like protein                 49.3    1e-04   
sp|P84971.1|DEF4_TRIKH  RecName: Full=Defensin Tk-AMP-D4              48.1    1e-04   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               48.9    1e-04   
ref|XP_008385108.1|  PREDICTED: defensin-like protein 2               48.5    2e-04   
gb|AFM82501.1|  defensin                                              48.1    2e-04   
ref|XP_002862935.1|  low-molecular-weight cysteine-rich 76            48.1    2e-04   
ref|XP_009793542.1|  PREDICTED: defensin-like protein                 48.5    2e-04   
gb|EYU33797.1|  hypothetical protein MIMGU_mgv1a018660mg              49.3    2e-04   
ref|NP_001146997.1|  flower-specific gamma-thionin                    47.8    2e-04   
ref|NP_001146981.1|  flower-specific gamma-thionin precursor          47.8    3e-04   
ref|NP_001152704.1|  low-molecular-weight cysteine-rich protein L...  47.8    3e-04   
ref|XP_011099655.1|  PREDICTED: defensin-like protein 1               47.8    3e-04   
sp|P84963.1|DEF1_TRIKH  RecName: Full=Defensin Tk-AMP-D1              47.4    3e-04   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               47.8    3e-04   
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               47.4    4e-04   
ref|XP_002513755.1|  Low-molecular-weight cysteine-rich protein L...  47.4    4e-04   
sp|Q8GTM0.1|DEF_NICAL  RecName: Full=Flower-specific defensin; Al...  47.4    6e-04   
gb|AHZ55769.1|  DEF2                                                  47.4    6e-04   
gb|ACQ90609.1|  defensin-like protein                                 47.0    7e-04   
ref|XP_011086334.1|  PREDICTED: uncharacterized protein LOC105168097  47.8    0.001   
gb|AAD21200.1|  putative gamma-thionin precursor                      47.0    0.001   
ref|XP_010497013.1|  PREDICTED: putative defensin-like protein 9      46.2    0.001   



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TELGTN IMVAEARMCES SSKFKGPC+RDSNCATVCHTEGF+GGDCKG RRRCFCTKPC
Sbjct  21   TELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRRCFCTKPC  80



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  TI  AEAR CES S +FKGPC+RDSNCATVC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21   TEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  TI  AEAR CES S +FKGPC+RDSNCATVC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21   TEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
 gb|AFM82499.1| defensin [Nicotiana tabacum]
Length=78

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  TI  AEAR CES S +FKGPC+RDSNCATVC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21   TEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  TI  AEAR CES S +F+GPC R+ NCA VC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  21   TEMGPMTI--AEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  TI  AEAR CES   +FKGPC+RD NCATVC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  21   TEMGPMTI--AEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+GT   MVAEAR CES S +FKGPC R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  21   TEMGT---MVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+GT   MVAEAR CES S +FKGPC R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  21   TEMGT---MVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  TI  AEAR CES S +F+G C R+ NCA VC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  21   TEMGPMTI--AEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_004297786.1| PREDICTED: defensin Ec-AMP-D2-like [Fragaria vesca subsp. vesca]
Length=79

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            T +G N  MVAEAR CE+ S KFKG C R+SNCA+VC TEGF+GGDC+GLRRRCFCTK C
Sbjct  21   TGMGPNA-MVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGLRRRCFCTKHC  79



>ref|XP_004297787.1| PREDICTED: defensin Ec-AMP-D2-like [Fragaria vesca subsp. vesca]
Length=79

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            T +G NT MVAEAR CES S KFKG C  ++NCA+VC TEGFSGGDC+GLRRRCFCTK C
Sbjct  21   TGMGPNT-MVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGLRRRCFCTKHC  79



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + EAR+CESPS +FKGPC  D NCA+VC TEGF+GGDC+GLRRRCFCTK C
Sbjct  28   IIEARICESPSQRFKGPCLTDRNCASVCETEGFTGGDCRGLRRRCFCTKEC  78



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            IMVAEAR CES S  FKG C RD NCA VC TEGF+GG CKG RRRCFC KPC
Sbjct  26   IMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQCKGFRRRCFCNKPC  78



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   IMVAEAR CE+PS+ FKG C  D+NCA+VC TEGF GG C+G R+RCFCTKPC
Sbjct  21   TEMGP--IMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQRCFCTKPC  78



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  21   TEMGP--MRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + T    + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  19   MATGPTRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGLRRRCFCTRPC  76



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  21   TEMGP--MRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  21   TEMGP--MRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + T  + + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  19   MATGPMKIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + T  + + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  19   MATGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + T  + + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  15   MATGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  72



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+GT   MVA+AR CES S +FKGPC R SNCA VC TEGF  G C+G+RRRCFCTK C
Sbjct  21   TEMGT---MVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRGIRRRCFCTKHC  77



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            T+LG   + +A AR CESPS +F+GPC+RD+NCATVC TEGF+GG CKGLR RCFCTK C
Sbjct  22   TQLGP--VTMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCTKDC  79



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  22   MRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  74



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +FKGPC R SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27   MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 5/63 (8%)
 Frame = +3

Query  132  LGTNT-----IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCT  296
            +G NT     I +A AR CESPS KF+GPC+RD+NCA+VC TEGF+GG+CKGLR RCFCT
Sbjct  16   IGYNTETQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCT  75

Query  297  KPC  305
            + C
Sbjct  76   RDC  78



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   I+  EAR CES S +FKG CA ++NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21   TEMGPMRIV--EARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +E+GT  +  AEAR CES S++FKG C RDSNCATVC TEGF GG+C+G RRRCFCT+ C
Sbjct  21   SEMGT--MSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC  78



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKG C R SNCA VC TEGF GG+C+G RRRCFCTK C
Sbjct  21   TEMGP---MVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRCFCTKHC  77



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21   TEMGP--MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKGPC  D+NCA+VCH E FSGG C+G RRRCFCTK C
Sbjct  21   TEMGPT--MVAEARDCESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGFRRRCFCTKHC  78



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21   TEMGP--MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKGPC  D+NCA+VC TE FSGG C+G RRRCFCTK C
Sbjct  21   TEMGPR--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCFCTKHC  78



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +MVAEAR CES S +F G C R SNCA+VC TEGF+GG C+G RRRCFCTKPC
Sbjct  28   VMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21   TEMGP--MRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + T   MVAEAR CES S KFKGPCA D NCA+VC TE FSGG C+G RRRCFCT  C
Sbjct  19   VATGPSMVAEARTCESQSHKFKGPCASDHNCASVCQTERFSGGHCRGFRRRCFCTTHC  76



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  6    TEMGP--MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  63



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   I VAEAR+C+S S+ FKGPC  D +CA VC TEGF+GG C+GLRR CFCTKPC
Sbjct  21   TEMGP--IKVAEARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRRICFCTKPC  78



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   I  AEAR CES S+ FKG C RDSNCATVC TEGF GG+C+G RRRCFCT+ C
Sbjct  22   TEMGP--ISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC  79



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   I+  EAR CES S +FKGPC  D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21   TEMGPTRIV--EARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  AE R CES S KFKGPC+RDSNCA+VC  EGF+GGDC+G RRRCFCT+ C
Sbjct  22   VKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            E+G   +MVAEAR CES S +FKGPCAR +NCA+VC+TEGF  G C G+RRRC CTKPC
Sbjct  23   EMG-GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPC  80



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            M+ EAR CES S KFKGPC R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  26   MMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCRGFRRRCFCTKHC  77



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +FKG C R+SNCA +C TEGF GG C+GLRRRCFCTK C
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKHC  77



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKGPC  D+NC +VC TEGFSGG C+G  RRCFCTK C
Sbjct  21   TEMGPT--MVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFCTKEC  78



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + + VAEAR CES S +FKG C R SNCA VC TEGF GG C GLRRRCFC+KPC
Sbjct  24   DPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGLRRRCFCSKPC  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L  +T M+AEAR CES S +FKG C   SNC +VCHTEGFSGG C+G RRRCFCT+ C
Sbjct  17   LVFSTGMIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGFRRRCFCTRHC  74



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +3

Query  132  LGTNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L +  ++V  EAR+C+S S  FKGPCARD NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  17   LASQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  75



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKGPC  D+NCA+VC TE FSGG C+G RRRC CTK C
Sbjct  21   TEMGPT--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCLCTKHC  78



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +FKG C   SNCA+VCHTEGF+GG C+G RRRCFCT+ C
Sbjct  26   MVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCRGFRRRCFCTRHC  77



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKG C   SNCA+VCHTEGF GG C+G RRRCFCT+ C
Sbjct  21   TEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFCTRHC  77



>gb|AFM82500.1| defensin [Nicotiana tabacum]
Length=77

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G    MVAEAR CES S +FKG C   SNCA+VCHTEGF GG C+G RRRCFCT+ C
Sbjct  21   TEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFCTRHC  77



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RR CFCTKPC
Sbjct  21   TEMGP--MRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRLCFCTKPC  78



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VAEAR CESPS  F+GPC R  NCA VC TEGF GG+C+GLRRRCFCT  C
Sbjct  50   VAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHC  102



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
              ++  EAR+C+S S  FKGPCARD NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  22   EVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  76



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + A  R CE+PS +FKGPC ++SNCA VC TEGF GG C+GLRRRCFCT+PC
Sbjct  50   VAAIERTCETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR+CESPS  FKG C  D+NC  +C TEGFSGG C+G RRRCFCTK C
Sbjct  22   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC  73



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G     VAEAR CES S +FKG C  D+NCA+VC TEGF  GDCKG RRRCFC KPC
Sbjct  21   TEMGPK---VAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC  77



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            T MVAEAR CES S +FKG C   SNC +VCHTEGF+GG C+G RRRCFCT+ C
Sbjct  21   TGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  74



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VA AR C+S S KFKGPC+RD NCATVC TEGF+ G C+GLRRRCFCT+ C
Sbjct  26   VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>gb|KGN62247.1| hypothetical protein Csa_2G340400 [Cucumis sativus]
Length=107

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AEARMC+S S  F GPC RD NCA VC TEGFSGG+C G RRRCFCT  C
Sbjct  58   AEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  107



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EAR CES S +FKGPC  D+NCA VCH EGF GG C+GLRRRCFCT+ C
Sbjct  28   VEARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGKCRGLRRRCFCTRHC  77



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +FKG C R+SNCA +C TEGF GG C+GLRRRCFCT  C
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTMYC  77



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            VAEAR CES S +FKG C R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  27   VAEARTCESQSHRFKGICVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +3

Query  132  LGTNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L +  ++V  EAR+C S S  FKGPCARD NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  17   LASQEVVVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  75



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AEAR CES S  FKGPC  D+NCA+VC TEGF GGDC+GLRR+CFCT+ C
Sbjct  30   AEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGLRRQCFCTRNC  79



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MV EAR CES S +FKG C   +NCA+VCHTEGF GG+C+G RRRCFCTK C
Sbjct  23   MVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGFRRRCFCTKHC  74



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGFS G C+G RRRCFCT  C
Sbjct  23   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR+CESPS  FKG C  D+NC  +C TEGFSGG C+G RRRCFCTK C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G+    +AEAR CES S KFKG C  ++NCA VC TEGF+GGDC+GLRRRCFCT+ C
Sbjct  21   TEIGSK---MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +E+G   +  AEAR+CES S +FKGPC   SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  20   SEMG---LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC  76



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G +  MVA AR CE+PS+ FKG C  D+NCA+VC TEGF GG CKG R+RCFCTKPC
Sbjct  21   TEMGPS--MVA-ARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGFRQRCFCTKPC  77



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +E+GT    VAEAR CES S KF+G C R+SNCA VC TEGF GG C+G+RRRCFCT+ C
Sbjct  21   SEMGTK---VAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTRLC  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAE R CES S++FKG C   SNCA VC TEGF GG+C+GLRRRCFCTK C
Sbjct  24   MVAEGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCTKHC  75



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTK  299
            TE+G    MVAEAR CES S +FKGPC  D+NC +VC TEGFSGG C+G  RRCFCTK
Sbjct  21   TEMGPT--MVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFCTK  76



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   +  AEAR CES S +F G C RDSNCA++C TEGF GG+C+G RRRCFCT+ C
Sbjct  18   TEMGQ--MSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRGFRRRCFCTRNC  75



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +FKGPC  D+NC +VC TE F+GG C+G RRRCFCTK C
Sbjct  28   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S++FKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  28   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  79



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
              I+  EAR+CES S  FKGPC RD NCA VC  E FSGG CKG+RRRCFCTK C
Sbjct  20   EAIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCFCTKLC  74



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +FKGPC  D+NC +VC TE F+GG C+G RRRCFCTK C
Sbjct  28   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S++FKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G+  IMV EAR C S S  FKG C  D NCATVC TEGF+ G C+G R+RCFC+KPC
Sbjct  21   TEMGS--IMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFRQRCFCSKPC  78



>ref|XP_004147317.1| PREDICTED: defensin-like protein-like [Cucumis sativus]
 ref|XP_004170998.1| PREDICTED: defensin-like protein-like [Cucumis sativus]
Length=79

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AEARMC+S S  F GPC RD NCA VC TEGFSGG+C G RRRCFCT  C
Sbjct  30   AEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  79



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G+    +AEAR CES + KFKG C  ++NCA VC TEGF+GGDC+GLRRRCFCT+ C
Sbjct  21   TEIGSK---MAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   IMVAEAR CES S +FKG C  + NCA+VC+TEGF  G CKGLRRRCFC + C
Sbjct  22   TEMGP--IMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  79



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  162  ARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  1    ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  48



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EAR CES S +FKGPC  ++NCA VCH EGF GG C+GLRRRCFCT+ C
Sbjct  28   VEARTCESQSHRFKGPCVSENNCANVCHNEGFGGGKCRGLRRRCFCTRHC  77



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +3

Query  132  LGTNTIMVAEA-RMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L  +T MVAEA R CE+ S +FKG CAR +NCA VC TEGF GG C+G RRRCFCTK C
Sbjct  17   LVFSTGMVAEATRTCEAKSHRFKGICARKANCAAVCQTEGFHGGHCRGFRRRCFCTKHC  75



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAEAR CES S +F+G C   SNC +VCHTEGF+GG C+G RRRCFCT+ C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  TNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  +MV AEAR+C S S  FKGPC R  NCA+VC TEGF GG+CKG RRRCFC KPC
Sbjct  18   SQEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ++  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  24   LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MV EAR CES S +FKG C   +NCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  26   MVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRGFRRRCFCTKHC  77



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ++  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  24   LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAE R C+S S +FKG C   SNCATVC TEGF GG C+G RRRCFCTK C
Sbjct  26   MVAEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGGHCRGFRRRCFCTKHC  77



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   +MVAEAR CES S +FKG C  + NCA+VC+TEGF  G CKGLRRRCFC + C
Sbjct  18   TEMGP--VMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  75



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EARMCES S  F GPC   +NCA +CH EGF+ GDC+G RRRC CT+PC
Sbjct  30   VEARMCESSSQLFNGPCLSTTNCANICHNEGFTDGDCQGFRRRCICTRPC  79



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            M+AE R CE+ S KFKG C   SNCATVC TEGF GG C G+RRRCFCTK C
Sbjct  27   MLAEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGIRRRCFCTKHC  78



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            IMVAEAR CES S +FKG C  + NCA+VC+TEGF  G CKGLRRRCFC + C
Sbjct  28   IMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  80



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L   T MVAEAR CES S KFKG C  D NCA+VC TE F GG C+G RRRCFCT  C
Sbjct  17   LLVATEMVAEARTCESKSQKFKGACVSDRNCASVCQTERFPGGHCRGFRRRCFCTTHC  74



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGF  G C+G RRRCFCT  C
Sbjct  23   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGF  G C+G RRRCFCT  C
Sbjct  46   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + EAR CES S KFKG C  ++NCA+VC TEGF+GGDC+GLRRRCFCT+ C
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + EAR CES S ++KGPC R +NCA VC TEGFSGG C+G RRRCFC K C
Sbjct  23   LTEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCRGFRRRCFCAKHC  73



>ref|XP_010653029.1| PREDICTED: defensin-like protein 1 isoform X2 [Vitis vinifera]
Length=74

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  135  GTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             +  ++ +EAR+CES S KF+G C  D NCA VC  EGFSGG CKGLRRRCFCTK C
Sbjct  18   ASQMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  74



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +++G  ++   EAR CES S KFKG C R SNCA VC TEGF GG C+GLRRRCFCTK C
Sbjct  21   SDMGMTSV---EARKCESASHKFKGLCFRASNCANVCKTEGFHGGHCRGLRRRCFCTKHC  77



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AEAR CES S +F G C R SNCA+VC TEGF GG+C+GLRRRCFCT+ C
Sbjct  26   AEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRGLRRRCFCTRNC  75



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ++  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  3    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L T      EAR CES S  FKG C  D+NC +VCHTEGF+GG+C+GLR+RCFCT+ C
Sbjct  19   LATGPTTRVEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGLRQRCFCTRNC  76



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +V EAR CES S KFKG C  D+NCA VCH+E FSGG C+G RRRCFCT  C
Sbjct  27   LVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRCFCTTHC  78



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            VA+AR C+S S +FKG C R+SNCA +C TEGF GG+C+G RRRCFCTK C
Sbjct  26   VADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTKHC  76



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + +  AR CES S +FKGPC+RD+NCA VC TEGF+GG CKGLR RCFCT+ C
Sbjct  26   VTMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  25   VTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +E+GT    V EAR CES S +FKG C R SNCA VC TEGF GG C+GLR RCFCTK C
Sbjct  21   SEMGTK---VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  77



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L +  ++  E R CES S +FKG C  D NCA+VCH EGF+GG+C+G RRRCFCT+ C
Sbjct  88   LASQMMVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRGFRRRCFCTRHC  145



>gb|AHA50468.1| defensin-like protein 2 [Citrullus lanatus]
Length=78

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AE R+C+S S  F GPC RD NCA VC TEGFSGGDC G RRRCFCT+ C
Sbjct  29   AEGRVCKSQSHSFHGPCMRDHNCAVVCRTEGFSGGDCVGFRRRCFCTRLC  78



>ref|XP_002272913.2| PREDICTED: defensin-like protein 1 isoform X1 [Vitis vinifera]
 emb|CBI27688.3| unnamed protein product [Vitis vinifera]
Length=75

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  TNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
               ++ +EAR+CES S KF+G C  D NCA VC  EGFSGG CKGLRRRCFCTK C
Sbjct  20   QEMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  75



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            M+AE R CES S KFKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27   MLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            E+GT    V EAR CES S +FKG C R SNCA VC TEGF GG C+GLR RCFCTK C
Sbjct  23   EMGTK---VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  78



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            M+AE R CES S KFKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27   MLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + VAEAR CES S KFKG C R SNCA+VC +EGF+GG C+G+ RRC+CT  C
Sbjct  12   TEMG---LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MV EAR C S S +FKG C  D+NCA+VC TEGF GGDCKGLRRRCFC   C
Sbjct  21   MVGEARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCKGLRRRCFCETHC  72



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L  +T MVAEAR CES S +FKG C R +NCA VC TEGF  G C+G R RCFCTK C
Sbjct  17   LVFSTGMVAEARKCESQSHRFKGICLRKANCAAVCQTEGFHSGHCRGFRGRCFCTKHC  74



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G  T   AEAR CES S +F G C R+SNCA+VC TEGF GG+C+  RRRCFCT+ C
Sbjct  21   TEMGPMT--SAEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRRRCFCTRNC  78



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  27   VEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  TNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  +MV  EAR+C S S  FKGPC R  NCA VC TEGF GG+CKG RRRCFC KPC
Sbjct  18   SQEMMVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             +  AE R CES S KFKGPC  DSNC +VC  EGF GGDC+G+R RCFCT+ C
Sbjct  21   AVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCRGVRHRCFCTRNC  74



>gb|KEH35658.1| low-molecular-weight cysteine-rich protein [Medicago truncatula]
Length=52

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            M AEARMCES S  FKG C  D NCA VC  EGFSGG C+GLR RCFCT+ C
Sbjct  1    MHAEARMCESQSHGFKGACVGDHNCALVCRNEGFSGGRCQGLRHRCFCTRLC  52



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            M+AE R CE+ S KFKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27   MLAEGRTCEAHSRKFKGTCLGKSNCASVCQTEGFHGGHCRGFRRRCFCTKHC  78



>dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri]
Length=71

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            A   +C SPS KFKGPC  DSNC +VC  EGF+GG+C+G RRRCFC+KPC
Sbjct  22   ANGSLCRSPSQKFKGPCFSDSNCQSVCEGEGFTGGECEGFRRRCFCSKPC  71



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L +  ++  E R CES S +FKG C  D NCA+VCH EGF GG+C+G RRRCFC K C
Sbjct  16   LASQMMVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRGFRRRCFCKKRC  73



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            VAEAR CE+ S +FKG C R +NCA VC  EGF GG C+G RRRCFCTK C
Sbjct  28   VAEARTCETRSHRFKGICGRKANCAAVCQAEGFQGGHCRGFRRRCFCTKHC  78



>gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus]
Length=73

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  TNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  ++  EAR+CES S  FKG C  D NCA VC  EGFSGG+C+G RRRCFCTK C
Sbjct  18   SQVVVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
 emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris]
 gb|ESW09810.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
Length=73

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  TNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  ++  EAR+CES S  FKG C  D NCA VC  EGFSGG+C+G RRRCFCTK C
Sbjct  18   SQVVVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ++AE R CES S KFKG C   +NCA+VC TEGF GG+C+G RRRCFCTK C
Sbjct  27   LLAEGRTCESQSRKFKGTCLSKTNCASVCQTEGFPGGNCRGFRRRCFCTKHC  78



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C   SNCA VCH EGF GG+C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC  77



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + +MVAEAR CES S +F+GPC R SNC  VC TEGF  G C+G RRRCFC   C
Sbjct  25   DQMMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L +  ++  E R CES S +FKG C    NCA+VCH EGF+GG C+G RRRCFCT+ C
Sbjct  16   LSSQMVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGFRRRCFCTRHC  73



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MV EAR CESPS +FKG C   +NC  VC TEGF GG C+G RRRCFCTK C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MV EAR CESPS +FKG C   +NC  VC TEGF GG C+G RRRCFCTK C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AE R+CES S KFKGPC  D NCA VC  EGFSGG C+G R RCFCTK C
Sbjct  92   AEGRVCESKSHKFKGPCLGDHNCALVCRNEGFSGGRCRGFRHRCFCTKLC  141



>ref|XP_011462172.1| PREDICTED: uncharacterized protein LOC105350880 [Fragaria vesca 
subsp. vesca]
Length=136

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  TNTIMVAE-ARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TN ++ A+ AR CES S  F G C  +SNCA+VC TEGF+GGDC+GLRRRCFCTK C
Sbjct  80   TNAMVAADDARKCESLSHNFNGLCLSESNCASVCATEGFTGGDCRGLRRRCFCTKQC  136



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S KF+GPC    NCA VCH EGF GG C+G RRRC+CT+ C
Sbjct  26   VTVEARTCESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  ++NC  VCH EGF GG+C+GLRRRCFCT+ C
Sbjct  26   VTVEARTCESKSHRFKGACLSETNCKNVCHNEGFRGGNCRGLRRRCFCTRNC  77



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + VAEAR C S S KF+GPC R +NCA VC TEGF  G C+GLRRRCFCT  C
Sbjct  21   TEVG-GPVGVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRGLRRRCFCTTHC  79



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKGPC    NCA VCH EGF GG C+G RRRC+CT+ C
Sbjct  26   VTVEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC  77



>emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera]
Length=74

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             ++ +EAR+CES S KF+G C  D NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  21   MVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGXRRRCFCTKLC  74



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKGPC    NCA VCH EGF GG C+G RRRC+CT+ C
Sbjct  26   VTVEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC  77



>ref|XP_010675153.1| PREDICTED: defensin-like protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=72

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L  + +  AE R+C+S S  FKGPCARD NCA VC  EGFSGG C G  RRC+CT+ C
Sbjct  15   LFASQVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGGRCHGFFRRCYCTRLC  72



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  TNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            T  +MVA+AR CES S +FKG C   SNCA VC TEGF  G C+G RRRCFC+K C
Sbjct  1    TGPLMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  +SNC  VCH EGF GG+C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESKSHRFKGTCLSESNCKNVCHNEGFQGGNCRGFRRRCFCTRHC  77



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +F+GPC    NC  VCH EGFSGG C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCFCTRHC  77



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +F+GPC    NC  VCH EGFSGG C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCFCTRHC  77



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             I  AE R+C S S  ++GPC  D NCA VC  EGFSGGDC G RRRCFCTK C
Sbjct  21   AIQRAEGRVCISQSHGYRGPCVHDHNCALVCRNEGFSGGDCIGWRRRCFCTKLC  74



>ref|XP_004503015.1| PREDICTED: defensin-like protein 6-like isoform X2 [Cicer arietinum]
Length=74

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             +  AE R+C S S  FKGPC  D NCA VC  EGFSGG+C+G RRRCFCTK C
Sbjct  21   VMKTAEGRVCASQSHAFKGPCVGDHNCALVCRNEGFSGGNCQGFRRRCFCTKLC  74



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  ++NC  VCH EGFSGG+C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESQSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCFCTRYC  77



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  ++NC  VCH EGFSGG+C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESKSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCFCTRHC  77



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +M +EAR+CESPS  FKG C  D NCA VC TEGF+GG C+G R RCFCT  C
Sbjct  23   VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGARHRCFCTIIC  75



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR C S S +FKG C  D+NC  VCH EGF GGDC+G RRRCFCT+ C
Sbjct  26   VTVEARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRCFCTRNC  77



>gb|ADK91098.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2, partial [Arabidopsis halleri]
Length=55

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C   SNCA VCH EGF GG+C+G RRRCFCT+ C
Sbjct  4    VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AEAR+C S S  FKG C  + NCATVC TEGF+GG C+GLRRRCFC+K C
Sbjct  25   AEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLRRRCFCSKNC  74



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G     VAEAR CES S KFKG C R SNCA+VC +EGF+GG C+G+ RRC+CT  C
Sbjct  12   TEMGPK---VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            L T      EAR CES S  FKG C  D+NC +VC TEGF+GG+C+G RRRCFCT+ C
Sbjct  19   LATGPTTSVEARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGNCRGFRRRCFCTRNC  76



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +V EAR+CES S  FKG C   +NC  +C TEGF+GG C+G RRRCFCTKPC
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>ref|XP_004503014.1| PREDICTED: defensin-like protein 6-like isoform X1 [Cicer arietinum]
Length=75

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             +  AE R+C S S  FKGPC  D NCA VC  EGFSGG+C+G RRRCFCTK C
Sbjct  22   VMKTAEGRVCASQSHAFKGPCVGDHNCALVCRNEGFSGGNCQGFRRRCFCTKLC  75



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + VAEAR C+S S +F+GPC R  NCA VC TEGF  G C+G RRRCFC   C
Sbjct  21   TEIGA--VAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTHC  78



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  ++NC  VCH EGF+GG+C+G RRRCFCT+ C
Sbjct  26   VTVEARKCESKSHRFKGKCLSETNCKNVCHNEGFTGGNCRGFRRRCFCTRNC  77



>emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine 
max]
Length=75

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
              +  ++  E R+CES S  F G C RD NCA VC  EGFSGG CKG RRRCFCT+ C
Sbjct  18   FASQVVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC  75



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  ++NC  VCH EGF+GG+C+G RRRCFCT+ C
Sbjct  26   VTVEARTCESKSHRFKGKCFSETNCKNVCHNEGFTGGNCRGFRRRCFCTRHC  77



>gb|ADQ43196.1| unknown [Schrenkiella parvula]
Length=76

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C  D NC  VCH EGF GG C+G RRRCFCT+ C
Sbjct  25   VTVEARTCESQSHRFKGKCLSDGNCGNVCHNEGFGGGKCRGFRRRCFCTRNC  76



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VAEAR CE+ S +F+GPC R  NCA VC TEGF GG C+G R RCFCT  C
Sbjct  28   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  80



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VAEAR CE+ S +F+GPC R  NCA VC TEGF GG C+G R RCFCT  C
Sbjct  30   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  82



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  E R CES S+ F GPC  +SNCA VC+TEGF  GDC+G RRRC CT+PC
Sbjct  21   VTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGDCRGFRRRCMCTRPC  72



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR+C+S S KFKGPC  + NCA VCHTEGF  GDC GL RRC+C   C
Sbjct  11   VTVEARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRCYCNTHC  62



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  AEAR CES S +FKG C  D+ CA  C  EGFSGGDC+GLRRRCFC + C
Sbjct  24   VKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGLRRRCFCNRLC  76



>ref|XP_009631841.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=62

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EAR+C SPS  + GPC  D NCA VC  EGFSGGDC G++R+C+CTK C
Sbjct  13   VEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCYCTKLC  62



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EAR+C SPS  + GPC  D NCA VC  EGFSGGDC G++R+C+CTK C
Sbjct  27   VEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCYCTKLC  76



>gb|KHN09675.1| Defensin-like protein, partial [Glycine soja]
Length=59

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             ++  E R+CES S  F G C RD NCA VC  EGFSGG CKG RRRCFCT+ C
Sbjct  6    VVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC  59



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G      AEAR C+S S +FKG C R SNCA VC TEGF  G C+G  RRCFCTK C
Sbjct  21   TEMGPK---AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  77



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
              +  +  AE R+C+S S  FKGPCARD NCA VC  EGFSGG C G  RRC+CT+ C
Sbjct  16   FASPEVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGGRCHGFFRRCYCTRLC  73



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   + VA AR CES S KFKG C R SNCA+VC +EGF+GG C+G+ RRC+CT  C
Sbjct  12   TEMG---LKVAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MV +AR CESPS  FKG C   +NC  VC TEGF GG C+G RRRCFCTK C
Sbjct  22   MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|KJB30731.1| hypothetical protein B456_005G157500 [Gossypium raimondii]
Length=77

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            E+G  T+   E R CESPS KFKG C    NCATVC TEG+  G C+G RRRC C KPC
Sbjct  21   EMGPTTV---EGRKCESPSHKFKGMCMNRDNCATVCQTEGYEDGKCEGFRRRCICIKPC  76



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G      AEAR CES S KFKG C R SNCA+VC +EGF+GG C+G+ RRC+CT  C
Sbjct  12   TEMGPK---AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR  ES S KF+GPC    NCA VCH EGF GG C+G RRRC+CT+ C
Sbjct  26   VTVEARTSESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+    +   EAR C+S S  FKG C    NCA VC TEGF+GG C G RRRCFC+KPC
Sbjct  21   TEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTEGFTGGHCHGFRRRCFCSKPC  80



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S KF+G C    NCA VCH EGF GG C+G RRRC+CT+ C
Sbjct  26   VTVEARTCESKSHKFRGLCVSRHNCANVCHNEGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             AEAR C+S S +FKG C R SNCA VC TEGF  G C+G  RRCFCTK C
Sbjct  28   AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  78



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CE+ S  F GPC   +NCA VCH EGF  GDC+G RRRC C++PC
Sbjct  27   VTVEARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGFRRRCLCSRPC  78



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +V EAR+CES S  FKG C   +NC  +C TEGF+GG C+G RRRCFCTK C
Sbjct  23   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGHCRGFRRRCFCTKHC  74



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AE R CES S KFKG CA  +NCA VC TEGF GG C+G RRRCFCT  C
Sbjct  26   AEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGKCRGFRRRCFCTTHC  75



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C   +NC  VCH EGF GG C+G RRRC+CT+ C
Sbjct  25   VTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRCYCTRHC  76



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C   +NC  VCH EGF GG C+G RRRC+CT+ C
Sbjct  26   VTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRCYCTRHC  77



>gb|KJB11914.1| hypothetical protein B456_002G029700 [Gossypium raimondii]
Length=78

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   ++    ++CESPS+ FKG C RD NC  VC TEGF  GDCKG  R+C CTKPC
Sbjct  21   TEMGP--VVADGDKICESPSNAFKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC  78



>gb|KJB11913.1| hypothetical protein B456_002G029700 [Gossypium raimondii]
Length=78

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE+G   ++    ++CESPS+ FKG C RD NC  VC TEGF  GDCKG  R+C CTKPC
Sbjct  21   TEMGP--VVADGDKICESPSNAFKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC  78



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +V EAR+CES S  FKG C   +NC  +C TEGF+GG C+G RRRCFCTK C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKHC  73



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + +  ++  E R CES S++FKG C R SNCA+VC  EGF  G C+G+RRRC C KPC
Sbjct  20   IASEEMVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>gb|EYU27577.1| hypothetical protein MIMGU_mgv1a024490mg [Erythranthe guttata]
Length=71

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            A+ R CES S  F+GPC  D NC  VC +EGF+ GDC+G RRRCFC KPC
Sbjct  22   AKGRTCESQSFNFRGPCVIDHNCKAVCESEGFTDGDCQGFRRRCFCRKPC  71



>gb|EYU18232.1| hypothetical protein MIMGU_mgv1a015502mg [Erythranthe guttata]
Length=156

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  316  MMN*QGLVQKQRRRNPLQSPPENPSVWQTVAQLLSRAHGPLNFELGDSHILASATI  149
            +M+ Q LVQKQRRR P QSPPE PS+WQT  QL+S   GPL   L D H+LAS TI
Sbjct  82   VMDQQCLVQKQRRRKPWQSPPEKPSLWQTNLQLVSLTQGPLKRWLCDKHVLASPTI  137



>gb|AIA67013.1| defensin [Triticum aestivum]
Length=76

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + +A AR C+S S KFKG C RD NCA+VC  EGF+GG CKG   RC+CTK C
Sbjct  24   VQLALARDCQSKSFKFKGMCVRDDNCASVCLLEGFTGGKCKGFWHRCYCTKDC  76



>gb|ADK91116.1| PCP17C2, partial [Arabidopsis halleri]
Length=55

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR  ES S +FKG C   SNCA VCH EGF GG+C+G RRRCFCT+ C
Sbjct  4    VTVEARTRESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             A+AR CE+PS++FKG C   +NCA VC TEGFSGG C G RRRC CTK C
Sbjct  22   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             A+AR CE+PS++FKG C   +NCA VC TEGFSGG C G RRRC CTK C
Sbjct  61   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AE R C S S  FKG C  D+NCA VC TEGF+GGDC G RRRCFCT+ C
Sbjct  35   AEGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGDCGGFRRRCFCTRIC  84



>ref|XP_006384382.1| hypothetical protein POPTR_0004s14520g [Populus trichocarpa]
 gb|ERP62179.1| hypothetical protein POPTR_0004s14520g [Populus trichocarpa]
Length=74

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  TNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
               ++ AEAR+C S S  +KGPC R  NCA VC TEGF+GG+CKG   RCFC K C
Sbjct  19   QEMVVPAEARVCLSQSHHYKGPCLRGHNCAMVCKTEGFAGGECKGFISRCFCAKLC  74



>gb|ACV84385.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDC--KGLRRRCFCTK  299
            TE+GT T  +AEAR C S S  FKG C   SNCA VCHTE F GG+C  +   R+CFC +
Sbjct  21   TEMGTTTTKLAEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGECHTQHFERKCFCKR  80

Query  300  PC  305
            PC
Sbjct  81   PC  82



>ref|XP_009780051.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=74

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             E R+C S S  + G C  D NCA VC  EGFSGGDC G RRRCFCTK C
Sbjct  25   VEGRVCISQSHGYHGTCVHDHNCALVCRNEGFSGGDCIGWRRRCFCTKLC  74



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
              ++  E R CES S +F G C    NCA+VCH EGF+GG C+G R+RCFC K C
Sbjct  20   QMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGFRKRCFCKKRC  74



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            AE R C S S  FKG C  D+NCA VC TEGF+GGDC G RRRCFCT+ C
Sbjct  25   AEGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGDCGGFRRRCFCTRIC  74



>sp|P81571.1|DEFD2_SPIOL RecName: Full=Defensin D2; AltName: Full=Antimicrobial peptide 
D2; AltName: Full=So-D2, partial [Spinacia oleracea]
Length=52

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  +R C++PS  FKG C RDSNC T C  EG+  GDCKG+RRRC C+KPC
Sbjct  2    IFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC  52



>gb|EMS52277.1| Defensin Tk-AMP-D1.1 [Triticum urartu]
Length=77

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE    ++ VA AR CES S KF G C  D+NCA VC TEGF+ G C G++R C CTK C
Sbjct  18   TEEQGGSVQVALARDCESDSHKFHGACFSDTNCANVCQTEGFTAGKCVGVQRHCHCTKDC  77



>gb|AIA67009.1| defensin [Triticum aestivum]
Length=77

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            TE    ++ VA AR CES S KF G C  D+NCA VC TEGF+ G C G++R C CTK C
Sbjct  18   TEEQGGSVQVALARDCESDSHKFHGACFSDTNCAYVCQTEGFTAGKCVGVQRHCHCTKDC  77



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  EAR CES S +FKG C   +NC  VCH EGF GG C+G R RC+CT+ C
Sbjct  26   VTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRVRCYCTRHC  77



>gb|AAG38520.1|AF283535_1 proteinase inhibitor se60-like protein [Citrus x paradisi]
Length=73

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  TNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  IMV AE R+C+S S  F G C    NCA VC  EGFSGG C+G+RRRCFC+K C
Sbjct  17   SQEIMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC  73



>gb|AGC82207.1| defensin [Persea americana var. drymifolia]
Length=78

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  156  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             EA  CE+PS  F G C R SNCA+VCH E F+ G C+G+RRRC C KPC
Sbjct  29   VEAATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC  78



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
              +  I+  E RMC+S S  FK  C  D NCA +C  EGFSGG C+G  RRC+CT+ C
Sbjct  16   FSSQKIIGIEGRMCQSKSHHFKHMCWSDHNCAIICRNEGFSGGRCRGFHRRCYCTRLC  73



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VA AR C SPS KFKG C  D+NCA+VC TE F GG C G+R+RC CT+ C
Sbjct  24   VQVALARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +3

Query  129  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGFS G+C+G     FCT  C
Sbjct  23   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGECRGFPPPPFCTTHC  80



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKG--LRRRCFCTK  299
            TE+GT T+ VAEAR C S S  FKG C   SNCA VC TE F  G+C      R+CFC +
Sbjct  20   TEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTENFPDGECHAPHYERKCFCKR  79

Query  300  PC  305
            PC
Sbjct  80   PC  81



>gb|EMS49334.1| Defensin-like protein [Triticum urartu]
 gb|AIA66991.1| defensin [Triticum aestivum]
Length=82

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDC--KGLRRRCFCTK  299
            TE+GT T  VAEAR C S S KFKG C   SNCA VC TE F  G+C  + L R+CFC +
Sbjct  21   TEMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKR  80

Query  300  PC  305
            PC
Sbjct  81   PC  82



>gb|AAL14240.1| proteinase inhibitor [Musa acuminata AAA Group]
Length=49

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  159  EARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            E+R CES S++FKG C R SNCA+VC  EGF  G C+G+RRRC C KPC
Sbjct  1    ESRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  49



>ref|XP_007033370.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04296.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  144  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
             ++ ++AR+CES S  FKG C  D NC  VC  EGFSGG C+G R RCFCT+ C
Sbjct  23   MVVPSKARLCESKSHGFKGACLSDHNCGMVCSNEGFSGGRCRGFRHRCFCTRRC  76



>sp|P86518.1|DEF1_ECHCG RecName: Full=Defensin Ec-AMP-D1 [Echinochloa crus-galli]
Length=47

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  165  RMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            R C+S S ++KG C  D+NCA+VC TEGFSGG C G R RCFCTK C
Sbjct  1    RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKAC  47



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VAEAR CES S +F G C R  NCA VC TEGF GG C+G  RRCFCT  C
Sbjct  37   VAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  89



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +    ++  +ARMC++PS  F+G C  + NC   C  EGF  G CKGLRRRCFC++PC
Sbjct  13   VAEEMVVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRRRCFCSRPC  70



>gb|KJB11873.1| hypothetical protein B456_002G043900 [Gossypium raimondii]
 gb|KJB11875.1| hypothetical protein B456_002G044100 [Gossypium raimondii]
Length=75

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTE-GFSGGDCKGLRRRCFCTKP  302
            TE+G    M AEA+ CE  S KFKG C   +NCA+VC +E GF GG C+G RRRC CTKP
Sbjct  18   TEMGP---MSAEAKTCEVESGKFKGMCMSSTNCASVCKSEPGFDGGHCQGFRRRCLCTKP  74

Query  303  C  305
            C
Sbjct  75   C  75



>ref|XP_010228361.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=76

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VA AR C SPS KF G C RDSNCA +  TEGF  G C G+R RCFC K C
Sbjct  24   VQVALARECGSPSHKFHGMCTRDSNCANIWLTEGFKTGKCVGIRHRCFCYKNC  76



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VAEAR CES S +F G C R  NCA VC TEGF GG C+G  RRCFCT  C
Sbjct  28   VAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  80



>sp|P86519.1|DEF2_ECHCG RecName: Full=Defensin Ec-AMP-D2 [Echinochloa crus-galli]
Length=47

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  165  RMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            R C+S S ++KG C  D+NCA+VC TEGFSGG C G R RCFCTK C
Sbjct  1    RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKHC  47



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  147  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            + VAEAR CES S +F G C R  NCA VC TEGF  G C+G RRRCFCT  C
Sbjct  25   VAVAEARRCESLSHRFAGLCLRGHNCANVCRTEGFPDGKCRGARRRCFCTTHC  77



>ref|XP_007202934.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 ref|XP_007202943.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 ref|XP_007203068.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
 gb|EMJ04133.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 gb|EMJ04142.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 gb|EMJ04267.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
Length=85

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 8/60 (13%)
 Frame = +3

Query  150  MVAE--------ARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAE        +R CES S+KFKGPC R SNCA +C  EGF GG C G R RC CTK C
Sbjct  26   MVAEGKVETKETSRTCESLSTKFKGPCIRSSNCANICEEEGFKGGKCVGFRLRCTCTKNC  85



>ref|XP_007202863.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
 gb|EMJ04062.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
Length=85

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 8/60 (13%)
 Frame = +3

Query  150  MVAE--------ARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAE        +R CES S+KFKGPC R SNCA +C  EGF GG C G R RC CTK C
Sbjct  26   MVAEGKVETKETSRTCESLSTKFKGPCIRSSNCANICEEEGFKGGKCVGFRLRCTCTKNC  85



>ref|XP_007226225.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
 gb|EMJ27424.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
Length=87

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  165  RMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            R CES S KFKG C   SNCAT C TEGF+GG C+G RRRCFC+K C
Sbjct  41   RTCESQSQKFKGICFLSSNCATSCTTEGFNGGQCRGFRRRCFCSKAC  87



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 39/62 (63%), Gaps = 4/62 (6%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLR--RRCFCTK  299
            TE+G N  MVAEAR C S S  +KG C  D NCA VC TEGF  G C+G     RCFC K
Sbjct  21   TEMGAN--MVAEARSCISKSFTYKGLCVHDRNCANVCRTEGFVEGHCRGFAFGSRCFCYK  78

Query  300  PC  305
            PC
Sbjct  79   PC  80



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDC--KGLRRRCFCTK  299
            TE+G  T  VAEAR C S S KFKG C   SNCA VC TE F  G+C  + L R+CFC K
Sbjct  21   TEMGATTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRTENFPDGECHRQHLERKCFCKK  80

Query  300  PC  305
            PC
Sbjct  81   PC  82



>sp|P83399.1|DEF1_VIGUN RecName: Full=Defensin-like protein 1; AltName: Full=Cp-thionin 
I; AltName: Full=Cp-thionin-1; AltName: Full=Gamma-thionin 
I [Vigna unguiculata]
Length=47

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  165  RMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            R+CES S  FKG C  D NCA VC  EGFSGG+C+G RRRCFCT  C
Sbjct  1    RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTLKC  47



>ref|XP_006466198.1| PREDICTED: defensin-like protein 6-like [Citrus sinensis]
Length=73

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  TNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  +MV AE R+C+S S  F G C    NCA VC  EGFSGG C+G+RRRCFC+K C
Sbjct  17   SQEMMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC  73



>gb|ACB20518.1| defensin precursor [Saccharum officinarum]
Length=80

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCK--GLRRRCFCTK  299
            TELGT T  VAEAR C S S +FKG C   SNCA VC TE F GG+CK  G  R+CFC K
Sbjct  21   TELGTTT--VAEARYCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKADGATRKCFCKK  78

Query  300  PC  305
             C
Sbjct  79   IC  80



>ref|XP_007203287.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
 gb|EMJ04486.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
Length=85

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 8/60 (13%)
 Frame = +3

Query  150  MVAE--------ARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            MVAE        +R CES S+KFKGPC R SNCA +C  EGF GG C G R RC CTK C
Sbjct  26   MVAEGKVETKETSRTCESLSTKFKGPCFRSSNCANICEKEGFKGGKCVGFRLRCTCTKNC  85



>gb|KJB12908.1| hypothetical protein B456_002G043800 [Gossypium raimondii]
Length=107

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  150  MVAEARMCESPSSKFKGPCARDSNCATVCHTE-GFSGGDCKGLRRRCFCTKPC  305
            M AEA+ CE+ S KFKG C   +NCA+VC +E GF GG C+G RR+C CTKPC
Sbjct  55   MSAEAKTCETQSGKFKGMCMSSTNCASVCKSEPGFDGGHCQGFRRQCVCTKPC  107



>gb|AIA67004.1| defensin [Triticum aestivum]
Length=84

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCK--GLRRRCFCTK  299
            TE+GT  +  A  R CES S +++G C RD NC  VC+TEGF  G CK  G   +C CTK
Sbjct  22   TEMGTTRVAEARHRHCESQSHRYRGACWRDDNCKHVCNTEGFPSGKCKFHGFESKCVCTK  81

Query  300  PC  305
            PC
Sbjct  82   PC  83



>gb|AIA66990.1| defensin [Triticum aestivum]
Length=82

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDC--KGLRRRCFCTK  299
            TE+GT T  +AEAR C S S  FKG C   SNCA VCHTE F GG+C  +   R+CFC +
Sbjct  21   TEMGTTTTKLAEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGECHTQHFERKCFCKR  80

Query  300  PC  305
             C
Sbjct  81   VC  82



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            V E R+CES S +FKG C  D NC  VC  EGF  G C+G R RCFCT+ C
Sbjct  25   VVEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDGWCRGFRHRCFCTRNC  75



>ref|XP_009389205.1| PREDICTED: defensin Tk-AMP-D2-like [Musa acuminata subsp. malaccensis]
Length=79

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKG--LRRRCFCTK  299
            +E+GT    V   R CES S KF GPC R +NC  VC TEGF GG C+G  + R+C+CTK
Sbjct  21   SEMGTT---VVNGRTCESQSHKFVGPCVRKANCGNVCQTEGFHGGVCRGSLIHRKCYCTK  77

Query  300  PC  305
             C
Sbjct  78   NC  79



>ref|XP_006426419.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
 gb|ESR39659.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
Length=72

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  TNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  ++ AE R+C+S S  F G C    NCA VC  EGFSGG C+G RRRCFC+K C
Sbjct  17   SQMMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC  72



>gb|ACV84382.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCK--GLRRRCFCTK  299
            TE+GT T+  AEAR C S S KFKG C   SNCA++C TE F GG+CK     R+CFC +
Sbjct  21   TEMGTPTMKAAEARDCLSQSHKFKGSCLSSSNCASICRTENFPGGECKLESFARKCFCKR  80

Query  300  PC  305
             C
Sbjct  81   VC  82



>ref|XP_006426420.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
 gb|ESR39660.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
Length=73

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  TNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            +  +MV AE R+C+S S  F G C    NCA VC  EGFSGG C+G RRRCFC+K C
Sbjct  17   SQEMMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC  73



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDC--KGLRRRCFCTK  299
            TE+G  T+ +AEAR C S S KFKG C   SNCA VC TE F  G+C      R+CFC +
Sbjct  21   TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  80

Query  300  PC  305
            PC
Sbjct  81   PC  82



>gb|ABX84378.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66996.1| defensin [Triticum aestivum]
Length=82

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCK--GLRRRCFCTK  299
            TE+GT T  VAEAR C S S KFKG C   SNCA++C TE F GG+CK     R+CFC +
Sbjct  21   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  80

Query  300  PC  305
             C
Sbjct  81   VC  82



>gb|ABX84377.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66997.1| defensin [Triticum aestivum]
Length=82

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  126  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCK--GLRRRCFCTK  299
            TE+GT T  VAEAR C S S KFKG C   SNCA++C TE F GG+CK     R+CFC +
Sbjct  21   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  80

Query  300  PC  305
             C
Sbjct  81   VC  82



>gb|AIA67015.1| defensin [Triticum aestivum]
Length=78

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  159  EARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  305
            E R+CE+ S++FKG C   +NCA +C TEGF+ G C GL+R+C CTKPC
Sbjct  30   EGRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125