BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF015B03

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   6e-71   Nicotiana tomentosiformis
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    234   8e-69   Solanum tuberosum [potatoes]
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    225   1e-68   Nicotiana tabacum [American tobacco]
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    231   1e-67   Nicotiana sylvestris
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    231   1e-67   
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  216   7e-67   Citrus sinensis [apfelsine]
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    228   2e-66   Nicotiana sylvestris
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    228   3e-66   Nicotiana tomentosiformis
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    226   1e-65   Sesamum indicum [beniseed]
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     221   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_002298197.2|  beta-glucosidase family protein                    220   2e-63   
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    219   5e-63   Citrus sinensis [apfelsine]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             219   5e-63   Citrus clementina [clementine]
ref|XP_002303181.1|  beta-glucosidase family protein                    218   6e-63   
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    218   1e-62   Populus euphratica
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    217   1e-62   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    217   2e-62   Populus euphratica
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    217   2e-62   Medicago sativa subsp. x varia
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      217   2e-62   Solanum lycopersicum
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   3e-62   
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   3e-62   
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   4e-62   Solanum tuberosum [potatoes]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    216   4e-62   Medicago truncatula
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   4e-62   
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    216   6e-62   Cicer arietinum [garbanzo]
ref|XP_002513707.1|  Beta-glucosidase, putative                         216   6e-62   Ricinus communis
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         215   8e-62   Jatropha curcas
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              214   1e-61   Populus tremula x Populus alba [gray poplar]
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    215   1e-61   Eucalyptus grandis [rose gum]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    214   2e-61   
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                214   3e-61   Brassica rapa
emb|CDY18705.1|  BnaA09g06900D                                          214   3e-61   Brassica napus [oilseed rape]
gb|EPS65933.1|  hypothetical protein M569_08842                         213   4e-61   Genlisea aurea
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    213   5e-61   Vitis vinifera
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    213   5e-61   Eucalyptus grandis [rose gum]
ref|XP_007043027.1|  Beta-D-xylosidase 4                                213   5e-61   
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             213   6e-61   Phaseolus vulgaris [French bean]
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              212   6e-61   Populus tremula x Populus alba [gray poplar]
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    212   1e-60   Vitis vinifera
emb|CBI40687.3|  unnamed protein product                                212   1e-60   Vitis vinifera
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    212   1e-60   Arabis alpina [alpine rockcress]
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           212   2e-60   Gossypium arboreum [tree cotton]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    211   2e-60   Gossypium raimondii
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             211   2e-60   Capsella rubella
emb|CDY46812.1|  BnaC02g43200D                                          211   2e-60   Brassica napus [oilseed rape]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    211   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    211   3e-60   
emb|CDX81229.1|  BnaC09g06400D                                          211   3e-60   
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                211   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             211   4e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    210   5e-60   Eucalyptus grandis [rose gum]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    210   6e-60   Glycine max [soybeans]
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             210   6e-60   Prunus persica
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      210   8e-60   Morus notabilis
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                210   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    209   1e-59   Glycine max [soybeans]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    209   1e-59   
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                209   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             209   2e-59   Phaseolus vulgaris [French bean]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                209   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002866623.1|  beta-xylosidase 4                                  209   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                209   2e-59   Brassica rapa
ref|NP_201262.1|  beta-D-xylosidase 4                                   208   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31313.1|  BnaA02g34280D                                          208   3e-59   Brassica napus [oilseed rape]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     208   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    207   9e-59   Prunus mume [ume]
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    206   1e-58   Fragaria vesca subsp. vesca
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    206   2e-58   Elaeis guineensis
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    206   2e-58   Sesamum indicum [beniseed]
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    206   2e-58   Eucalyptus grandis [rose gum]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    205   5e-58   Fragaria vesca subsp. vesca
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    204   6e-58   
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    204   1e-57   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    204   1e-57   
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    203   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     203   2e-57   Brassica rapa
emb|CDY51290.1|  BnaA06g23560D                                          203   2e-57   Brassica napus [oilseed rape]
emb|CDY56487.1|  BnaCnng30450D                                          203   3e-57   Brassica napus [oilseed rape]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            202   4e-57   Raphanus sativus
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    202   5e-57   Sesamum indicum [beniseed]
emb|CDY52884.1|  BnaC06g27770D                                          193   5e-57   Brassica napus [oilseed rape]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    200   2e-56   Cicer arietinum [garbanzo]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          200   3e-56   Amborella trichopoda
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        199   7e-56   Medicago truncatula
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    198   9e-56   Arabis alpina [alpine rockcress]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                198   1e-55   Camelina sativa [gold-of-pleasure]
ref|NP_196535.1|  beta-xylosidase 3                                     198   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             198   1e-55   Eutrema salsugineum [saltwater cress]
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           189   2e-55   Glycine soja [wild soybean]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    197   2e-55   Gossypium raimondii
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    197   3e-55   Beta vulgaris subsp. vulgaris [field beet]
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    197   3e-55   Medicago sativa subsp. x varia
ref|XP_002873418.1|  beta-xylosidase 3                                  197   4e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    197   4e-55   Fragaria vesca subsp. vesca
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           196   6e-55   Gossypium arboreum [tree cotton]
dbj|BAJ89945.1|  predicted protein                                      193   6e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    196   7e-55   Eucalyptus grandis [rose gum]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    195   2e-54   Glycine max [soybeans]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                194   2e-54   Erythranthe guttata [common monkey flower]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                194   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          194   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          194   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    192   4e-54   
dbj|BAJ90420.1|  predicted protein                                      193   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      193   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     193   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     193   7e-54   Camelina sativa [gold-of-pleasure]
emb|CDY21595.1|  BnaC09g46970D                                          194   9e-54   Brassica napus [oilseed rape]
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                192   1e-53   Camelina sativa [gold-of-pleasure]
gb|EMT32951.1|  Beta-D-xylosidase 4                                     194   1e-53   
emb|CDY01780.1|  BnaC06g28200D                                          192   2e-53   
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                191   3e-53   Brassica rapa
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    191   3e-53   Hordeum vulgare [barley]
emb|CDX97115.1|  BnaC09g45100D                                          191   3e-53   
emb|CDX96113.1|  BnaA07g26180D                                          192   5e-53   
emb|CDY35825.1|  BnaC09g37570D                                          191   5e-53   Brassica napus [oilseed rape]
emb|CDX69892.1|  BnaA10g22410D                                          190   6e-53   
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                189   2e-52   Brassica rapa
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                189   3e-52   
ref|NP_001054038.1|  Os04g0640700                                       188   4e-52   
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          187   6e-52   Sorghum bicolor [broomcorn]
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       184   6e-52   
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     187   9e-52   
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     186   2e-51   Setaria italica
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                186   3e-51   Erythranthe guttata [common monkey flower]
gb|EYU44008.1|  hypothetical protein MIMGU_mgv1a0207571mg               174   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                184   2e-50   
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    184   2e-50   
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              183   2e-50   Selaginella moellendorffii
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             183   2e-50   Selaginella moellendorffii
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                       173   4e-50   Gossypium arboreum [tree cotton]
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          182   4e-50   Amborella trichopoda
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                181   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like                171   2e-49   
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         179   8e-49   Jatropha curcas
ref|XP_002515300.1|  Beta-glucosidase, putative                         179   8e-49   Ricinus communis
ref|XP_002885319.1|  beta-1,4-xylosidase                                178   2e-48   
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       170   3e-48   Morus notabilis
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          176   3e-48   Nicotiana sylvestris
ref|XP_004170761.1|  PREDICTED: beta-D-xylosidase 1-like                168   4e-48   
ref|XP_003625957.1|  Beta-xylosidase                                    177   5e-48   Medicago truncatula
gb|KJB38536.1|  hypothetical protein B456_006G259500                    176   5e-48   Gossypium raimondii
gb|KJB77632.1|  hypothetical protein B456_012G147500                    177   5e-48   Gossypium raimondii
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         176   5e-48   Jatropha curcas
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          176   7e-48   Nicotiana sylvestris
emb|CAN77623.1|  hypothetical protein VITISV_007589                     165   8e-48   Vitis vinifera
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             176   1e-47   Selaginella moellendorffii
emb|CDP18762.1|  unnamed protein product                                173   1e-47   Coffea canephora [robusta coffee]
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             176   1e-47   Selaginella moellendorffii
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             175   2e-47   
gb|KJB38535.1|  hypothetical protein B456_006G259500                    175   2e-47   Gossypium raimondii
ref|NP_188596.1|  putative beta-D-xylosidase 5                          175   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            174   3e-47   Populus euphratica
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              174   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            174   3e-47   Populus euphratica
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       174   3e-47   Gossypium arboreum [tree cotton]
dbj|BAB02547.1|  beta-1,4-xylosidase                                    175   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003615012.1|  Auxin-induced beta-glucosidase                     164   4e-47   
ref|XP_003592512.1|  Xylosidase                                         174   4e-47   Medicago truncatula
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     174   5e-47   Sesamum indicum [beniseed]
emb|CDY67410.1|  BnaCnng54810D                                          172   5e-47   Brassica napus [oilseed rape]
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  174   5e-47   
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            172   5e-47   Glycine soja [wild soybean]
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                  165   6e-47   Citrus sinensis [apfelsine]
gb|ACD93208.1|  beta xylosidase                                         174   6e-47   Camellia sinensis [black tea]
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          174   7e-47   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             173   8e-47   
gb|KJB72795.1|  hypothetical protein B456_011G198200                    173   8e-47   Gossypium raimondii
ref|XP_002527511.1|  Beta-glucosidase, putative                         173   1e-46   Ricinus communis
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    173   1e-46   Ricinus communis
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            173   1e-46   
emb|CDY58860.1|  BnaCnng33860D                                          173   1e-46   Brassica napus [oilseed rape]
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            173   1e-46   Cucumis melo [Oriental melon]
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            173   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            173   1e-46   
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             172   1e-46   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             172   1e-46   
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       172   1e-46   Glycine max [soybeans]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              172   1e-46   Fragaria vesca subsp. vesca
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              172   2e-46   Prunus mume [ume]
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             172   2e-46   Prunus persica
gb|AAS17751.2|  beta xylosidase                                         172   2e-46   Fragaria x ananassa
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            172   2e-46   Brassica rapa
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            172   2e-46   Vitis vinifera
emb|CDP17081.1|  unnamed protein product                                171   3e-46   Coffea canephora [robusta coffee]
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            172   3e-46   
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            171   3e-46   Glycine soja [wild soybean]
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             171   3e-46   Phaseolus vulgaris [French bean]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            171   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            172   4e-46   Nicotiana sylvestris
dbj|BAF00595.1|  xylosidase                                             165   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            171   4e-46   Glycine max [soybeans]
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              171   4e-46   Gossypium arboreum [tree cotton]
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             171   4e-46   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         171   5e-46   Jatropha curcas
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            171   5e-46   Pyrus x bretschneideri [bai li]
gb|KJB09457.1|  hypothetical protein B456_001G143600                    171   5e-46   Gossypium raimondii
emb|CDY00033.1|  BnaC09g02680D                                          171   5e-46   
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            171   5e-46   Elaeis guineensis
emb|CBI22460.3|  unnamed protein product                                172   5e-46   Vitis vinifera
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                171   5e-46   Brassica rapa
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            171   6e-46   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN82161.1|  hypothetical protein VITISV_035506                     172   6e-46   Vitis vinifera
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            171   6e-46   Populus euphratica
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              171   7e-46   Vitis vinifera
emb|CBI22910.3|  unnamed protein product                                171   7e-46   Vitis vinifera
emb|CDY15255.1|  BnaC05g01340D                                          171   7e-46   Brassica napus [oilseed rape]
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       171   7e-46   Morus notabilis
dbj|BAG28345.1|  arabinofuranosidase                                    171   8e-46   Citrus unshiu [satsuma mandarin]
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                171   8e-46   Phoenix dactylifera
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            171   8e-46   Nicotiana sylvestris
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             170   9e-46   Phaseolus vulgaris [French bean]
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             170   9e-46   
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           170   9e-46   Prunus salicina [Japanese plum]
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            170   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    170   1e-45   Cucumis melo [Oriental melon]
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       170   1e-45   
ref|XP_010094323.1|  Beta-D-xylosidase 1                                170   1e-45   Morus notabilis
emb|CDX89954.1|  BnaA10g01280D                                          170   1e-45   
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            170   1e-45   Prunus mume [ume]
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    170   1e-45   Cucumis melo [Oriental melon]
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            170   1e-45   Brassica rapa
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            169   1e-45   Glycine soja [wild soybean]
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              170   1e-45   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              170   2e-45   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              170   2e-45   
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            169   2e-45   Nicotiana tomentosiformis
ref|XP_003591420.1|  Beta xylosidase                                    169   2e-45   Medicago truncatula
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    170   2e-45   
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       169   2e-45   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             169   2e-45   Prunus persica
ref|XP_002311398.2|  beta-D-xylosidase family protein                   169   2e-45   
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            169   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            169   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       169   3e-45   Glycine max [soybeans]
ref|XP_002316021.1|  beta-D-xylosidase family protein                   169   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    169   4e-45   Vitis vinifera
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       169   4e-45   Cicer arietinum [garbanzo]
emb|CDY49607.1|  BnaA09g03310D                                          169   4e-45   Brassica napus [oilseed rape]
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            169   5e-45   Prunus mume [ume]
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                168   5e-45   Cucumis sativus [cucumbers]
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    168   5e-45   
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            168   6e-45   Fragaria vesca subsp. vesca
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              168   6e-45   
emb|CDY33913.1|  BnaA02g30740D                                          168   6e-45   Brassica napus [oilseed rape]
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       168   6e-45   Glycine max [soybeans]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             168   6e-45   Capsella rubella
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             168   7e-45   
emb|CDY05634.1|  BnaC02g39030D                                          168   7e-45   
ref|XP_007051080.1|  Beta-xylosidase 2                                  168   7e-45   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            167   9e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             167   9e-45   Prunus persica
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           167   9e-45   Prunus salicina [Japanese plum]
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       167   9e-45   Solanum lycopersicum
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    167   9e-45   Arabis alpina [alpine rockcress]
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            167   1e-44   Sesamum indicum [beniseed]
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     167   1e-44   Tarenaya hassleriana [spider flower]
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    167   1e-44   Arabis alpina [alpine rockcress]
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                167   1e-44   Cicer arietinum [garbanzo]
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              167   1e-44   Populus euphratica
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       167   1e-44   Cucumis sativus [cucumbers]
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            167   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_003594795.1|  Beta xylosidase                                    167   1e-44   Medicago truncatula
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730          167   1e-44   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                167   2e-44   Glycine max [soybeans]
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    167   2e-44   
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             167   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                167   2e-44   Brassica rapa
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         167   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       167   2e-44   Cucumis sativus [cucumbers]
gb|AAP83934.1|  auxin-induced beta-glucosidase                          167   2e-44   Oxybasis rubra [pigweed]
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          167   2e-44   Persea americana
ref|NP_563659.1|  probable beta-D-xylosidase 2                          167   2e-44   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO45878.1|  beta-D-xylosidase                                      166   2e-44   Acacia mangium
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            167   2e-44   Prunus mume [ume]
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              166   2e-44   Populus euphratica
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    166   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                166   3e-44   
emb|CAN72807.1|  hypothetical protein VITISV_033721                     158   3e-44   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    166   3e-44   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     166   3e-44   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                167   3e-44   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       166   3e-44   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             166   3e-44   
gb|EPS60429.1|  hypothetical protein M569_14372                         166   4e-44   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    166   4e-44   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            167   4e-44   
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             166   4e-44   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            166   4e-44   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            166   5e-44   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             166   5e-44   
ref|XP_002865732.1|  beta-xylosidase 1                                  166   5e-44   
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             166   5e-44   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          166   5e-44   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                165   6e-44   
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     165   6e-44   
emb|CDX85405.1|  BnaC07g27160D                                          165   6e-44   
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       165   6e-44   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     165   6e-44   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            165   6e-44   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             165   7e-44   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              165   7e-44   
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        165   7e-44   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               165   7e-44   
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                165   7e-44   
gb|AES97966.2|  glycoside hydrolase family 3 protein                    165   8e-44   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         165   8e-44   
dbj|BAF79669.1|  beta-D-xylosidase                                      165   8e-44   
gb|KHN12900.1|  Beta-D-xylosidase 1                                     165   8e-44   
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            165   9e-44   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             165   9e-44   
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          165   1e-43   
gb|KJB49844.1|  hypothetical protein B456_008G140600                    165   1e-43   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     164   1e-43   
emb|CDO98788.1|  unnamed protein product                                164   1e-43   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     164   1e-43   
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                164   2e-43   
gb|KJB16241.1|  hypothetical protein B456_002G219100                    164   2e-43   
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       164   2e-43   
gb|KJB59941.1|  hypothetical protein B456_009G282000                    163   2e-43   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       164   2e-43   
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              164   2e-43   
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             164   2e-43   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       164   2e-43   
ref|NP_196618.1|  putative beta-D-xylosidase 6                          164   2e-43   
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    164   2e-43   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   164   2e-43   
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            164   3e-43   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             164   3e-43   
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7            160   3e-43   
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    162   3e-43   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            163   4e-43   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             163   4e-43   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       163   4e-43   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            163   5e-43   
gb|KJB59940.1|  hypothetical protein B456_009G282000                    162   6e-43   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            162   6e-43   
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              162   6e-43   
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       162   7e-43   
ref|XP_006840294.1|  hypothetical protein AMTR_s00045p00064060          162   8e-43   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            162   1e-42   
gb|KCW63061.1|  hypothetical protein EUGRSUZ_G006532                    151   1e-42   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            162   1e-42   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    162   1e-42   
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    162   1e-42   
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            162   1e-42   
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            162   1e-42   
emb|CDX97026.1|  BnaC09g45990D                                          161   1e-42   
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             162   1e-42   
emb|CBI19138.3|  unnamed protein product                                164   1e-42   
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  161   2e-42   
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            161   2e-42   
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             161   2e-42   
emb|CDO97479.1|  unnamed protein product                                160   2e-42   
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             161   3e-42   
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         161   3e-42   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                160   3e-42   
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            161   3e-42   
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   3e-42   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5            160   3e-42   
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            160   3e-42   
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            160   3e-42   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             161   4e-42   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   160   4e-42   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   160   4e-42   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       160   4e-42   
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     159   5e-42   
gb|KJB44020.1|  hypothetical protein B456_007G230000                    160   5e-42   
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             160   6e-42   
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                160   6e-42   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            160   6e-42   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    160   6e-42   
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          160   6e-42   
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        162   6e-42   
ref|XP_001775759.1|  predicted protein                                  160   6e-42   
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        162   7e-42   
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        162   7e-42   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                160   7e-42   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    160   7e-42   
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            160   8e-42   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       159   8e-42   
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   158   8e-42   
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                160   1e-41   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          159   1e-41   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            159   1e-41   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            159   1e-41   
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            159   2e-41   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            159   2e-41   
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            159   2e-41   
ref|XP_011466576.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    157   2e-41   
emb|CDX69822.1|  BnaA10g21710D                                          158   2e-41   
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   158   3e-41   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             158   3e-41   
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       158   3e-41   
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             158   3e-41   
emb|CBI25987.3|  unnamed protein product                                157   3e-41   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          158   3e-41   
dbj|BAK01582.1|  predicted protein                                      157   3e-41   
ref|XP_007214466.1|  hypothetical protein PRUPE_ppa023763mg             157   4e-41   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       158   4e-41   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    158   4e-41   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                157   4e-41   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            157   4e-41   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             157   4e-41   
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    158   4e-41   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             157   4e-41   
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                157   5e-41   
gb|AAF17692.1|AC009243_19  F28K19.27                                    157   5e-41   
emb|CBI25718.3|  unnamed protein product                                157   6e-41   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            157   7e-41   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            157   8e-41   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...    157   8e-41   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            157   8e-41   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            157   8e-41   
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    157   9e-41   
ref|NP_177929.1|  putative beta-D-xylosidase 7                          156   9e-41   
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg                155   1e-40   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            157   1e-40   
ref|XP_008364222.1|  PREDICTED: probable beta-D-xylosidase 5            152   1e-40   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  157   1e-40   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    158   1e-40   
ref|XP_006449653.1|  hypothetical protein CICLE_v10017977mg             155   1e-40   
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             156   2e-40   
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       156   2e-40   
ref|XP_008383565.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    156   2e-40   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            156   2e-40   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            156   2e-40   
ref|XP_008245938.1|  PREDICTED: probable beta-D-xylosidase 5            156   2e-40   
gb|EPS70883.1|  hypothetical protein M569_03875                         155   2e-40   
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             155   2e-40   
ref|XP_011460171.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    155   3e-40   
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            155   3e-40   
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            155   4e-40   
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            155   4e-40   
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...    153   4e-40   
emb|CDP01028.1|  unnamed protein product                                155   4e-40   
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                154   4e-40   
ref|XP_009360864.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    155   5e-40   
ref|XP_007008778.1|  Glycosyl hydrolase family protein                  155   5e-40   
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    154   5e-40   
emb|CDP01027.1|  unnamed protein product                                156   5e-40   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       155   5e-40   
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       156   5e-40   
gb|KDP42384.1|  hypothetical protein JCGZ_02441                         150   6e-40   
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6            154   6e-40   
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         154   6e-40   
ref|XP_010105119.1|  putative beta-D-xylosidase 6                       154   6e-40   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            154   6e-40   
ref|XP_002527212.1|  beta-glucosidase, putative                         150   6e-40   
gb|KJB29304.1|  hypothetical protein B456_005G093200                    154   7e-40   
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                  147   7e-40   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       154   7e-40   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    154   7e-40   
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6            154   7e-40   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    154   8e-40   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       154   9e-40   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       154   9e-40   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         154   9e-40   
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                154   9e-40   
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       154   1e-39   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    154   1e-39   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6            154   1e-39   
gb|KDO78121.1|  hypothetical protein CISIN_1g047862mg                   153   1e-39   
gb|KDP42389.1|  hypothetical protein JCGZ_02446                         151   1e-39   
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg             153   1e-39   
ref|XP_006369869.1|  hypothetical protein POPTR_0001s34340g             150   2e-39   
emb|CDP02677.1|  unnamed protein product                                153   2e-39   
ref|XP_006449655.1|  hypothetical protein CICLE_v10014315mg             153   2e-39   
ref|XP_006468193.1|  PREDICTED: probable beta-D-xylosidase 5-like       153   2e-39   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            153   2e-39   
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            153   2e-39   
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            153   2e-39   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         153   2e-39   
gb|KGN49379.1|  hypothetical protein Csa_6G522730                       151   3e-39   
gb|KCW75948.1|  hypothetical protein EUGRSUZ_D00316                     152   3e-39   
emb|CDO97277.1|  unnamed protein product                                153   3e-39   
ref|XP_006468194.1|  PREDICTED: probable beta-D-xylosidase 5-like       152   3e-39   
gb|KDP43295.1|  hypothetical protein JCGZ_24216                         150   3e-39   
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       152   3e-39   
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                152   3e-39   
gb|KDP37939.1|  hypothetical protein JCGZ_04582                         153   3e-39   
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            152   4e-39   
emb|CDX87482.1|  BnaA07g33910D                                          152   4e-39   
ref|XP_006354073.1|  PREDICTED: probable beta-D-xylosidase 7-like       152   5e-39   
ref|XP_008439653.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   5e-39   
ref|XP_008371585.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   6e-39   
gb|KJB59094.1|  hypothetical protein B456_009G239100                    152   6e-39   
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                152   6e-39   
ref|XP_003612944.1|  Beta-D-xylosidase                                  152   6e-39   
ref|XP_009536966.1|  xylosidase                                         151   7e-39   
gb|KDP32160.1|  hypothetical protein JCGZ_12621                         152   7e-39   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            151   7e-39   
ref|XP_010558471.1|  PREDICTED: probable beta-D-xylosidase 2            151   7e-39   
gb|KDO78122.1|  hypothetical protein CISIN_1g040836mg                   151   7e-39   
emb|CDX88410.1|  BnaC06g38540D                                          151   8e-39   
gb|ABY48135.1|  beta-D-xylosidase                                       151   8e-39   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       151   9e-39   
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7            151   9e-39   



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT+PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT LVNTAG+VS
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIPTYEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +ST
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVST  150

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLTYWSPN+NI+R
Sbjct  151  EARAMYNVGLAGLTYWSPNVNIYR  174



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT LVNTAGNVS
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGKVVST  153

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            E RAM+N G AGLTYWSPN+NI+R
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYR  177



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  139  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFP  +LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGKAVS  150

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAM+N GLAGLTYWSPN+NI+R
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYR  175



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +1

Query  139  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVS  150

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAM+N GLAGLTYWSPN+NI+R
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYR  175



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI+ LVNTAG+VS
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGKVVST  153

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            E RAM+N G AGLTYWSPN+NI+R
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYR  177



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  156  VGLAGLTFWSPNINIFR  172



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI FLV+ AG VS
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+SYTGPGV+F+G+VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGKVVST  159

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLTYWSPN+NIFR
Sbjct  160  EARAMYNVGLAGLTYWSPNINIFR  183



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI FLV+ AG VS
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+SYTGPGV+F+G++PAATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVST  156

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLTYWSPN+NIFR
Sbjct  157  EARAMYNVGLAGLTYWSPNINIFR  180



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI +LVNTA  VS
Sbjct  24   PVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAKGVS  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP Y+WWSEALHG+SY GPG  F+G+VP ATSFPQ +LTAA+FNE+LF  IGKV+ST
Sbjct  84   RLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGKVVST  143

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLT+WSPN+NIFR
Sbjct  144  EARAMYNVGLAGLTFWSPNINIFR  167



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P ++Q++PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI FLVN A  VS
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVST  142

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLTYWSPN+NIFR
Sbjct  143  EARAMYNVGLAGLTYWSPNVNIFR  166



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFR  175



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  156  VGLAGLTFWSPNINIFR  172



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  156  VGLAGLTFWSPNINIFR  172



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFR  172



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFR  175



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  151

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  152  ARAMYNVGLAGLTFWSPNINIFR  174



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFR  175



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P ATSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGKVVS  148

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLTYWSPN+NIFR
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFR  173



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++  V +Q +PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI FLV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             VSRLGIP YEWWSEALHG++YTGPGV+FT +VP ATSFPQ +LTAASFN TLF TIGKV
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKV  142

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +STEARAM+N GLAGLTYWSPN+NIFR
Sbjct  143  VSTEARAMYNVGLAGLTYWSPNVNIFR  169



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S  +PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKITFLV+ AG V+RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP+YEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGKVVSTEAR  149

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  150  AMYNVGLAGLTYWSPNVNIFR  170



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFR  172



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFR  172



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFR  172



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            + PV +Q +PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI FLV+ A  
Sbjct  60   LKPVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASG  119

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            VSRLGIP YEWWSEALHG++YTGPGV+F+ +VP ATSFPQ +LTAASFN +LF TIGKV+
Sbjct  120  VSRLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVV  179

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            STEARAM+N GLAGLTYWSPN+NIFR
Sbjct  180  STEARAMYNVGLAGLTYWSPNVNIFR  205



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLTYWSPN+NIFR
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFR  173



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFR  172



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V SQT+PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A +V
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLTYWSPN+NIFR
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFR  173



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  152

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFR  175



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q +PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+FLVN+AG+VSR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTE  146

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  147  ARAMYNVGLAGLTFWSPNVNIFR  169



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI---  492
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKVI   
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVISQV  152

Query  493  -STEARAMHNYGLAGLTYWSPNMNIFR  570
             STEARAM+N GLAGLT+WSPN+NIFR
Sbjct  153  VSTEARAMYNVGLAGLTFWSPNINIFR  179



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+ FLV+ AGNV RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  159

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  160  VGLAGLTFWSPNVNIFR  176



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI FLVN AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFR  172



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  34   AQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRLG  93

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  154  AMYNVGLAGLTYWSPNVNIFR  174



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  34   AQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRLG  93

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  154  AMYNVGLAGLTYWSPNVNIFR  174



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+ +L N+A  VSRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSE LHG+SYTGPGV FT +VP ATSFPQ +LT+ASFNE+LF  IGKV+STEARAM+N
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGKVVSTEARAMYN  139

Query  520  YGLAGLTYWSPNMNIFR  570
             G AGLT+WSPN+NIFR
Sbjct  140  VGSAGLTFWSPNVNIFR  156



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F  +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  150

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFR  173



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  142  VQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            V  QT+ PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAMHN GLA LT+WSPN+NIFR
Sbjct  152  EARAMHNVGLAELTFWSPNVNIFR  175



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI F+V+ AG+VSR
Sbjct  44   VFGQTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSR  103

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG  F+ +VP ATSFPQ +LTAASFN TLF  IG+V+STE
Sbjct  104  LGIPKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVSTE  163

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  164  ARAMYNVGLAGLTYWSPNINIFR  186



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A NVSR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG +F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGRVVSTE  151

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFR  174



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 5/148 (3%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK-----  486
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGK     
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVYYTQ  150

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N GLAGLT+WSPN+NIFR
Sbjct  151  VVSTEARAMYNVGLAGLTFWSPNINIFR  178



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFR  173



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLT+WSPN+NIFR
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFR  173



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +QT+PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  153  AMYNVGLAGLTYWSPNVNIFR  173



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFR  178



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFR  178



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  38   AQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  97

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  98   IPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  157

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  158  AMYNVGLAGLTYWSPNVNIFR  178



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  153  AMYNVGLAGLTYWSPNVNIFR  173



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI FLVN AG V+RLGIP+
Sbjct  35   SPVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPS  94

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+
Sbjct  95   YEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVSTEARAMY  154

Query  517  NYGLAGLTYWSPNMNIFR  570
            N GLAGLTYWSPN+NIFR
Sbjct  155  NVGLAGLTYWSPNVNIFR  172



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++ P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI FLV+ A 
Sbjct  20   VLPPSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAK  79

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             VSRLGIP YEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK 
Sbjct  80   AVSRLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKA  139

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +STEARAM+N GLAGLT+WSPN+NIFR
Sbjct  140  VSTEARAMYNVGLAGLTFWSPNVNIFR  166



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  34   AQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRLG  93

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  154  AMYNVGLAGLTYWSPNVNIFR  174



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+ FLVN A  VSR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STE
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVSTE  146

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAMHN GLAGLTYWSPN+NIFR
Sbjct  147  ARAMHNVGLAGLTYWSPNVNIFR  169



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI FLV+ A  VSRLG
Sbjct  34   AQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRLG  93

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  154  AMYNVGLAGLTYWSPNVNIFR  174



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  142  VQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            V  QT  PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTPKPVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP Y+WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  92   RLGIPNYKWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAMHN GLAGLT+WSPN+NIFR
Sbjct  152  EARAMHNVGLAGLTFWSPNVNIFR  175



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFR  175



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI FLVN+AG+VSRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STEAR
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTEAR  157

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  158  AMYNVGLAGLTYWSPNINIFR  178



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +1

Query  136  GPVQSQ-TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            G V+ Q T+P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI FLVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            VSRLGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGKVV  149

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            STEARAM+N GLAGLTYWSPN+NI R
Sbjct  150  STEARAMYNVGLAGLTYWSPNVNIVR  175



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  513
            TYEWWSEALHG+SY GPG +FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  92   TYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  151

Query  514  HNYGLAGLTYWSPNMNIFR  570
            +N GLAGLTYWSPN+NIFR
Sbjct  152  YNVGLAGLTYWSPNVNIFR  170



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFR  175



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+ FLVN A  VSR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP+YEWWSEALHG+S+ GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  149

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAMHN GLAGLT+WSPN+NIFR
Sbjct  150  ARAMHNVGLAGLTFWSPNVNIFR  172



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
             GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI +LV+ A  
Sbjct  20   FGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAKG  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            VSRLGIP+Y WWSEALHG+S  G G  FTG VPAATSFPQ +LT A+FNE+LF  IGKV+
Sbjct  80   VSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGKVV  139

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            STEARAM+N G AGLT+WSPN+NIFR
Sbjct  140  STEARAMYNVGSAGLTFWSPNVNIFR  165



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V  QT+ ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A +V
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP ATSFP P+LTAASFN +LF TIG+ +S
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGRAVS  147

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLTYWSPN+NIFR
Sbjct  148  TEARAMHNVGLAGLTYWSPNINIFR  172



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  513
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  92   TYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  151

Query  514  HNYGLAGLTYWSPNMNIFR  570
            +N GLAGLTYWSPN+NIFR
Sbjct  152  YNVGLAGLTYWSPNVNIFR  170



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  38   AQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  97

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  98   IPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  157

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  158  AMYNVGLAGLTYWSPNVNIFR  178



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  153  AMYNVGLAGLTYWSPNVNIFR  173



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  38   AQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  97

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  98   IPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  157

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  158  AMYNVGLAGLTYWSPNVNIFR  178



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  153  AMYNVGLAGLTYWSPNVNIFR  173



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  41   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  100

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  513
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  101  TYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  160

Query  514  HNYGLAGLTYWSPNMNIFR  570
            +N GLAGLTYWSPN+NIFR
Sbjct  161  YNVGLAGLTYWSPNVNIFR  179



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI FLVN+AG+VSR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTE  155

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFR  178



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  176  ARAMYNVGLAGLTYWSPNINIFR  198



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+ FLVN A  VSR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  148

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAMHN GLAGLT+WSPN+NIFR
Sbjct  149  ARAMHNVGLAGLTFWSPNVNIFR  171



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK  +LV+ A  VS
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+SYTGPG  F   VP ATSFPQ +LTA +FNE+LF  IGKV+ST
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGKVVST  143

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLT+WSPN+NIFR
Sbjct  144  EARAMYNVGLAGLTFWSPNVNIFR  167



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF TIGKVISTEARAMHN
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGKVISTEARAMHN  158

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  159  VGLAGLTFWSPNVNIFR  175



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYW+PN+NIFR
Sbjct  176  ARAMYNVGLAGLTYWAPNINIFR  198



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  160

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  161  AMYNVGLAGLTYWSPNVNIFR  181



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  169

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  170  AMYNVGLAGLTYWSPNVNIFR  190



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  68   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  127

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  128  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  187

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  188  AMYNVGLAGLTYWSPNVNIFR  208



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S   P++ACD   N  L    FCN     K RV DLVKRLTL EK+ FLVN A  V RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP+YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STEAR
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGKVVSTEAR  147

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AMHN GLAGLTYWSPN+NIFR
Sbjct  148  AMHNVGLAGLTYWSPNVNIFR  168



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  44   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRLG  103

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  104  IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  163

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  164  AMYNVGLAGLTYWSPNVNIFR  184



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  33   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  153  AMYNVGLAGLTYWSPNVNIFR  173



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  44   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRLG  103

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  104  IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  163

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  164  AMYNVGLAGLTYWSPNVNIFR  184



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  33   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVARLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLTYWSPN+NIFR
Sbjct  153  AMYNVGLAGLTYWSPNVNIFR  173



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI +LV+ +  V
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
            SRLGIP Y+WWSEALHG+SY GPG  F+  +PAAT FPQ +LTA++FN++LF TI KV+S
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLFETIAKVVS  142

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAM+N GLAGLT++SPN+NIFR
Sbjct  143  TEARAMYNAGLAGLTFFSPNINIFR  167



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+STE
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIGSVVSTE  151

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFR  174



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI FLVN    VSRLGIP 
Sbjct  29   SPVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPA  88

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            YEWWSEALHG+SY GPG +F+G+VP ATSFPQ + + ASFN +L+  IGKV+STEARAM+
Sbjct  89   YEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGKVVSTEARAMY  148

Query  517  NYGLAGLTYWSPNMNIFR  570
            N GLAGLT+WSPN+NIFR
Sbjct  149  NVGLAGLTFWSPNINIFR  166



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+S E
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIGSVVSNE  151

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFR  174



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P+ ++++PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI FLV+ A  VS
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP Y WWSEALHG+S  GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVST  146

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N G AGLT+WSPN+NIFR
Sbjct  147  EARAMYNVGQAGLTFWSPNVNIFR  170



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP Y WWSEALHG+S  G G NF+G +  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N GLAGLT+WSPN+NIFR
Sbjct  153  AMYNVGLAGLTFWSPNVNIFR  173



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  28   NQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRLG  87

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP+Y+WWSEALHG+S  G G  FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  88   IPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  147

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLT+WSPN+NIFR
Sbjct  148  AMYNVGSAGLTFWSPNVNIFR  168



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  +Q++PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI FL + A  VS
Sbjct  30   PSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRANGVS  89

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP Y WWSEALHG+S  G G NF+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  90   RLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGKVVST  149

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLT+WSPN+NIFR
Sbjct  150  EARAMYNVGLAGLTFWSPNVNIFR  173



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STEA AM+N G
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTEAGAMYNVG  131

Query  526  LAGLTYWSPNMNIFR  570
            LAG TYWSPN+NIFR
Sbjct  132  LAGFTYWSPNINIFR  146



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  142  VQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            V  Q +P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVST  148

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLT+WSPN+NIFR
Sbjct  149  EARAMYNVGLAGLTFWSPNVNIFR  172



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI +L++ A +V+RLGIP 
Sbjct  39   SPAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPK  98

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            YEWWSEALHG+S  GPG  FT VVP ATSFPQ + TAASFN TLF  IGKV+S EARAM+
Sbjct  99   YEWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVSNEARAMY  158

Query  517  NYGLAGLTYWSPNMNIFR  570
            N GLAGLTYWSPN+NIFR
Sbjct  159  NTGLAGLTYWSPNVNIFR  176



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  GPG +F+ +VP AT+FP P+LTAASFN +LF  IG V+S E
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIGSVVSNE  150

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N GLAGLTYWSPN+NIFR
Sbjct  151  ARAMYNVGLAGLTYWSPNINIFR  173



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP Y+WWSEALHG+S  G G +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLT+WSPN+NIFR
Sbjct  153  AMYNVGSAGLTFWSPNVNIFR  173



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 113/144 (78%), Gaps = 3/144 (2%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S +   YAC    N   +S PFC++ L V  RVADLV+RLTL EKITFLV+ AGNVSR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPG-VNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            LGIPTY+WWSEALHG+S  G G   FT +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVST  149

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLTYW+PN+NIFR
Sbjct  150  EARAMYNVGLAGLTYWAPNINIFR  173



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++G V   +  V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AG
Sbjct  29   VVGQV---SQAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAG  85

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
            N+SRLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  86   NISRLGIPKYEWWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKV  145

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +STEARAM+N GLAGLT+WSPN+NIFR
Sbjct  146  VSTEARAMYNVGLAGLTFWSPNVNIFR  172



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLT+WSPN+NIFR
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFR  170



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +1

Query  163  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+ FL N AG+V RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  522
            WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN 
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  160

Query  523  GLAGLTYWSPNMNIFR  570
            GLAGLT+WSPN+NIFR
Sbjct  161  GLAGLTFWSPNVNIFR  176



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A +VSRLGIP YEW
Sbjct  30   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPKYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F+ V+P ATSFP P+LTAASFN +LF  IG+V+STEARAM+N G
Sbjct  90   WSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGRVVSTEARAMYNVG  149

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+NIFR
Sbjct  150  LAGLTYWSPNINIFR  164



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  340  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  517  NYGLAGLTYWSPNMNIFR  570
            N G AGLT+WSPN+NIFR
Sbjct  153  NVGAAGLTFWSPNVNIFR  170



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  340  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  517  NYGLAGLTYWSPNMNIFR  570
            N G AGLT+WSPN+NIFR
Sbjct  153  NVGAAGLTFWSPNVNIFR  170



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  167

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLT+WSPN+NIFR
Sbjct  168  AMYNVGSAGLTFWSPNVNIFR  188



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  167

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLT+WSPN+NIFR
Sbjct  168  AMYNVGSAGLTFWSPNVNIFR  188



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 110/143 (77%), Gaps = 3/143 (2%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V+ QT   +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSR
Sbjct  25   VRGQT---FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSR  81

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGIP YEWWSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  82   LGIPRYEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTE  141

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            A AM+N GLAGLTYWSPN+NIFR
Sbjct  142  AGAMYNVGLAGLTYWSPNINIFR  164



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLT+WSPN+NIFR
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFR  170



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLT+WSPN+NIFR
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFR  170



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLT+WSPN+NIFR
Sbjct  153  AMYNVGSAGLTFWSPNVNIFR  173



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLT+WSPN+NIFR
Sbjct  153  AMYNVGSAGLTFWSPNVNIFR  173



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI FL ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIPTYEWW+EALHG+S+ GP   F+ +VP+AT FPQ +LTAASFN +LF  IGK +ST
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGKAVST  147

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLTYWSPN+NIFR
Sbjct  148  EARAMYNVGLAGLTYWSPNVNIFR  171



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  L    FCN++     R  DLV RLTL EK+ FLVN    + RL
Sbjct  223  EAQT-PVFACD-ASNATLAGYGFCNRKASASARAKDLVSRLTLAEKVGFLVNKQAALGRL  280

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEA
Sbjct  281  GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEA  340

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAMHN GLAGLT+WSPN+NIFR
Sbjct  341  RAMHNVGLAGLTFWSPNINIFR  362



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  513
             Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGKVVSTEARAM  155

Query  514  HNYGLAGLTYWSPNMNIFR  570
            +N G AGLT+WSPN+NIFR
Sbjct  156  YNVGAAGLTFWSPNVNIFR  174



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ  LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    + RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEARAMHN
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHN  155

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  156  VGLAGLTFWSPNINIFR  172



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
            V+STEARAM+N G AGLT+WSPN+NIFR
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFR  174



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  513
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  155

Query  514  HNYGLAGLTYWSPNMNIFR  570
            +N G AGLT+W+PN+NIFR
Sbjct  156  YNVGAAGLTFWAPNVNIFR  174



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+ FL ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWW+EALHG+S+ GP   FT +VP+AT FPQ +LTAASFN +LF  IGK +STEARAM+N
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGKAVSTEARAMYN  154

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLTYWSPN+NIFR
Sbjct  155  VGLAGLTYWSPNVNIFR  171



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEA
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGEVVSTEA  142

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAMHN GLAGLT+WSPN+NIFR
Sbjct  143  RAMHNVGLAGLTFWSPNINIFR  164



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  28   RAQT-PVFACD-ASNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPRL  85

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            GIP YEWWSEALHG+SY GPG  F+ +VPAATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  86   GIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGEVVSNEA  145

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAMHN GLAGLT+WSPN+NIFR
Sbjct  146  RAMHNVGLAGLTFWSPNINIFR  167



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 106/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAMHN GLAGLT+WSPN+NIFR
Sbjct  152  RAMHNVGLAGLTFWSPNINIFR  173



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   187 bits (476),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 88/137 (64%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  152  VGLAGLTFWSPNINIFR  168



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  520  YGLAGLTYWSPNMNIFR  570
             GLAGLT+WSPN+NIFR
Sbjct  152  VGLAGLTFWSPNINIFR  168



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +1

Query  133  IGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI ++++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGK  486
             VSRLGIP Y WWSEALHG+   GPG  F    V AATSFPQ +LTAASFN +LFH IGK
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGK  146

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
             ISTEARAMHN G AGLT+WSPN+NIFR
Sbjct  147  AISTEARAMHNVGAAGLTFWSPNVNIFR  174



>gb|EYU44008.1| hypothetical protein MIMGU_mgv1a0207571mg, partial [Erythranthe 
guttata]
Length=203

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N   K++PFC   L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  33   FACDP-SNSVSKNMPFCRVSLHIRDRVGDLIGRLTLQEKIRSLVNNAAPVDRLGIKGYEW  91

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNTGPGVKFGGEFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  151

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  152  VAGLTYWSPNVNIFR  166



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    +
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  495
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  143

Query  496  TEARAMHNYGLAGLTYWSPNMNIFR  570
            TEARAMHN GLAGLT+WSPN+NIFR
Sbjct  144  TEARAMHNVGLAGLTFWSPNINIFR  168



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 106/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAMHN GLAGLT+WSPN+NIFR
Sbjct  152  RAMHNVGLAGLTFWSPNINIFR  173



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A  + RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            +P+Y+WW EALHG++ + PGV F G+ PAATSFP P+  AASFN TLF++IG+ +S+EAR
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGEAVSSEAR  149

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            A+HN G AGLT+WSPN+NIFR
Sbjct  150  ALHNLGRAGLTFWSPNVNIFR  170



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I+   ++ TA + YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A
Sbjct  23   ILSNARASTAQLRYACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAA  82

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  486
              + RLG+P+Y+WW EALHG++ + PGV F G+ PAATSFP P+ TAASFN TLF++IG+
Sbjct  83   QGIPRLGVPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGE  141

Query  487  VISTEARAMHNYGLAGLTYWSPNMNIFR  570
             +S+EARA+HN G AGLT+WSPN+NIFR
Sbjct  142  AVSSEARALHNLGRAGLTFWSPNVNIFR  169



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  148

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NIFR
Sbjct  149  GGMAGLTYWSPNVNIFR  165



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P   +  P +ACD      + S PFC++ L +  RV+DL++RLTLPEK   LVN A  ++
Sbjct  20   PAIVEPGPSFACDGQ----MGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLG+P YEWWSEALHG+S  GPG  F G VP ATSFPQ +LTAASFN +L+  IG+ +ST
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVST  135

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N GLAGLT+WSPN+NIFR
Sbjct  136  EARAMYNEGLAGLTFWSPNVNIFR  159



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+ FLVN    ++RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S EA
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSNEA  149

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAMHN GLAGLT+WSPN+NIFR
Sbjct  150  RAMHNVGLAGLTFWSPNINIFR  171



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  244  VADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATS  423
            VADLVKRLTL EKI FLVN+A  VSRLGIP YEWWS+ALHG+SY GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  424  FPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLAGLTYWSPNMNIFR  570
            FPQ +L AASF  +LF  IGKV+STEARAM+N GLAGLT+WSPN+NIF+
Sbjct  131  FPQVILPAASFYASLFEAIGKVVSTEARAMYNVGLAGLTFWSPNVNIFQ  179



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  146  LAGLTYWSPNVNVFR  160



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+  LVN AG VSRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVSDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NI R
Sbjct  147  AAGLTYWSPNVNILR  161



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A  VSRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+NIFR
Sbjct  146  LAGLTYWSPNVNIFR  160



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 3/146 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            STEARAM+N GLAGLTYWSPN+N+FR
Sbjct  137  STEARAMYNAGLAGLTYWSPNVNVFR  162



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  510
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S E RA
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRA  145

Query  511  MHNYGLAGLTYWSPNMNIFR  570
            M+N G AGLT+WSPN+NI R
Sbjct  146  MYNGGAAGLTFWSPNVNILR  165



>ref|XP_004170761.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
Length=241

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  351
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  352  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLA  531
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G A
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVSDEARAMYNGGTA  152

Query  532  GLTYWSPNMNIFR  570
            GLTYWSPN+NIFR
Sbjct  153  GLTYWSPNVNIFR  165



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+  LVN A  V R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F GV PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  147  AAGLTYWSPNVNIFR  161



>gb|KJB38536.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=589

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NIFR
Sbjct  150  GGMAGLTYWSPNVNIFR  166



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             + RLG+P Y+WWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNE L+  +G+V
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNEMLWLEMGRV  135

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +STEARAM+N GLAGLTYWSPN+N+FR
Sbjct  136  VSTEARAMYNVGLAGLTYWSPNVNVFR  162



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+  LVN A +VSRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  148

Query  526  LAGLTYWSPNMNIFR  570
            + GLTYWSPN+NIFR
Sbjct  149  MGGLTYWSPNVNIFR  163



>ref|XP_009804070.1| PREDICTED: beta-D-xylosidase 1 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  510
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S E RA
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRA  145

Query  511  MHNYGLAGLTYWSPNMNIFR  570
            M+N G AGLT+WSPN+NI R
Sbjct  146  MYNGGAAGLTFWSPNVNILR  165



>emb|CAN77623.1| hypothetical protein VITISV_007589 [Vitis vinifera]
Length=167

 Score =   165 bits (418),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EK+ FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKVGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGKV  T
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKVTLT  149



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  526  LAGLTYWSPNMNIFR  570
             +GLT+WSPN+NI+R
Sbjct  148  QSGLTFWSPNINIYR  162



>emb|CDP18762.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 6/140 (4%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            +  P YAC +       +  F    LDVKTRV DL+K+L+L EKI  LV+ A  VSRL I
Sbjct  15   RITPAYACAS------GNYTFYYTSLDVKTRVDDLIKKLSLQEKIGNLVDGAAGVSRLRI  68

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  510
            P YEWWSE LHG+S TGPGV+FT +VP ATSFPQ +LTAASFN++LF   GKV+STEARA
Sbjct  69   PIYEWWSEILHGVSNTGPGVHFTSLVPGATSFPQVILTAASFNQSLFEINGKVVSTEARA  128

Query  511  MHNYGLAGLTYWSPNMNIFR  570
            M+N GL GLT WSPN+NIFR
Sbjct  129  MYNVGLGGLTNWSPNVNIFR  148



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  526  LAGLTYWSPNMNIFR  570
             +GLT+WSPN+NI+R
Sbjct  148  QSGLTFWSPNINIYR  162



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD  +N   +SL FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI
Sbjct  31   ESRPPFACDP-RNGLTRSLRFCRVNLPLHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGI  89

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  510
              YEWWSEALHG+S  GPG  F G VP ATSFPQ + TAASFNE+L+  IG+V+S EARA
Sbjct  90   QGYEWWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGRVVSDEARA  149

Query  511  MHNYGLAGLTYWSPNMNIFR  570
            M+N G+AGLTYWSPN+NIFR
Sbjct  150  MYNGGMAGLTYWSPNVNIFR  169



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NIFR
Sbjct  150  GGMAGLTYWSPNVNIFR  166



>ref|NP_188596.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
 sp|Q9LJN4.2|BXL5_ARATH RecName: Full=Probable beta-D-xylosidase 5; Short=AtBXL5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76268.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
Length=781

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  146  LAGLTYWSPNVNVFR  160



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  146  VAGLTYWSPNVNIFR  160



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
             + P      P +ACD  +N   ++LPFC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  21   FVSPRTGDARPAFACDP-RNGLTRNLPFCRPSLPIPNRVRDLIGRLTLQEKIRLLVNNAA  79

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  80   PVPRLGIRGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGRV  139

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +S EARAM+N G+AGLTYWSPN+NIFR
Sbjct  140  VSDEARAMYNGGMAGLTYWSPNVNIFR  166



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  146  VAGLTYWSPNVNIFR  160



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEAR  143

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G+AGLTYWSPN+NIFR
Sbjct  144  AMYNGGMAGLTYWSPNVNIFR  164



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  146  LAGLTYWSPNVNVFR  160



>ref|XP_003615012.1| Auxin-induced beta-glucosidase, partial [Medicago truncatula]
Length=190

 Score =   164 bits (415),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L++ I KVI TEAR ++N
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGTEARGVYN  152

Query  520  YGLA-GLTYWSPNMNIFR  570
             G A G+T+W+PN+NIFR
Sbjct  153  AGQAQGMTFWAPNINIFR  170



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 105/147 (71%), Gaps = 4/147 (3%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
             I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN + 
Sbjct  15   FILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPST  70

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNETL++T+G+V
Sbjct  71   GISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQV  130

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +S EARAM+N  LAGLT+WSPN+N+FR
Sbjct  131  VSNEARAMYNVDLAGLTFWSPNVNVFR  157



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  147  VAGLTYWSPNVNIFR  161



>emb|CDY67410.1| BnaCnng54810D [Brassica napus]
Length=525

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  146  LAGLTYWSPNINVFR  160



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA  +SRLG+P YEW
Sbjct  85   FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTASGISRLGVPAYEW  143

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F   VP ATSFP  +L+AASFN TL+  +G+V+STEARAM+N G
Sbjct  144  WSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQVVSTEARAMYNVG  203

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  204  LAGLTYWSPNVNVFR  218



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  146  TAGLTYWSPNVNIFR  160



>gb|KDO87027.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
 gb|KDO87028.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
Length=226

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   ++LPFC   L +  RV DL+ RL+L EK+  L++ A  V RLGI  YEW
Sbjct  28   FACDP-KDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TA+SFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  147  TAGLTYWSPNVNIFR  161



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 4/141 (3%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            I  YEWWSEALHG+S   PGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EAR
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVISTAASFNASLWEHIGRVVSDEAR  140

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G+AGLTYWSPN+NIFR
Sbjct  141  AMYNGGMAGLTYWSPNVNIFR  161



>ref|XP_006830079.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
 gb|ERM97495.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
Length=801

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD  +      LPFCN  L +  R  DLV RL L EK+  LVN A  V+RLG+P YEW
Sbjct  38   YACDKGE---AAPLPFCNISLPIHDRAQDLVSRLNLTEKVQQLVNKAAGVARLGVPPYEW  94

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GP V+F G +P ATSFP  +L+ ASFNETL+  +G+V+STEARAM+N G
Sbjct  95   WSEALHGVSNVGPAVHFNGTIPGATSFPAVILSGASFNETLWFVMGQVVSTEARAMYNTG  154

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  155  LAGLTYWSPNVNVFR  169



>ref|XP_006406478.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
 gb|ESQ47931.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
Length=749

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = +1

Query  166  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNRATGVPRLGVPPYE  84

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  522
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  523  GLAGLTYWSPNMNIFR  570
            GLAGLTYWSPN+N+FR
Sbjct  145  GLAGLTYWSPNVNVFR  160



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + +AASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITSAASFNESLWEQIGRVVSDEAR  143

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G+AGLTYWSPN+NIFR
Sbjct  144  AMYNGGMAGLTYWSPNVNIFR  164



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             + RLGIP YEWWSEALHG+S  G GV F G VP ATSFP  +L+AASFNETL+  +G+V
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQV  131

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +STEAR MH+ GLAGLTYWSPN+N+FR
Sbjct  132  VSTEARTMHSVGLAGLTYWSPNVNVFR  158



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  42   FACDP-RNGVTRNLKFCRANLPIHVRVRDLISRLTLQEKIRLLVNNAAAVPRLGIQGYEW  100

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  101  WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGRVVSDEARAMYNGG  160

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  161  LAGLTYWSPNVNVFR  175



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +       PFCN  L  +TR  DLV RLTL EK+  LV+ +  ++RLG+P YEW
Sbjct  32   FACDN-RASATSQFPFCNTSLPYETRAKDLVSRLTLQEKVIQLVDKSTGIARLGVPAYEW  90

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG +F G VP ATSFP  +L+AASFN++L+  +G+V+STEARAM+N G
Sbjct  91   WSEALHGVSNVGPGTSFNGTVPGATSFPAVILSAASFNQSLWLKMGQVVSTEARAMYNVG  150

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  151  LAGLTYWSPNVNVFR  165



>emb|CDY58860.1| BnaCnng33860D [Brassica napus]
Length=771

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATAKYTFCKASLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  146  LAGLTYWSPNINVFR  160



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNTA  + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRLG  90

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            IP YEWWSEALHG++  G G+   G +PAATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  508  AMHNYGLA-GLTYWSPNMNIFR  570
            A++N G A G+T+W+PN+NIFR
Sbjct  151  AVYNAGQAKGMTFWTPNINIFR  172



>ref|XP_010466113.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = +1

Query  166  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            +ACD  KN P      FCN  L  + R  DL+ RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLISRLSLTEKVQQLVNKATGVPRLGVPPYE  84

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  522
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  523  GLAGLTYWSPNMNIFR  570
            GLAGLTYWSPN+N+FR
Sbjct  145  GLAGLTYWSPNVNVFR  160



>ref|XP_009603126.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana tomentosiformis]
Length=790

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  SQ    Y  D    P   +  FCN  L    R  D+V RLTL EK+  LVN+A  + 
Sbjct  19   PCNSQIHACYKSD----PNTSTYGFCNTSLAYTDRAKDIVSRLTLQEKVRQLVNSASGIP  74

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLG+P YEWWSEALHG+S TGPGV F   VP ATS P  +L+AASFN +L++T+GKV+ST
Sbjct  75   RLGVPAYEWWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVSLWYTLGKVVST  134

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAMHN GLAGLTYWSPN+N+ R
Sbjct  135  EARAMHNVGLAGLTYWSPNVNVLR  158



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAAAFNATLWEAIGQVVSDEARAMFNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  146  VAGLTYWSPNVNIFR  160



>ref|XP_006298950.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
 gb|EOA31848.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
Length=762

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = +1

Query  166  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVLRLSLNEKVQQLVNKATGVPRLGVPPYE  84

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  522
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  523  GLAGLTYWSPNMNIFR  570
            GLAGLTYWSPN+NIFR
Sbjct  145  GLAGLTYWSPNVNIFR  160



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  147  TAGLTYWSPNVNIFR  161



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  520  YGLAGLTYWSPNMNIFR  570
             G AGLTYWSPN+NIFR
Sbjct  149  GGQAGLTYWSPNVNIFR  165



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            S EARAM+N G+AGLTYWSPN+NIFR
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFR  165



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            S EARAM+N G+AGLTYWSPN+NIFR
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFR  165



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  520  YGLAGLTYWSPNMNIFR  570
             G AGLTYWSPN+NIFR
Sbjct  149  GGQAGLTYWSPNVNIFR  165



>ref|XP_009145766.1| PREDICTED: probable beta-D-xylosidase 5 [Brassica rapa]
Length=782

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N+FR
Sbjct  146  LAGLTYWSPNINVFR  160



>ref|XP_002264114.2| PREDICTED: probable beta-D-xylosidase 5 [Vitis vinifera]
Length=794

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  139

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLTYWSPN+NIFR
Sbjct  140  AMYNVGQAGLTYWSPNVNIFR  160



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+  LVN A  V+RLGI  Y
Sbjct  96   PAFACD-ARDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  PAATSFPQ + TAA+FN +L+  IG+V+S E RAM+N
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGRVVSDEGRAMYN  214

Query  520  YGLAGLTYWSPNMNIFR  570
             GL GLTYWSPN+NIFR
Sbjct  215  GGLGGLTYWSPNVNIFR  231



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGI  YEWWSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N G+AGLTYWSPN+NI R
Sbjct  147  EARAMYNGGVAGLTYWSPNVNILR  170



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  147  TAGLTYWSPNVNIFR  161



>ref|XP_007163167.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
 gb|ESW35161.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
Length=775

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNAVTKNLPFCKVSVAITERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWESIGRVVSDEARAMYNGG  149

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  150  VAGLTYWSPNINIFR  164



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  526  LAGLTYWSPNMNIFR  570
            + GLTYWSPN+NI R
Sbjct  150  VGGLTYWSPNVNILR  164



>ref|XP_009779847.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana sylvestris]
Length=794

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 98/144 (68%), Gaps = 4/144 (3%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  SQ    Y  D    P   +  FCN  L    R  DLV RLTL EK+  LVN+A  + 
Sbjct  19   PCNSQIHACYKSD----PNTSTYGFCNISLAYTDRAKDLVSRLTLQEKVGQLVNSASGIP  74

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLG+P YEWWSEALHG+S TGPGV F   VP ATS P  +L+AASFN  L++T+GKV+ST
Sbjct  75   RLGVPAYEWWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVLLWYTLGKVVST  134

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAMHN GLAGLTYWSPN+N+ R
Sbjct  135  EARAMHNVGLAGLTYWSPNVNVLR  158



>dbj|BAF00595.1| xylosidase [Arabidopsis thaliana]
Length=303

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRANVPIHVRVQDLLGRLTLQEKIRNLVNNAAAVPRLGIGGY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NI R
Sbjct  152  GGVAGLTYWSPNVNILR  168



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  146  TAGLTYWSPNVNIFR  160



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  28   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  86

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EAR
Sbjct  87   IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVSDEAR  146

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLTYWSPN+NIFR
Sbjct  147  AMYNGGAAGLTYWSPNVNIFR  167



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  ++   ++ PFC  +L +++RV+DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-EDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMFNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  146  VAGLTYWSPNVNIFR  160



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  34   FACDP-RNGLTRNLIFCRVNVPIHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  92

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  93   WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNGG  152

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+NIFR
Sbjct  153  LAGLTYWSPNVNIFR  167



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V RLGI  YEW
Sbjct  37   FACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVPRLGIKGYEW  95

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  96   WSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  155

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NI R
Sbjct  156  VAGLTYWSPNVNILR  170



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  49   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  107

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EAR
Sbjct  108  IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEAR  167

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLTYWSPN+NIFR
Sbjct  168  AMYNGGAAGLTYWSPNVNIFR  188



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NI R
Sbjct  168  GGVAGLTYWSPNVNILR  184



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 100/144 (69%), Gaps = 3/144 (2%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P    T P +AC     P   +LPFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PRGGATRPAFACG--GGPA-AALPFCRVALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S 
Sbjct  77   RLGIAGYEWWSEALHGVSDVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSD  136

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N G AGLT+WSPN+NIFR
Sbjct  137  EARAMYNGGQAGLTFWSPNVNIFR  160



>emb|CBI22460.3| unnamed protein product [Vitis vinifera]
Length=896

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  45   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  103

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  104  VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  163

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLTYWSPN+NIFR
Sbjct  164  AMYNVGQAGLTYWSPNVNIFR  184



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   N   ++L FC   L V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNLPVRVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NI R
Sbjct  168  GGVAGLTYWSPNVNILR  184



>ref|XP_010687347.1| PREDICTED: probable beta-D-xylosidase 5 [Beta vulgaris subsp. 
vulgaris]
Length=790

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YAC+  +   + +L FCN+ L    R  DLV RLTL EK   LVN A  + RLG+P YEW
Sbjct  24   YACNK-REVDINNLSFCNKSLPYHDRAKDLVSRLTLDEKARQLVNAARGIPRLGVPAYEW  82

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S TGPGV+F   VP ATSFP  +L+AASFN +L++ +G+V+STEARAM+N G
Sbjct  83   WSEALHGVSNTGPGVHFNATVPGATSFPAVILSAASFNTSLWYMMGQVVSTEARAMYNVG  142

Query  526  LAGLTYWSPNMNIFR  570
            LAGLTYWSPN+N++R
Sbjct  143  LAGLTYWSPNVNVYR  157



>emb|CAN82161.1| hypothetical protein VITISV_035506 [Vitis vinifera]
Length=925

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  139

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM+N G AGLTYWSPN+NIFR
Sbjct  140  AMYNVGQAGLTYWSPNVNIFR  160



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S+    +ACD  ++   ++ PFC  +L +++RV DL+ R+TL EK+  LVN A  V RLG
Sbjct  21   SEALDAFACDP-EDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  507
            I  YEWWSEALHG+S  GPG  F GV P ATSFPQ + T+ASFN TL+  IG+V+S EAR
Sbjct  80   IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQVVSDEAR  139

Query  508  AMHNYGLAGLTYWSPNMNIFR  570
            AM N G+AGLT+WSPN+NIFR
Sbjct  140  AMFNGGVAGLTFWSPNVNIFR  160



>ref|XP_002276351.1| PREDICTED: putative beta-D-xylosidase [Vitis vinifera]
Length=770

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   ++LPFC   L ++ R  DLV RLTL EKI  LVN A +V RLGI  YEW
Sbjct  27   FACDP-RNGVTRNLPFCRVSLPIQERARDLVGRLTLQEKIRLLVNNAIDVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  146  MAGLTYWSPNVNIFR  160



>emb|CBI22910.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   ++LPFC   L ++ R  DLV RLTL EKI  LVN A +V RLGI  YEW
Sbjct  27   FACDP-RNGVTRNLPFCRVSLPIQERARDLVGRLTLQEKIRLLVNNAIDVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  146  MAGLTYWSPNVNIFR  160



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  16   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  74

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  75   LGIKGYEWWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGRVVSNE  134

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N G+ GLTYWSPN+NI R
Sbjct  135  ARAMYNGGVGGLTYWSPNVNILR  157



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  S +   +ACD   +   + LPFC   L ++ RV DL+ RL L EK+  LVN A  V+
Sbjct  25   PSSSASREPFACDPT-DKTTRGLPFCRTSLPIQERVKDLIGRLALQEKVRLLVNNAAAVT  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  84   RLGIKGYEWWSEALHGVSNVGPGSKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  143

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N G+AGLTYWSPN+NIFR
Sbjct  144  EARAMYNGGVAGLTYWSPNVNIFR  167



>dbj|BAG28345.1| arabinofuranosidase [Citrus unshiu]
Length=769

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  147  MAGLTYWSPNVNIFR  161



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 99/144 (69%), Gaps = 3/144 (2%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  +   P +AC      GL   PFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PGGAAARPAFACGGGPAVGL---PFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S 
Sbjct  77   RLGIGGYEWWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSD  136

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N G AGLT+WSPN+NIFR
Sbjct  137  EARAMYNGGQAGLTFWSPNVNIFR  160



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +  Q  P +ACD  ++   K+ PFC   L +  RV DL+ RLTL EK+  L NTA  VSR
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLIGRLTLQEKVKLLGNTAAAVSR  80

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVISTAASFNASLWEEIGRVVSDE  140

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N  + GLTYWSPN+NIFR
Sbjct  141  ARAMYNGEMGGLTYWSPNVNIFR  163



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
              GLTYWSPN+NIFR
Sbjct  146  TGGLTYWSPNVNIFR  160



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  147  MAGLTYWSPNVNIFR  161



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 102/146 (70%), Gaps = 3/146 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
              EARAM+N G+AGLTYWSPN+NIFR
Sbjct  140  PDEARAMYNGGMAGLTYWSPNVNIFR  165



>ref|XP_010507856.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = +1

Query  166  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYE  84

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  522
            WWSEALHG+S  GPGV F G VP ATSFP  +LT A+FN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTTANFNTSLWLKMGEVVSTEARAMHNV  144

Query  523  GLAGLTYWSPNMNIFR  570
            GLAGLTYWSPN+N+FR
Sbjct  145  GLAGLTYWSPNVNVFR  160



>ref|XP_008454299.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Cucumis melo]
Length=741

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            + GLTYWSPN+NIFR
Sbjct  146  VGGLTYWSPNVNIFR  160



>ref|XP_010111676.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC31467.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=802

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 3/146 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  492
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  493  STEARAMHNYGLAGLTYWSPNMNIFR  570
            STEARAM+N GLAGLTYWSPN+N+FR
Sbjct  137  STEARAMYNAGLAGLTYWSPNVNVFR  162



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = +1

Query  166  YACDTVKNPGL-KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            +ACD     GL +SL FC   L V  RV+DL+ RLTL EKI  LVN A  V RLGI  YE
Sbjct  39   FACD--PRSGLTRSLRFCRTTLPVHVRVSDLIGRLTLQEKIRLLVNNAIEVPRLGIQGYE  96

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  522
            WWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N 
Sbjct  97   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  156

Query  523  GLAGLTYWSPNMNIFR  570
            GLAGLT+WSPN+NIFR
Sbjct  157  GLAGLTFWSPNVNIFR  172



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N G+ GLTYWSPN+NI R
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILR  162



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 3/145 (2%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P +S T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + 
Sbjct  25   PTES-TQPPYACDSSQ-PSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIP  82

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGIP+YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L++ IG+VI T
Sbjct  83   RLGIPSYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGT  142

Query  499  EARAMHNYGLA-GLTYWSPNMNIFR  570
            EARA++N G A G+T+W+PN+NIFR
Sbjct  143  EARALYNAGQATGMTFWAPNINIFR  167



>ref|XP_008454298.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Cucumis melo]
Length=768

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
            + GLTYWSPN+NIFR
Sbjct  146  VGGLTYWSPNVNIFR  160



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N G+ GLTYWSPN+NI R
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILR  162



>gb|KHN19223.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=681

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  149

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  150  TAGLTYWSPNVNIFR  164



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYN  149

Query  520  YGLAGLTYWSPNMNIFR  570
             G AGLT+WSPN+NIFR
Sbjct  150  GGAAGLTFWSPNVNIFR  166



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +NP  ++L FC  R  +  RV DL+ RLTL EKI  LVN A +V RLGI  YEW
Sbjct  33   FACDP-RNPITRTLKFCRVRASIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRLGIQGYEW  91

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNGG  151

Query  526  LAGLTYWSPNMNIFR  570
             AGLT+WSPN+NIFR
Sbjct  152  AAGLTFWSPNVNIFR  166



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYN  149

Query  520  YGLAGLTYWSPNMNIFR  570
             G AGLT+WSPN+NIFR
Sbjct  150  GGAAGLTFWSPNVNIFR  166



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +  Q  P +ACD  ++   K+ PFC   L +  RV DLV RLTL EK+  L NTA  V R
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLVGRLTLQEKVKLLGNTAAAVPR  80

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGRVVSDE  140

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N  + GLTYWSPN+NIFR
Sbjct  141  ARAMYNGDMGGLTYWSPNVNIFR  163



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            + S+    +ACD  KN    + PFC   L + TRV DL+ RLTL EK++ LVN A  V R
Sbjct  15   MSSEARDPFACDP-KNTSTNNFPFCKASLPIPTRVNDLIGRLTLQEKVSMLVNNAAAVPR  73

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            +GI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + T ASFN +L+  IG+V S E
Sbjct  74   VGIKGYEWWSEALHGVSNVGPGTKFAGQFPAATSFPQVITTVASFNASLWEAIGRVASDE  133

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N G AGLTYWSPN+NIFR
Sbjct  134  ARAMYNGGTAGLTYWSPNVNIFR  156



>ref|XP_006488872.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Citrus 
sinensis]
Length=826

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  68   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  126

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  127  WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  186

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+NIFR
Sbjct  187  MAGLTYWSPNVNIFR  201



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N G+++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  25   FACDPA-NAGIRNLRFCKTSLPIHVRVQDLIARLTLQEKIRLLVNNAAPVQRLGISGYEW  83

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S TG GV F G  P ATSFPQ + TAASFN +L+  IG+V+S E RAM+N G
Sbjct  84   WSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGRVVSEEGRAMYNGG  143

Query  526  LAGLTYWSPNMNIFR  570
             AGLT+WSPN+NIFR
Sbjct  144  AAGLTFWSPNVNIFR  158



>ref|XP_007200259.1| hypothetical protein PRUPE_ppa015037mg [Prunus persica]
 gb|EMJ01458.1| hypothetical protein PRUPE_ppa015037mg [Prunus persica]
Length=798

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            A  +ACD  K+       FCN+ L  + R  DLV RLTL EK+  LV+ +  ++RLG+P 
Sbjct  23   AQQFACDK-KDSTTSKFAFCNRTLSYENRAKDLVSRLTLQEKVQQLVDNSAGIARLGVPA  81

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            Y+WWSEALHG+S  GPG  F G VP ATSFP  +L+AASFN +L+  +G+V+STEARAM+
Sbjct  82   YKWWSEALHGVSDLGPGTKFNGTVPGATSFPAVILSAASFNSSLWLKMGQVVSTEARAMY  141

Query  517  NYGLAGLTYWSPNMNIFR  570
            N GLAGLTYWSPN+N+FR
Sbjct  142  NVGLAGLTYWSPNVNVFR  159



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  31   FACDA-KNGLTRSLKFCRVNMPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM N G
Sbjct  90   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNKSLWEEIGRVVSDEARAMFNGG  149

Query  526  LAGLTYWSPNMNIFR  570
            +AGLTYWSPN+N+FR
Sbjct  150  MAGLTYWSPNVNVFR  164



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEAGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  498
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  499  EARAMHNYGLAGLTYWSPNMNIFR  570
            EARAM+N G+AGLTYWSPN+N+ R
Sbjct  147  EARAMYNGGVAGLTYWSPNVNVLR  170



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  526  LAGLTYWSPNMNIFR  570
            + GLTYWSPN+NI R
Sbjct  150  VGGLTYWSPNVNILR  164



>ref|XP_003520749.2| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=802

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  58   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  116

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  117  WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  176

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  177  TAGLTYWSPNVNIFR  191



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 98/138 (71%), Gaps = 7/138 (5%)
 Frame = +1

Query  166  YACDTVKNPGL---KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +ACD    P L   +SL FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  
Sbjct  28   FACD----PKLGLTRSLKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQG  83

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            YEWWSEALHG+S  GPG  F G  P AT+FPQ + TAASFNE+L+  IG+V+S EARAM+
Sbjct  84   YEWWSEALHGVSNVGPGTKFGGAFPGATAFPQVITTAASFNESLWEEIGRVVSDEARAMY  143

Query  517  NYGLAGLTYWSPNMNIFR  570
            N G+AGLTYWSPN+N+FR
Sbjct  144  NGGMAGLTYWSPNVNVFR  161



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++  V  +    +ACD  K+      PFC + + +  RV DL+ RLTL EK+  LVN A 
Sbjct  17   VLAVVSGEARDPFACDP-KDGANAGFPFCRKSIGIGERVKDLIGRLTLEEKVRLLVNNAA  75

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  489
             V RLGI  YEWWSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  76   GVPRLGIKGYEWWSEALHGVSNVGPGTKFSGDFPGATSFPQVITTAASFNSSLWEAIGQV  135

Query  490  ISTEARAMHNYGLAGLTYWSPNMNIFR  570
            +S EARAM+N G AGLT+WSPN+NIFR
Sbjct  136  VSDEARAMYNGGAAGLTFWSPNVNIFR  162



>ref|XP_004494414.1| PREDICTED: probable beta-D-xylosidase 2-like [Cicer arietinum]
Length=771

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++   +ACD  K+   K LPFC+ +L +  RV D++ RLTL EK+  LVN A  V R GI
Sbjct  22   ESRDTFACDP-KDGTTKKLPFCSVKLAIPERVKDIIGRLTLQEKVNLLVNNAAAVPRFGI  80

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  510
              YEWWSEALHG+S  GPG  F  + P ATSFPQ + TAASFN +L+  IG+V+S EARA
Sbjct  81   KGYEWWSEALHGVSNVGPGTKFGALFPGATSFPQVITTAASFNASLWEAIGRVVSDEARA  140

Query  511  MHNYGLAGLTYWSPNMNIFR  570
            M+N G AGLTYWSPN+NIFR
Sbjct  141  MYNGGAAGLTYWSPNVNIFR  160



>emb|CDY49607.1| BnaA09g03310D [Brassica napus]
Length=788

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   N   ++L FC   + V+ RV DL+ R TL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNIPVRVRVQDLIGRFTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NI R
Sbjct  168  GGVAGLTYWSPNVNILR  184



>ref|XP_008236322.1| PREDICTED: probable beta-D-xylosidase 5 [Prunus mume]
Length=916

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            A  +ACD  K+       FCN+ L  + R  DLV RLTL EK+  LV+ +  ++RLG+P 
Sbjct  23   AQQFACDN-KDSTTSKFAFCNRTLSYENRAKDLVSRLTLQEKVQQLVDNSAGIARLGVPA  81

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  516
            Y+WWSEALHG+S  GPG  F G VP ATSFP  +L+AASFN +L+  +G+V+STEARAM+
Sbjct  82   YKWWSEALHGVSDLGPGTKFNGTVPGATSFPAVILSAASFNSSLWLKMGQVVSTEARAMY  141

Query  517  NYGLAGLTYWSPNMNIFR  570
            N GLAGLTYWSPN+N+FR
Sbjct  142  NVGLAGLTYWSPNVNVFR  159



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  351
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  352  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLA  531
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G A
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVSDEARAMYNGGTA  152

Query  532  GLTYWSPNMNIFR  570
            GLTYWSPN+NIFR
Sbjct  153  GLTYWSPNVNIFR  165



>ref|XP_004156823.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 2-like 
[Cucumis sativus]
Length=769

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++  AP +ACD   N      PFC + L V+ RV DL+ RLTL EK+  LV+ AG V RL
Sbjct  21   RASRAP-FACDP-NNSVTTDYPFCRRSLVVEERVKDLIGRLTLEEKVKLLVSNAGGVPRL  78

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            GI  Y+WWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V+S EA
Sbjct  79   GIKAYQWWSEALHGVSNVGPGTRFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEA  138

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAM+N G+ GLTYWSPN+NIFR
Sbjct  139  RAMYNGGVGGLTYWSPNVNIFR  160



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            QS T+  +AC+   +   K LPFC  +L +  RV DL+ RLTL EK+  LVN+A  V RL
Sbjct  28   QSPTSSSFACNP-NDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRL  86

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  504
            GI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+ +S EA
Sbjct  87   GIKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEAIGQAVSDEA  146

Query  505  RAMHNYGLAGLTYWSPNMNIFR  570
            RAM+N G+ GLTYWSPN+N+ R
Sbjct  147  RAMYNGGMGGLTYWSPNVNVLR  168



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +NP  ++L FC   + +  RV DL+ RLTL EKI  LVN A +V RLGI  YEW
Sbjct  33   FACDP-RNPITRTLKFCRVTMSIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRLGIQGYEW  91

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNGG  151

Query  526  LAGLTYWSPNMNIFR  570
             AGLT+WSPN+NIFR
Sbjct  152  AAGLTFWSPNVNIFR  166



>emb|CDY33913.1| BnaA02g30740D [Brassica napus]
Length=772

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  519
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  520  YGLAGLTYWSPNMNIFR  570
             G+AGLTYWSPN+NI R
Sbjct  152  GGVAGLTYWSPNVNILR  168



>ref|XP_003554544.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=771

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN G K + FC   L +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  27   FACDP-KNGGTKKMAFCKVSLAIAERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  525
            WSEALHG+S  GP V F    PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNLGPAVKFNAQFPAATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  145

Query  526  LAGLTYWSPNMNIFR  570
             AGLTYWSPN+NIFR
Sbjct  146  TAGLTYWSPNVNIFR  160



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V+      +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  22   VRVHCRETFACDT-KDAATATLRFCQMSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPR  80

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  501
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNE  140

Query  502  ARAMHNYGLAGLTYWSPNMNIFR  570
            ARAM+N G+ GLTYWSPN+NI R
Sbjct  141  ARAMYNGGVGGLTYWSPNVNILR  163



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 100/140 (71%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            Q+   +ACD +K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + RLGI
Sbjct  20   QSRETFACD-IKDAATATLRFCQLSVPITERVKDLIGRLTLVEKVSLLGNTAAAIPRLGI  78

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  510
              YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARA
Sbjct  79   KGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARA  138

Query  511  MHNYGLAGLTYWSPNMNIFR  570
            M+N G+ GLTYWSPN+NI R
Sbjct  139  MYNGGVGGLTYWSPNVNILR  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515