BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014P14

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784283.1|  PREDICTED: DNA-directed RNA polymerase III s...  55.8    7e-08   Nicotiana sylvestris
ref|XP_009607009.1|  PREDICTED: DNA-directed RNA polymerase III s...  53.9    2e-07   Nicotiana tomentosiformis
ref|XP_009784284.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.0    1e-06   Nicotiana sylvestris
ref|XP_011076392.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.8    1e-06   Sesamum indicum [beniseed]
ref|XP_009607010.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.1    3e-06   Nicotiana tomentosiformis
emb|CDP05351.1|  unnamed protein product                              48.1    5e-06   Coffea canephora [robusta coffee]



>ref|XP_009784283.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score = 55.8 bits (133),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query  133  MDPNLPSSPTSSrkfrfapkpp-prrakkkVELKTESNRHDASDDEAPDTRLLRRANEHL  309
            MDP+LPSSP  +RK +FAPK P  R+ +  V+ KTE++R++ ++D      +L R NE L
Sbjct  1    MDPDLPSSPPKTRKVKFAPKAPPRRKKQNSVQHKTEADRNEDTNDNEAAEAILHRVNERL  60

Query  310  TRGkakaekkavqvvFSHGVASSAPIRTYGNPRE  411
            TR K K EKKAV+V F+HGVAS   IRT+G P+E
Sbjct  61   TRQKPKTEKKAVEVAFAHGVASPTSIRTFGKPKE  94


 Score = 27.3 bits (59),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +2

Query  473  PSPSNTNVDVDEDSLAKAES-IKKKKREYREP  565
            P PS+   D+ E S++ +++ +K+KK+EY+EP
Sbjct  119  PLPSSIEADLAEISVSNSDALLKRKKKEYKEP  150



>ref|XP_009607009.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Nicotiana tomentosiformis]
Length=358

 Score = 53.9 bits (128),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  133  MDPNLPSSPTSSrkfrfapkppprrakkk-VELKTESNRHDASDDEAPDTRLLRRANEHL  309
            MDP+LPSSP  +RK +FAPK PPRR K+  V+ KTE++ ++ ++D      + RR NE L
Sbjct  1    MDPDLPSSPPKTRKVKFAPKAPPRRKKQNPVQPKTEADGNEDTNDNEAAEAIRRRVNERL  60

Query  310  TRGkakaekkavqvvFSHGVASSAPIRTYGNPREGTAD  423
            TR K K EKKAV+V FSHGVAS   IRT+G P+E T +
Sbjct  61   TRQKPKTEKKAVEVAFSHGVASPTSIRTFGKPKELTVN  98


 Score = 27.7 bits (60),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +2

Query  473  PSPSNTNVDVDEDSLAKAESI-KKKKREYREP  565
            P PS+   D+ E S++ ++++ K+KK+EY+EP
Sbjct  119  PLPSSIGADLAEISVSNSDALFKRKKKEYKEP  150



>ref|XP_009784284.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Nicotiana sylvestris]
Length=355

 Score = 52.0 bits (123),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +1

Query  133  MDPNLPSSPTSSrkfrfapkpp-prrakkkVELKTESNRHDASDDEAPDTRLLRRANEHL  309
            MDP+LPSSP  +RK +FAPK P  R+ +  V+ KTE++R++ ++D      +L R NE L
Sbjct  1    MDPDLPSSPPKTRKVKFAPKAPPRRKKQNSVQHKTEADRNEDTNDNEAAEAILHRVNERL  60

Query  310  TRGkakaekkavqvvFSHGVASSAPIRTYGNPRE  411
            TR +    +K V+V F+HGVAS   IRT+G P+E
Sbjct  61   TR-QKPKTEKKVEVAFAHGVASPTSIRTFGKPKE  93


 Score = 27.3 bits (59),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +2

Query  473  PSPSNTNVDVDEDSLAKAES-IKKKKREYREP  565
            P PS+   D+ E S++ +++ +K+KK+EY+EP
Sbjct  118  PLPSSIEADLAEISVSNSDALLKRKKKEYKEP  149



>ref|XP_011076392.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Sesamum indicum]
 ref|XP_011076393.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Sesamum indicum]
 ref|XP_011076394.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Sesamum indicum]
Length=366

 Score = 50.8 bits (120),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +1

Query  229  KTESNRHDASDDEAPDTRLLRRANEHLT-RGkakaekkavqvvFSHGVASSAPIRTYGNP  405
            K+E+   D SDDE     L R+ +EHLT RG    +K + QV FSHGVA++  IRT+G P
Sbjct  31   KSETAAQDDSDDEQTQQFLTRKVHEHLTRRGSKVEKKSSAQVAFSHGVAANT-IRTFGKP  89

Query  406  REGTAD  423
            RE T D
Sbjct  90   RERTGD  95


 Score = 28.1 bits (61),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +2

Query  455  DPRDLVPSPSNTNVD-VDEDSLAKAES-IKKKKREYREP  565
            D ++LV S S    + VDE++ + A++ + KKKREY+EP
Sbjct  109  DDQNLVASVSTAGTEGVDENTASSADALVVKKKREYKEP  147



>ref|XP_009607010.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Nicotiana tomentosiformis]
Length=357

 Score = 50.1 bits (118),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +1

Query  133  MDPNLPSSPTSSrkfrfapkppprrakkk-VELKTESNRHDASDDEAPDTRLLRRANEHL  309
            MDP+LPSSP  +RK +FAPK PPRR K+  V+ KTE++ ++ ++D      + RR NE L
Sbjct  1    MDPDLPSSPPKTRKVKFAPKAPPRRKKQNPVQPKTEADGNEDTNDNEAAEAIRRRVNERL  60

Query  310  TRGkakaekkavqvvFSHGVASSAPIRTYGNPREGTAD  423
            TR +    +K V+V FSHGVAS   IRT+G P+E T +
Sbjct  61   TR-QKPKTEKKVEVAFSHGVASPTSIRTFGKPKELTVN  97


 Score = 27.7 bits (60),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +2

Query  473  PSPSNTNVDVDEDSLAKAESI-KKKKREYREP  565
            P PS+   D+ E S++ ++++ K+KK+EY+EP
Sbjct  118  PLPSSIGADLAEISVSNSDALFKRKKKEYKEP  149



>emb|CDP05351.1| unnamed protein product [Coffea canephora]
Length=380

 Score = 48.1 bits (113),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +1

Query  283  LLRRANEHLTR-GkakaekkavqvvFSHGVASSAPIRTYGNPREGTAD  423
            LLR+ NEHLTR      +K +VQV FSHGVASS  +RTYG+ +EG+ D
Sbjct  51   LLRKVNEHLTRRWPQAEKKSSVQVAFSHGVASSTSLRTYGSAKEGSGD  98


 Score = 28.9 bits (63),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
 Frame = +2

Query  431  GLKGSGYGDPRDLVPSPSNTNVD--VDEDSLAKAESIKKKKREYREP  565
            GL+ S      D+   PS + +D  V+    A   S K+KKREY+EP
Sbjct  104  GLRDSAADTRGDIHSLPSTSKIDWMVESSEDATVTSFKQKKREYKEP  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920