BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014P10

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629282.1|  PREDICTED: regulator of nonsense transcripts...    117   2e-27   Nicotiana tomentosiformis
ref|XP_006362492.1|  PREDICTED: regulator of nonsense transcripts...    112   3e-25   Solanum tuberosum [potatoes]
ref|XP_004244550.1|  PREDICTED: regulator of nonsense transcripts...    112   3e-25   Solanum lycopersicum
ref|XP_009781095.1|  PREDICTED: regulator of nonsense transcripts...    111   3e-25   Nicotiana sylvestris
ref|XP_006358610.1|  PREDICTED: regulator of nonsense transcripts...    111   7e-25   Solanum tuberosum [potatoes]
ref|XP_009626110.1|  PREDICTED: regulator of nonsense transcripts...    109   2e-24   Nicotiana tomentosiformis
ref|XP_009626103.1|  PREDICTED: regulator of nonsense transcripts...    109   2e-24   Nicotiana tomentosiformis
ref|XP_009792531.1|  PREDICTED: regulator of nonsense transcripts...    109   2e-24   Nicotiana sylvestris
ref|XP_004245855.1|  PREDICTED: regulator of nonsense transcripts...    109   2e-24   Solanum lycopersicum
ref|XP_010325538.1|  PREDICTED: regulator of nonsense transcripts...    109   2e-24   Solanum lycopersicum
emb|CDP13413.1|  unnamed protein product                                109   3e-24   Coffea canephora [robusta coffee]
gb|EYU17850.1|  hypothetical protein MIMGU_mgv1a000580mg                104   9e-23   Erythranthe guttata [common monkey flower]
gb|EYU33046.1|  hypothetical protein MIMGU_mgv1a000320mg                103   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_002279304.2|  PREDICTED: regulator of nonsense transcripts...  99.4    7e-21   Vitis vinifera
ref|XP_010664057.1|  PREDICTED: regulator of nonsense transcripts...  99.4    8e-21   Vitis vinifera
ref|XP_011070275.1|  PREDICTED: regulator of nonsense transcripts...  98.6    1e-20   Sesamum indicum [beniseed]
ref|XP_010269894.1|  PREDICTED: regulator of nonsense transcripts...  92.8    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006590595.1|  PREDICTED: regulator of nonsense transcripts...  92.4    2e-18   Glycine max [soybeans]
ref|XP_003517385.1|  PREDICTED: regulator of nonsense transcripts...  92.4    2e-18   Glycine max [soybeans]
ref|XP_008448746.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  92.0    2e-18   Cucumis melo [Oriental melon]
gb|EPS67765.1|  hypothetical protein M569_07005                       91.7    3e-18   Genlisea aurea
ref|XP_007210428.1|  hypothetical protein PRUPE_ppa000334mg           91.7    3e-18   Prunus persica
ref|XP_008229510.1|  PREDICTED: regulator of nonsense transcripts...  91.7    3e-18   Prunus mume [ume]
ref|XP_008229509.1|  PREDICTED: regulator of nonsense transcripts...  91.7    3e-18   Prunus mume [ume]
ref|XP_008786216.1|  PREDICTED: regulator of nonsense transcripts...  91.7    3e-18   Phoenix dactylifera
ref|XP_008786218.1|  PREDICTED: regulator of nonsense transcripts...  91.7    4e-18   
ref|XP_004511758.1|  PREDICTED: regulator of nonsense transcripts...  91.3    4e-18   
ref|XP_004511759.1|  PREDICTED: regulator of nonsense transcripts...  90.9    7e-18   Cicer arietinum [garbanzo]
ref|XP_007156614.1|  hypothetical protein PHAVU_002G003300g           90.9    7e-18   Phaseolus vulgaris [French bean]
ref|XP_007156615.1|  hypothetical protein PHAVU_002G003300g           90.9    7e-18   Phaseolus vulgaris [French bean]
ref|XP_004150168.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  90.1    1e-17   
ref|XP_004163978.1|  PREDICTED: regulator of nonsense transcripts...  89.7    1e-17   
gb|KGN55800.1|  hypothetical protein Csa_3G016940                     89.7    1e-17   Cucumis sativus [cucumbers]
ref|XP_010933539.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  89.0    3e-17   Elaeis guineensis
ref|XP_008784706.1|  PREDICTED: regulator of nonsense transcripts...  87.8    7e-17   Phoenix dactylifera
ref|XP_003611424.1|  Regulator of nonsense transcripts-like protein   87.4    9e-17   Medicago truncatula
gb|KEH27486.1|  regulator of nonsense transcripts protein             87.4    9e-17   Medicago truncatula
ref|XP_008373714.1|  PREDICTED: regulator of nonsense transcripts...  86.7    1e-16   
ref|XP_010274587.1|  PREDICTED: regulator of nonsense transcripts...  86.7    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010274588.1|  PREDICTED: regulator of nonsense transcripts...  86.7    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009369688.1|  PREDICTED: regulator of nonsense transcripts...  86.7    2e-16   
ref|XP_009369687.1|  PREDICTED: regulator of nonsense transcripts...  86.7    2e-16   
ref|XP_009369685.1|  PREDICTED: regulator of nonsense transcripts...  86.7    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_009371868.1|  PREDICTED: regulator of nonsense transcripts...  86.7    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008346507.1|  PREDICTED: regulator of nonsense transcripts...  86.3    2e-16   
ref|XP_008346509.1|  PREDICTED: regulator of nonsense transcripts...  86.3    2e-16   
ref|XP_008346508.1|  PREDICTED: regulator of nonsense transcripts...  86.3    3e-16   
ref|XP_009341223.1|  PREDICTED: regulator of nonsense transcripts...  85.5    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_009341225.1|  PREDICTED: regulator of nonsense transcripts...  85.5    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_009341224.1|  PREDICTED: regulator of nonsense transcripts...  85.5    5e-16   Pyrus x bretschneideri [bai li]
gb|EPS70804.1|  hypothetical protein M569_03951                       83.6    9e-16   Genlisea aurea
ref|XP_004300289.1|  PREDICTED: regulator of nonsense transcripts...  84.0    1e-15   Fragaria vesca subsp. vesca
ref|XP_010919834.1|  PREDICTED: regulator of nonsense transcripts...  83.6    2e-15   Elaeis guineensis
ref|XP_008375865.1|  PREDICTED: regulator of nonsense transcripts...  83.2    3e-15   
ref|XP_008375866.1|  PREDICTED: regulator of nonsense transcripts...  83.2    3e-15   
ref|XP_008375864.1|  PREDICTED: regulator of nonsense transcripts...  83.2    3e-15   
ref|XP_008375863.1|  PREDICTED: regulator of nonsense transcripts...  83.2    3e-15   
ref|XP_010110516.1|  Regulator of nonsense transcripts 1-like pro...  82.4    5e-15   Morus notabilis
ref|XP_010530003.1|  PREDICTED: regulator of nonsense transcripts...  81.3    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010530005.1|  PREDICTED: regulator of nonsense transcripts...  81.3    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010530004.1|  PREDICTED: regulator of nonsense transcripts...  81.3    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010055383.1|  PREDICTED: regulator of nonsense transcripts...  80.1    3e-14   Eucalyptus grandis [rose gum]
ref|XP_006385597.1|  RNA helicase family protein                      79.0    7e-14   
ref|XP_010518678.1|  PREDICTED: regulator of nonsense transcripts...  77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010518677.1|  PREDICTED: regulator of nonsense transcripts...  77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_011032015.1|  PREDICTED: regulator of nonsense transcripts...  77.4    2e-13   Populus euphratica
ref|XP_006368472.1|  RNA helicase family protein                      77.0    3e-13   
gb|KDO41072.1|  hypothetical protein CISIN_1g0010541mg                73.6    4e-13   Citrus sinensis [apfelsine]
gb|KFK31413.1|  hypothetical protein AALP_AA6G108800                  75.5    1e-12   Arabis alpina [alpine rockcress]
ref|XP_006398395.1|  hypothetical protein EUTSA_v10000743mg           75.5    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006436833.1|  hypothetical protein CICLE_v10033615mg           74.7    2e-12   
ref|XP_002865151.1|  low-level beta-amylase 1                         73.9    4e-12   
ref|XP_006485359.1|  PREDICTED: regulator of nonsense transcripts...  73.6    4e-12   Citrus sinensis [apfelsine]
ref|XP_002528794.1|  nonsense-mediated mRNA decay protein, putative   73.2    7e-12   Ricinus communis
gb|KDP45961.1|  hypothetical protein JCGZ_11864                       72.8    8e-12   Jatropha curcas
emb|CDY43638.1|  BnaC02g33040D                                        72.8    8e-12   Brassica napus [oilseed rape]
ref|XP_009128922.1|  PREDICTED: regulator of nonsense transcripts...  72.8    8e-12   Brassica rapa
ref|XP_009397656.1|  PREDICTED: regulator of nonsense transcripts...  72.0    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398577.1|  PREDICTED: regulator of nonsense transcripts...  71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398576.1|  PREDICTED: regulator of nonsense transcripts...  71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398575.1|  PREDICTED: regulator of nonsense transcripts...  71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398574.1|  PREDICTED: regulator of nonsense transcripts...  71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199512.2|  Regulator of nonsense transcripts 1-like protein    71.2    3e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10240.1|  prematurely terminated mRNA decay factor-like pr...  70.9    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445773.1|  PREDICTED: regulator of nonsense transcripts...  69.7    9e-11   
ref|XP_011018658.1|  PREDICTED: regulator of nonsense transcripts...  69.7    1e-10   Populus euphratica
ref|XP_010481386.1|  PREDICTED: regulator of nonsense transcripts...  69.3    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010494909.1|  PREDICTED: regulator of nonsense transcripts...  69.3    1e-10   Camelina sativa [gold-of-pleasure]
dbj|BAD30435.1|  putative type 1 RNA helicase                         68.2    4e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82084.1|  hypothetical protein OsI_26082                        67.8    4e-10   Oryza sativa Indica Group [Indian rice]
tpg|DAA62798.1|  TPA: hypothetical protein ZEAMMB73_068361            65.9    2e-09   
ref|XP_008651594.1|  PREDICTED: uncharacterized protein LOC100304...  65.9    2e-09   Zea mays [maize]
ref|XP_008651595.1|  PREDICTED: uncharacterized protein LOC100304...  65.9    2e-09   
tpg|DAA40908.1|  TPA: hypothetical protein ZEAMMB73_069756            65.5    2e-09   
ref|XP_008651597.1|  PREDICTED: uncharacterized protein LOC100304...  65.9    2e-09   Zea mays [maize]
ref|XP_008651596.1|  PREDICTED: uncharacterized protein LOC100304...  65.9    2e-09   Zea mays [maize]
ref|XP_006282104.1|  hypothetical protein CARUB_v10028351mg           65.5    2e-09   Capsella rubella
tpg|DAA40909.1|  TPA: hypothetical protein ZEAMMB73_069756            65.1    3e-09   
ref|XP_008668400.1|  PREDICTED: uncharacterized protein LOC100383...  64.7    4e-09   Zea mays [maize]
ref|XP_008668399.1|  PREDICTED: uncharacterized protein LOC100383...  64.7    4e-09   Zea mays [maize]
ref|XP_002460731.1|  hypothetical protein SORBIDRAFT_02g033940        64.7    4e-09   Sorghum bicolor [broomcorn]
ref|XP_003563076.1|  PREDICTED: regulator of nonsense transcripts...  64.7    4e-09   Brachypodium distachyon [annual false brome]
ref|XP_010677214.1|  PREDICTED: regulator of nonsense transcripts...  63.2    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006858514.1|  hypothetical protein AMTR_s00071p00142490        63.2    1e-08   Amborella trichopoda
gb|KJB25398.1|  hypothetical protein B456_004G189700                  62.8    2e-08   Gossypium raimondii
gb|KJB25396.1|  hypothetical protein B456_004G189700                  62.8    2e-08   Gossypium raimondii
gb|KJB25397.1|  hypothetical protein B456_004G189700                  62.4    2e-08   Gossypium raimondii
gb|KHF99302.1|  Regulator of nonsense transcripts 1 -like protein     61.2    6e-08   Gossypium arboreum [tree cotton]
gb|KJB21033.1|  hypothetical protein B456_003G179500                  61.2    6e-08   Gossypium raimondii
ref|XP_004957770.1|  PREDICTED: regulator of nonsense transcripts...  60.8    7e-08   Setaria italica
gb|KHG18592.1|  Regulator of nonsense transcripts 1 -like protein     60.8    7e-08   Gossypium arboreum [tree cotton]
ref|XP_007039605.1|  Regulator of nonsense transcripts 1              58.5    5e-07   
gb|AAL92018.1|  UPF1                                                  56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01127.1|  Regulator of nonsense transcripts 1 -like protein     50.1    2e-04   Gossypium arboreum [tree cotton]



>ref|XP_009629282.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana 
tomentosiformis]
Length=732

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQAN+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+F ELSQPIR SAWPTPSDSLV
Sbjct  1    MDSQANNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFHELSQPIRSSAWPTPSDSLV  59



>ref|XP_006362492.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum 
tuberosum]
Length=1264

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ N+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+FQELSQPIR SAWPTPSDSLV
Sbjct  1    MDSQPNNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQPIRSSAWPTPSDSLV  59



>ref|XP_004244550.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum 
lycopersicum]
Length=1264

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ N+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+FQELSQPIR SAWPTPSDSLV
Sbjct  1    MDSQPNNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQPIRSSAWPTPSDSLV  59



>ref|XP_009781095.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana 
sylvestris]
 ref|XP_009781096.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana 
sylvestris]
Length=687

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDS AN+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+F ELSQPIR SAWPTPSDSLV
Sbjct  1    MDSPANNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFHELSQPIRSSAWPTPSDSLV  59



>ref|XP_006358610.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum 
tuberosum]
Length=1267

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ+N LY+TASQPDTGNDAYTF+EFNT GEEFDYP+F ELSQPIR SAWPTPSDSLV
Sbjct  1    MDSQSNSLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFHELSQPIRSSAWPTPSDSLV  59



>ref|XP_009626110.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Nicotiana tomentosiformis]
Length=1269

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            M++Q N+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+FQELSQPIR SAWPTPSDSLV
Sbjct  1    MNTQPNNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQPIRSSAWPTPSDSLV  59



>ref|XP_009626103.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=1273

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            M++Q N+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+FQELSQPIR SAWPTPSDSLV
Sbjct  1    MNTQPNNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQPIRSSAWPTPSDSLV  59



>ref|XP_009792531.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana 
sylvestris]
Length=1272

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            M++Q N+LY+TASQPDTGNDAYTF+EFNT GEEFDYP+FQELSQPIR SAWPTPSDSLV
Sbjct  1    MNTQPNNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQPIRSSAWPTPSDSLV  59



>ref|XP_004245855.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Solanum lycopersicum]
Length=1274

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ N LY+TASQPDTGND YTF+EFNT GEEFDYP+F ELSQPIR SAWPTPSDSLV
Sbjct  1    MDSQGNSLYDTASQPDTGNDVYTFLEFNTQGEEFDYPEFHELSQPIRSSAWPTPSDSLV  59



>ref|XP_010325538.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Solanum lycopersicum]
Length=1261

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ N LY+TASQPDTGND YTF+EFNT GEEFDYP+F ELSQPIR SAWPTPSDSLV
Sbjct  1    MDSQGNSLYDTASQPDTGNDVYTFLEFNTQGEEFDYPEFHELSQPIRSSAWPTPSDSLV  59



>emb|CDP13413.1| unnamed protein product [Coffea canephora]
Length=1281

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQAN+LYETASQPDTGNDAYTF+EFNT GE+FDYP+FQELSQPIR S WPTP DS+
Sbjct  1    MDSQANNLYETASQPDTGNDAYTFLEFNTQGEDFDYPEFQELSQPIRSSVWPTPGDSI  58



>gb|EYU17850.1| hypothetical protein MIMGU_mgv1a000580mg [Erythranthe guttata]
Length=1060

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 3/61 (5%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEE-FDYPDFQELSQPIRP--SAWPTPSDS  355
            MDSQAN+LYETASQPDTGNDAYTF+EFNT GEE FDYP+FQELSQPIR   SAWPTPSDS
Sbjct  1    MDSQANNLYETASQPDTGNDAYTFLEFNTQGEEDFDYPEFQELSQPIRSSTSAWPTPSDS  60

Query  356  L  358
            +
Sbjct  61   I  61



>gb|EYU33046.1| hypothetical protein MIMGU_mgv1a000320mg [Erythranthe guttata]
Length=1260

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 3/61 (5%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEE-FDYPDFQELSQPIRP--SAWPTPSDS  355
            MDSQAN+LYETASQPDTGNDAYTF+EFNT GEE FDYP+FQELSQPIR   SAWPTPSDS
Sbjct  1    MDSQANNLYETASQPDTGNDAYTFLEFNTQGEEDFDYPEFQELSQPIRSSTSAWPTPSDS  60

Query  356  L  358
            +
Sbjct  61   I  61



>ref|XP_002279304.2| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Vitis vinifera]
 emb|CBI33955.3| unnamed protein product [Vitis vinifera]
Length=1267

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 3/58 (5%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ N+LY+TASQPDTGNDAYTF+EFNT GE+FDYPDF++   PIRPSAWPTPSDS+
Sbjct  1    MDSQPNNLYDTASQPDTGNDAYTFIEFNTQGEDFDYPDFRD---PIRPSAWPTPSDSI  55



>ref|XP_010664057.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Vitis vinifera]
Length=1272

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 3/58 (5%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ N+LY+TASQPDTGNDAYTF+EFNT GE+FDYPDF++   PIRPSAWPTPSDS+
Sbjct  1    MDSQPNNLYDTASQPDTGNDAYTFIEFNTQGEDFDYPDFRD---PIRPSAWPTPSDSI  55



>ref|XP_011070275.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Sesamum 
indicum]
Length=1276

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPG-EEFDYPDFQELSQPIRPSA--WPTPSDS  355
            MDSQ ++LYETASQPDTGNDAYTF+EFNT G E+FDYP+FQELSQPIR SA  WPTPSDS
Sbjct  1    MDSQTSNLYETASQPDTGNDAYTFLEFNTQGDEDFDYPEFQELSQPIRSSASVWPTPSDS  60

Query  356  L  358
            +
Sbjct  61   I  61



>ref|XP_010269894.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nelumbo 
nucifera]
Length=1274

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  200  NDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSL  358
            N+LYE ASQPDTG DAYTF+EFNT G+++DYP+F+ELSQPIR S WPTPSDS+
Sbjct  8    NNLYEAASQPDTGGDAYTFLEFNTQGDDYDYPEFRELSQPIRSSVWPTPSDSV  60



>ref|XP_006590595.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine 
max]
Length=1268

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine 
max]
Length=1266

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008448746.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
1 homolog [Cucumis melo]
Length=1268

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>gb|EPS67765.1| hypothetical protein M569_07005, partial [Genlisea aurea]
Length=1245

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 3/60 (5%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEE-FDYPDFQELSQPIRPSA--WPTPSDS  355
            MDSQ +DLYET SQPDTGNDAYTF+EFNT GEE FDYP+FQELSQPIR +A  WP  +DS
Sbjct  13   MDSQTSDLYETLSQPDTGNDAYTFIEFNTQGEEDFDYPEFQELSQPIRSAASVWPPHTDS  72



>ref|XP_007210428.1| hypothetical protein PRUPE_ppa000334mg [Prunus persica]
 gb|EMJ11627.1| hypothetical protein PRUPE_ppa000334mg [Prunus persica]
Length=1276

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQPNNLFETASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008229510.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Prunus mume]
Length=1272

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQPNNLFETASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008229509.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Prunus mume]
Length=1274

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQPNNLFETASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008786216.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008786217.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Phoenix dactylifera]
Length=1266

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  188  DSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPS  349
            DS  N+LYETASQPDTG DAYTF+EFNT G+E+DYP+F+ELSQP R SAWP+P+
Sbjct  4    DSVVNNLYETASQPDTGGDAYTFLEFNTQGDEYDYPEFRELSQPTRSSAWPSPA  57



>ref|XP_008786218.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Phoenix dactylifera]
Length=1249

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  188  DSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPS  349
            DS  N+LYETASQPDTG DAYTF+EFNT G+E+DYP+F+ELSQP R SAWP+P+
Sbjct  4    DSVVNNLYETASQPDTGGDAYTFLEFNTQGDEYDYPEFRELSQPTRSSAWPSPA  57



>ref|XP_004511758.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Cicer arietinum]
Length=1261

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFDTASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_004511759.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Cicer arietinum]
Length=1259

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFDTASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_007156614.1| hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris]
 gb|ESW28608.1| hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris]
Length=1248

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFDTASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_007156615.1| hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris]
 gb|ESW28609.1| hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris]
Length=1268

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDTGNDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFDTASQPDTGNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
1 homolog [Cucumis sativus]
Length=1246

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRPPVAWPTPSDSL  56



>ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis 
sativus]
Length=1268

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRPPVAWPTPSDSL  56



>gb|KGN55800.1| hypothetical protein Csa_3G016940 [Cucumis sativus]
Length=1269

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L+ETASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRPPVAWPTPSDSL  56



>ref|XP_010933539.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
1 homolog [Elaeis guineensis]
Length=1267

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  188  DSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPS  349
            DS  N+LYETASQPDTG DAYTF+EFNT G+++DYP+F+ELSQP R SAWP P+
Sbjct  4    DSVVNNLYETASQPDTGGDAYTFLEFNTQGDDYDYPEFRELSQPTRSSAWPHPA  57



>ref|XP_008784706.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Phoenix 
dactylifera]
Length=1262

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  188  DSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTP  346
            DS  N+LYETASQPDTG DAYTF+EFNT G+E+DYP+F+ELSQP R  AWP P
Sbjct  4    DSVVNNLYETASQPDTGGDAYTFLEFNTQGDEYDYPEFRELSQPTRSPAWPHP  56



>ref|XP_003611424.1| Regulator of nonsense transcripts-like protein [Medicago truncatula]
 gb|AES94382.1| regulator of nonsense transcripts protein [Medicago truncatula]
Length=1253

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS  N+L++TASQPDTG DAYTF+EFNT GE+FDYPDF++   PIR P AWPTPSDSL
Sbjct  1    MDSTQNNLFDTASQPDTGTDAYTFLEFNTQGEDFDYPDFRD---PIRSPVAWPTPSDSL  56



>gb|KEH27486.1| regulator of nonsense transcripts protein [Medicago truncatula]
Length=1275

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS  N+L++TASQPDTG DAYTF+EFNT GE+FDYPDF++   PIR P AWPTPSDSL
Sbjct  1    MDSTQNNLFDTASQPDTGTDAYTFLEFNTQGEDFDYPDFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008373714.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Malus 
domestica]
Length=582

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTSNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_010274587.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Nelumbo nucifera]
Length=1259

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSL  358
             N+LYETASQPDTG DAYTF+EFNT G+++DYP+F+ELSQPIR S WP   DS+
Sbjct  7    VNNLYETASQPDTGGDAYTFLEFNTQGDDYDYPEFRELSQPIRSSVWPPTPDSV  60



>ref|XP_010274588.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Nelumbo nucifera]
Length=1249

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPTPSDSL  358
             N+LYETASQPDTG DAYTF+EFNT G+++DYP+F+ELSQPIR S WP   DS+
Sbjct  7    VNNLYETASQPDTGGDAYTFLEFNTQGDDYDYPEFRELSQPIRSSVWPPTPDSV  60



>ref|XP_009369688.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Pyrus x bretschneideri]
Length=1283

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_009369687.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=1284

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_009369685.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=1285

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_009371868.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Pyrus 
x bretschneideri]
Length=1293

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008346507.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Malus domestica]
Length=1283

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTSNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008346509.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Malus domestica]
Length=1281

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTSNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_008346508.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Malus domestica]
Length=1282

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDS+ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MDSEPNNLFDTASQPDTSNDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_009341223.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=1267

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTASDSL  56



>ref|XP_009341225.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Pyrus x bretschneideri]
Length=1264

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTASDSL  56



>ref|XP_009341224.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=1266

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTASDSL  56



>gb|EPS70804.1| hypothetical protein M569_03951, partial [Genlisea aurea]
Length=547

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 7/61 (11%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPG-EEFDYPDFQELSQPIRPSA--WPTPSDS  355
            MDSQ    YETASQPDTGND YTF+EFNT G E+FDY +FQ LSQPIRPSA  WP+ SDS
Sbjct  1    MDSQ----YETASQPDTGNDVYTFLEFNTQGDEDFDYAEFQGLSQPIRPSASVWPSSSDS  56

Query  356  L  358
            +
Sbjct  57   V  57



>ref|XP_004300289.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Fragaria 
vesca subsp. vesca]
Length=1277

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            M+SQ N+L++TASQPDT  DAYTF+EFNT GE+FDYP+F++   PIR P AWPTPSDSL
Sbjct  1    MESQPNNLFDTASQPDTATDAYTFLEFNTQGEDFDYPEFRD---PIRSPVAWPTPSDSL  56



>ref|XP_010919834.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Elaeis 
guineensis]
Length=1263

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  188  DSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAW  337
            DS  N+LYETASQPDTG DAYTF+EFNT G+++DY +F+ELSQPIR SAW
Sbjct  4    DSVVNNLYETASQPDTGGDAYTFLEFNTQGDDYDYSEFRELSQPIRSSAW  53



>ref|XP_008375865.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Malus domestica]
Length=1271

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+ DYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDLDYPEFRD---PIRSPVAWPTASDSL  56



>ref|XP_008375866.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X4 [Malus domestica]
Length=1270

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+ DYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDLDYPEFRD---PIRSPVAWPTASDSL  56



>ref|XP_008375864.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Malus domestica]
Length=1272

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+ DYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDLDYPEFRD---PIRSPVAWPTASDSL  56



>ref|XP_008375863.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Malus domestica]
Length=1273

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIR-PSAWPTPSDSL  358
            MDSQ N+L++TASQPDT NDAYTF+EFNT GE+ DYP+F++   PIR P AWPT SDSL
Sbjct  1    MDSQPNNLFDTASQPDTANDAYTFLEFNTQGEDLDYPEFRD---PIRSPVAWPTASDSL  56



>ref|XP_010110516.1| Regulator of nonsense transcripts 1-like protein [Morus notabilis]
 gb|EXC26734.1| Regulator of nonsense transcripts 1-like protein [Morus notabilis]
Length=1267

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPS-AWPTPSDSL  358
            MDSQ ++L++ ASQPDT NDAYTF+EFNT GE+FDYP+F++   PIR S +WPTPSDSL
Sbjct  1    MDSQQSNLFDAASQPDTANDAYTFLEFNTQGEDFDYPEFRD---PIRSSVSWPTPSDSL  56



>ref|XP_010530003.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Tarenaya hassleriana]
Length=1258

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ N+L+ETASQPDT  DAYTF+EFNT GE EFDYP+F+       P+AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTAADAYTFLEFNTQGESEFDYPEFRS------PAAWPTPSDSL  53



>ref|XP_010530005.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Tarenaya hassleriana]
Length=1251

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ N+L+ETASQPDT  DAYTF+EFNT GE EFDYP+F+       P+AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTAADAYTFLEFNTQGESEFDYPEFRS------PAAWPTPSDSL  53



>ref|XP_010530004.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Tarenaya hassleriana]
Length=1254

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ N+L+ETASQPDT  DAYTF+EFNT GE EFDYP+F+       P+AWPTPSDSL
Sbjct  1    MDSQQNNLFETASQPDTAADAYTFLEFNTQGESEFDYPEFRS------PAAWPTPSDSL  53



>ref|XP_010055383.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Eucalyptus 
grandis]
 gb|KCW71841.1| hypothetical protein EUGRSUZ_E00323 [Eucalyptus grandis]
Length=1269

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 5/59 (8%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ N L+ETASQPD GNDAYTF EFNT G+ +FDYP+F++   P+R SAWPTPSDS+
Sbjct  1    MDSQQNSLFETASQPDAGNDAYTFYEFNTQGDGDFDYPEFRD---PMR-SAWPTPSDSI  55



>ref|XP_006385597.1| RNA helicase family protein [Populus trichocarpa]
 gb|ERP63394.1| RNA helicase family protein [Populus trichocarpa]
Length=1242

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MD+Q N+LYETASQPDT  DAYTF+EFNT GE +FDYP+F+       P AWPTPSDSL
Sbjct  1    MDNQDNNLYETASQPDTATDAYTFLEFNTQGESDFDYPEFRS------PVAWPTPSDSL  53



>ref|XP_010518678.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Tarenaya hassleriana]
Length=1246

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ ++L+ETASQPDT  DAYTF+EFNT G+ EFDYP+F+       P+AWPTPSDSL
Sbjct  1    MDSQQSNLFETASQPDTAADAYTFLEFNTQGDSEFDYPEFRS------PTAWPTPSDSL  53



>ref|XP_010518677.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Tarenaya hassleriana]
Length=1249

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ ++L+ETASQPDT  DAYTF+EFNT G+ EFDYP+F+       P+AWPTPSDSL
Sbjct  1    MDSQQSNLFETASQPDTAADAYTFLEFNTQGDSEFDYPEFRS------PTAWPTPSDSL  53



>ref|XP_011032015.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Populus 
euphratica]
Length=1265

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            M++Q N+LYETASQPDT  DAYTF+EFNT GE +FDYP+F+       P AWPTPSDSL
Sbjct  1    MNNQDNNLYETASQPDTATDAYTFLEFNTQGESDFDYPEFRS------PVAWPTPSDSL  53



>ref|XP_006368472.1| RNA helicase family protein [Populus trichocarpa]
 gb|ERP65041.1| RNA helicase family protein [Populus trichocarpa]
Length=1256

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MD+Q N LYETASQPDT  DAYTF+EFNT GE +FDYP+F+       P  WPTPSDSL
Sbjct  1    MDAQDNSLYETASQPDTATDAYTFLEFNTQGESDFDYPEFRS------PVTWPTPSDSL  53



>gb|KDO41072.1| hypothetical protein CISIN_1g0010541mg, partial [Citrus sinensis]
 gb|KDO41073.1| hypothetical protein CISIN_1g0010541mg, partial [Citrus sinensis]
 gb|KDO41074.1| hypothetical protein CISIN_1g0010541mg, partial [Citrus sinensis]
 gb|KDO41075.1| hypothetical protein CISIN_1g0010541mg, partial [Citrus sinensis]
 gb|KDO41076.1| hypothetical protein CISIN_1g0010541mg, partial [Citrus sinensis]
 gb|KDO41077.1| hypothetical protein CISIN_1g0010541mg, partial [Citrus sinensis]
Length=238

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 8/60 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFD-YPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ  +L+ETASQPDTG DAYTF+EFNT GE +FD YP+F+       P +WPTPSDSL
Sbjct  1    MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRS------PVSWPTPSDSL  54



>gb|KFK31413.1| hypothetical protein AALP_AA6G108800 [Arabis alpina]
Length=1247

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++TASQPDT  DAYTF+EFNT G+ EFDYP+F+       P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTASQPDTVADAYTFLEFNTQGDSEFDYPEFRS------PTAWPTPSDSI  53



>ref|XP_006398395.1| hypothetical protein EUTSA_v10000743mg [Eutrema salsugineum]
 gb|ESQ39848.1| hypothetical protein EUTSA_v10000743mg [Eutrema salsugineum]
Length=1202

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL+ETASQPDT  DAYTF+EFN+ G+ EFDYP+F+       P+AWPTPSDS+
Sbjct  1    MDSQQSDLFETASQPDTVPDAYTFLEFNSQGDSEFDYPEFRS------PTAWPTPSDSI  53



>ref|XP_006436833.1| hypothetical protein CICLE_v10033615mg, partial [Citrus clementina]
 gb|ESR50073.1| hypothetical protein CICLE_v10033615mg, partial [Citrus clementina]
Length=873

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 8/60 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFD-YPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ  +L+ETASQPDTG DAYTF+EFNT GE +FD YP+F+       P +WPTPSDSL
Sbjct  1    MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRS------PVSWPTPSDSL  54



>ref|XP_002865151.1| low-level beta-amylase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41410.1| low-level beta-amylase 1 [Arabidopsis lyrata subsp. lyrata]
Length=1253

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++TASQPD   DAYTF+EFNT G+ EFDYP+F+       P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTASQPDAVADAYTFLEFNTQGDSEFDYPEFRS------PTAWPTPSDSI  53



>ref|XP_006485359.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Citrus 
sinensis]
Length=1274

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 8/60 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFD-YPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ  +L+ETASQPDTG DAYTF+EFNT GE +FD YP+F+       P +WPTPSDSL
Sbjct  1    MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRS------PVSWPTPSDSL  54



>ref|XP_002528794.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis]
 gb|EEF33616.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis]
Length=1280

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 7/55 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTP  346
            MDS+ ++LYETASQPDTG DAYTF+EFNT GE +FDYP+F+       P AWPTP
Sbjct  1    MDSEQSNLYETASQPDTGTDAYTFLEFNTQGESDFDYPEFRS------PVAWPTP  49



>gb|KDP45961.1| hypothetical protein JCGZ_11864 [Jatropha curcas]
Length=1270

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 7/55 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTP  346
            MDS+ ++LYETASQPDTG DAYTF+EFNT GE +FDYP+F+       P AWPTP
Sbjct  1    MDSEQSNLYETASQPDTGTDAYTFLEFNTQGESDFDYPEFRS------PVAWPTP  49



>emb|CDY43638.1| BnaC02g33040D [Brassica napus]
Length=1216

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++TASQPDT  DAYTF+EFN+ G+ EFD+P+F+       P+AWPTPSDS+
Sbjct  1    MDSQPSDLFDTASQPDTAVDAYTFLEFNSQGDSEFDFPEFRS------PNAWPTPSDSI  53



>ref|XP_009128922.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Brassica 
rapa]
 emb|CDY37170.1| BnaA02g24890D [Brassica napus]
Length=1221

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++TASQPDT  DAYTF+EFN+ G+ EFD+P+F+       P+AWPTPSDS+
Sbjct  1    MDSQPSDLFDTASQPDTAVDAYTFLEFNSQGDSEFDFPEFRS------PNAWPTPSDSI  53



>ref|XP_009397656.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=1268

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWP  340
             N+LYETASQPDT  DAYTF+EFNT  E  DYP F+ELSQP R +AWP
Sbjct  6    VNNLYETASQPDTSGDAYTFLEFNTQDEFDDYPAFRELSQPSRSTAWP  53



>ref|XP_009398577.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=1233

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAW  337
             N+LYETASQPDT  DAYTF+EFNT  +  DYP+FQELSQP R +AW
Sbjct  6    VNNLYETASQPDTSGDAYTFLEFNTQDDFDDYPEFQELSQPSRSTAW  52



>ref|XP_009398576.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=1234

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAW  337
             N+LYETASQPDT  DAYTF+EFNT  +  DYP+FQELSQP R +AW
Sbjct  6    VNNLYETASQPDTSGDAYTFLEFNTQDDFDDYPEFQELSQPSRSTAW  52



>ref|XP_009398575.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1268

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAW  337
             N+LYETASQPDT  DAYTF+EFNT  +  DYP+FQELSQP R +AW
Sbjct  6    VNNLYETASQPDTSGDAYTFLEFNTQDDFDDYPEFQELSQPSRSTAW  52



>ref|XP_009398574.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1269

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAW  337
             N+LYETASQPDT  DAYTF+EFNT  +  DYP+FQELSQP R +AW
Sbjct  6    VNNLYETASQPDTSGDAYTFLEFNTQDDFDDYPEFQELSQPSRSTAW  52



>ref|NP_199512.2| Regulator of nonsense transcripts 1-like protein [Arabidopsis 
thaliana]
 sp|Q9FJR0.2|RENT1_ARATH RecName: Full=Regulator of nonsense transcripts 1 homolog; AltName: 
Full=ATP-dependent helicase UPF1 [Arabidopsis thaliana]
 gb|AED95457.1| Regulator of nonsense transcripts 1-like protein [Arabidopsis 
thaliana]
Length=1254

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++TASQPDT  D YTF+EFNT G+ EFDY DF        P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTASQPDTVADEYTFLEFNTQGDSEFDYQDFGS------PTAWPTPSDSI  53



>dbj|BAB10240.1| prematurely terminated mRNA decay factor-like protein [Arabidopsis 
thaliana]
Length=1235

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++TASQPDT  D YTF+EFNT G+ EFDY DF        P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTASQPDTVADEYTFLEFNTQGDSEFDYQDFGS------PTAWPTPSDSI  53



>ref|XP_010445773.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Camelina 
sativa]
Length=1072

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++T SQPDT  DAY F+EF+T G+ EFDYP+F        P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTVSQPDTVADAYNFLEFDTQGDSEFDYPEFGS------PTAWPTPSDSI  53



>ref|XP_011018658.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Populus 
euphratica]
Length=1266

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 7/55 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTP  346
            MD+Q N LYETASQPDT  DAYTF+EFNT GE +FDYP+F+       P  WPTP
Sbjct  1    MDAQDNSLYETASQPDTATDAYTFLEFNTQGESDFDYPEFRS------PVNWPTP  49



>ref|XP_010481386.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Camelina 
sativa]
Length=1248

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++T SQPDT  DAY F+EF+T G+ EFDYP+F        P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTVSQPDTVADAYNFLEFDTQGDSEFDYPEFGS------PTAWPTPSDSI  53



>ref|XP_010494909.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Camelina 
sativa]
Length=1248

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDSQ +DL++T SQPDT  DAY F+EF+T G+ EFDYP+F        P+AWPTPSDS+
Sbjct  1    MDSQQSDLFDTVSQPDTVADAYNFLEFDTQGDSEFDYPEFGS------PTAWPTPSDSI  53



>dbj|BAD30435.1| putative type 1 RNA helicase [Oryza sativa Japonica Group]
 gb|EEE67210.1| hypothetical protein OsJ_24327 [Oryza sativa Japonica Group]
Length=1277

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 5/55 (9%)
 Frame = +2

Query  191  SQANDLYETASQPD----TGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPT  343
            S A DLYETASQPD       DAYTF+EFNT G++FDYPDF ELSQP R SA PT
Sbjct  9    SAAADLYETASQPDPPASAAGDAYTFLEFNTQGDDFDYPDFPELSQPAR-SAPPT  62



>gb|EEC82084.1| hypothetical protein OsI_26082 [Oryza sativa Indica Group]
Length=1277

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +2

Query  200  NDLYETASQPD----TGNDAYTFVEFNTPGEEFDYPDFQELSQPIRPSAWPT  343
            +DLYETASQPD       DAYTF+EFNT G++FDYPDF+ELSQP R SA PT
Sbjct  12   DDLYETASQPDPPASAAGDAYTFLEFNTQGDDFDYPDFRELSQPAR-SAPPT  62



>tpg|DAA62798.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1205

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPD--TGNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A D+YETASQPD     DAYTF+EFNT G+EFDYPDF ELSQP
Sbjct  12   AIDMYETASQPDASVAGDAYTFLEFNTQGDEFDYPDFPELSQP  54



>ref|XP_008651594.1| PREDICTED: uncharacterized protein LOC100304236 isoform X1 [Zea 
mays]
 tpg|DAA62796.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1273

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPD--TGNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A D+YETASQPD     DAYTF+EFNT G+EFDYPDF ELSQP
Sbjct  12   AIDMYETASQPDASVAGDAYTFLEFNTQGDEFDYPDFPELSQP  54



>ref|XP_008651595.1| PREDICTED: uncharacterized protein LOC100304236 isoform X2 [Zea 
mays]
 tpg|DAA62797.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1272

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPD--TGNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A D+YETASQPD     DAYTF+EFNT G+EFDYPDF ELSQP
Sbjct  12   AIDMYETASQPDASVAGDAYTFLEFNTQGDEFDYPDFPELSQP  54



>tpg|DAA40908.1| TPA: hypothetical protein ZEAMMB73_069756 [Zea mays]
Length=726

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = +2

Query  191  SQANDLYETASQPDT--GNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            + A DLYETASQPD     DAYTF+EFNT G++FDYPDF ELSQP
Sbjct  10   TAAVDLYETASQPDAPAAGDAYTFLEFNTQGDDFDYPDFPELSQP  54



>ref|XP_008651597.1| PREDICTED: uncharacterized protein LOC100304236 isoform X4 [Zea 
mays]
 tpg|DAA62799.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1251

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPD--TGNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A D+YETASQPD     DAYTF+EFNT G+EFDYPDF ELSQP
Sbjct  12   AIDMYETASQPDASVAGDAYTFLEFNTQGDEFDYPDFPELSQP  54



>ref|XP_008651596.1| PREDICTED: uncharacterized protein LOC100304236 isoform X3 [Zea 
mays]
Length=1252

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPD--TGNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A D+YETASQPD     DAYTF+EFNT G+EFDYPDF ELSQP
Sbjct  12   AIDMYETASQPDASVAGDAYTFLEFNTQGDEFDYPDFPELSQP  54



>ref|XP_006282104.1| hypothetical protein CARUB_v10028351mg [Capsella rubella]
 gb|EOA15002.1| hypothetical protein CARUB_v10028351mg [Capsella rubella]
Length=1252

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            MDS+ NDL++TASQPD   DAYTF++F T G+ EFDYP+F+       P+ W TPSDS+
Sbjct  1    MDSEENDLFDTASQPDAVADAYTFLDFETQGDSEFDYPEFRS------PTVWLTPSDSI  53



>tpg|DAA40909.1| TPA: hypothetical protein ZEAMMB73_069756 [Zea mays]
Length=889

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = +2

Query  191  SQANDLYETASQPDT--GNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            + A DLYETASQPD     DAYTF+EFNT G++FDYPDF ELSQP
Sbjct  10   TAAVDLYETASQPDAPAAGDAYTFLEFNTQGDDFDYPDFPELSQP  54



>ref|XP_008668400.1| PREDICTED: uncharacterized protein LOC100383288 isoform X2 [Zea 
mays]
Length=1273

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPDT--GNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A DLYETASQPD     DAYTF+EFNT G++FDYPDF ELSQP
Sbjct  12   AVDLYETASQPDAPAAGDAYTFLEFNTQGDDFDYPDFPELSQP  54



>ref|XP_008668399.1| PREDICTED: uncharacterized protein LOC100383288 isoform X1 [Zea 
mays]
Length=1274

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPDT--GNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A DLYETASQPD     DAYTF+EFNT G++FDYPDF ELSQP
Sbjct  12   AVDLYETASQPDAPAAGDAYTFLEFNTQGDDFDYPDFPELSQP  54



>ref|XP_002460731.1| hypothetical protein SORBIDRAFT_02g033940 [Sorghum bicolor]
 gb|EER97252.1| hypothetical protein SORBIDRAFT_02g033940 [Sorghum bicolor]
Length=1269

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  197  ANDLYETASQPDT--GNDAYTFVEFNTPGEEFDYPDFQELSQP  319
            A DLYETASQPD     DAYTF+EFNT G++FDYPDF ELSQP
Sbjct  12   AVDLYETASQPDAPAAGDAYTFLEFNTQGDDFDYPDFPELSQP  54



>ref|XP_003563076.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Brachypodium 
distachyon]
Length=1267

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 4/47 (9%)
 Frame = +2

Query  197  ANDLYETASQPD----TGNDAYTFVEFNTPGEEFDYPDFQELSQPIR  325
            A DLYETASQPD       DAYTF+EFNT G++F+YPDF ELSQP R
Sbjct  11   AADLYETASQPDPSASAAGDAYTFLEFNTQGDDFEYPDFPELSQPAR  57



>ref|XP_010677214.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Beta 
vulgaris subsp. vulgaris]
Length=1292

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 6/48 (13%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGN-DAYTFVEFNTPG-----EEFDYPDFQEL  310
            MDS AN+LYETASQPDTGN DAYTF+EFNT G     ++F YP F EL
Sbjct  1    MDSNANNLYETASQPDTGNDDAYTFLEFNTQGGGDEDDDFSYPQFNEL  48



>ref|XP_006858514.1| hypothetical protein AMTR_s00071p00142490 [Amborella trichopoda]
 gb|ERN19981.1| hypothetical protein AMTR_s00071p00142490 [Amborella trichopoda]
Length=1252

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +2

Query  197  ANDLYETASQPDTGNDAYTFVEFNTPGEEFDYPDFQELSQ  316
             +++YETASQPDTG DAYTF+EFNT G++FDYPDF+E++Q
Sbjct  7    VSNMYETASQPDTG-DAYTFLEFNTQGDDFDYPDFREVNQ  45



>gb|KJB25398.1| hypothetical protein B456_004G189700 [Gossypium raimondii]
Length=1223

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDS  355
            MDSQ    YETASQPD   DAYTF+EFNT GE +F+Y DF++   PIR  +WPTPSD+
Sbjct  1    MDSQ----YETASQPDPATDAYTFLEFNTQGESDFEYTDFRD---PIR--SWPTPSDA  49



>gb|KJB25396.1| hypothetical protein B456_004G189700 [Gossypium raimondii]
Length=1263

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDS  355
            MDSQ    YETASQPD   DAYTF+EFNT GE +F+Y DF++   PIR  +WPTPSD+
Sbjct  1    MDSQ----YETASQPDPATDAYTFLEFNTQGESDFEYTDFRD---PIR--SWPTPSDA  49



>gb|KJB25397.1| hypothetical protein B456_004G189700 [Gossypium raimondii]
Length=1192

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDS  355
            MDSQ    YETASQPD   DAYTF+EFNT GE +F+Y DF++   PIR  +WPTPSD+
Sbjct  1    MDSQ----YETASQPDPATDAYTFLEFNTQGESDFEYTDFRD---PIR--SWPTPSDA  49



>gb|KHF99302.1| Regulator of nonsense transcripts 1 -like protein [Gossypium 
arboreum]
Length=1262

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDS  355
            MDSQ    +ETASQPD   DAYTF+EFNT GE +F+Y DF++   PIR  +WPTPSD+
Sbjct  1    MDSQ----FETASQPDPATDAYTFLEFNTQGESDFEYTDFRD---PIR--SWPTPSDA  49



>gb|KJB21033.1| hypothetical protein B456_003G179500 [Gossypium raimondii]
Length=1262

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 10/60 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ    ++TASQPD   DAYTF+EFNT GE +F+Y DF++   PIR  +WPTPSD+ V
Sbjct  1    MDSQ----FDTASQPDPATDAYTFLEFNTQGESDFEYTDFRD---PIR--SWPTPSDATV  51



>ref|XP_004957770.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Setaria 
italica]
Length=1277

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 4/42 (10%)
 Frame = +2

Query  203  DLYETASQPD----TGNDAYTFVEFNTPGEEFDYPDFQELSQ  316
            DLYETASQPD       DAYTF+EFNT G++FDYPDF ELSQ
Sbjct  17   DLYETASQPDPSASAAGDAYTFLEFNTQGDDFDYPDFPELSQ  58



>gb|KHG18592.1| Regulator of nonsense transcripts 1 -like protein [Gossypium 
arboreum]
Length=1236

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 10/60 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSLV  361
            MDSQ    ++TASQPD   DAYTF+EFNT GE +F+Y DF++   PIR  +WPTPSD+ V
Sbjct  1    MDSQ----FDTASQPDPATDAYTFLEFNTQGESDFEYGDFRD---PIR--SWPTPSDATV  51



>ref|XP_007039605.1| Regulator of nonsense transcripts 1 [Theobroma cacao]
 gb|EOY24106.1| Regulator of nonsense transcripts 1 [Theobroma cacao]
Length=1266

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 10/58 (17%)
 Frame = +2

Query  185  MDSQANDLYETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDS  355
            MDSQ    +ETASQPD   DAYTF+EFNT GE +F+Y DF++    IR  +WPTPSD+
Sbjct  1    MDSQ----FETASQPDPATDAYTFLEFNTQGESDFEYTDFRDT---IR--SWPTPSDT  49



>gb|AAL92018.1| UPF1 [Arabidopsis thaliana]
Length=1243

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 7/48 (15%)
 Frame = +2

Query  218  ASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDSL  358
            ASQPDT  D YTF+EFNT G+ EFDY DF        P+AWPTPSDS+
Sbjct  1    ASQPDTVADEYTFLEFNTQGDSEFDYQDFGS------PTAWPTPSDSI  42



>gb|KHG01127.1| Regulator of nonsense transcripts 1 -like protein [Gossypium 
arboreum]
Length=1215

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 6/50 (12%)
 Frame = +2

Query  209  YETASQPDTGNDAYTFVEFNTPGE-EFDYPDFQELSQPIRPSAWPTPSDS  355
            +ETASQPD   DAYTF+EFNT  E +F Y DF++   PI   +WPTP D+
Sbjct  5    FETASQPDPATDAYTFLEFNTQLESDFGYTDFRD---PI--CSWPTPYDA  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800