BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014O14

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765278.1|  PREDICTED: uncharacterized protein LOC104216...    198   1e-57   Nicotiana sylvestris
ref|XP_009765281.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    196   1e-57   Nicotiana sylvestris
ref|XP_009610506.1|  PREDICTED: uncharacterized protein LOC104104...    194   4e-56   Nicotiana tomentosiformis
ref|XP_009610509.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    192   4e-56   Nicotiana tomentosiformis
ref|XP_006351347.1|  PREDICTED: uncharacterized protein LOC102597...    185   1e-52   Solanum tuberosum [potatoes]
ref|XP_006351348.1|  PREDICTED: uncharacterized protein LOC102597...    183   3e-52   Solanum tuberosum [potatoes]
ref|XP_004249287.1|  PREDICTED: uncharacterized protein LOC101263558    177   1e-49   
gb|KDP40599.1|  hypothetical protein JCGZ_24598                         153   6e-41   Jatropha curcas
emb|CBI29160.3|  unnamed protein product                                137   1e-34   Vitis vinifera
emb|CDP10151.1|  unnamed protein product                                135   3e-34   Coffea canephora [robusta coffee]
gb|ABK96344.1|  unknown                                                 130   1e-32   Populus trichocarpa x Populus deltoides
ref|XP_002304823.2|  hypothetical protein POPTR_0003s18860g             130   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011020515.1|  PREDICTED: uncharacterized protein LOC105122866    130   2e-32   Populus euphratica
gb|KDO48650.1|  hypothetical protein CISIN_1g0162582mg                  124   1e-31   Citrus sinensis [apfelsine]
ref|XP_002276838.1|  PREDICTED: uncharacterized protein LOC100262520    127   2e-31   Vitis vinifera
ref|XP_008445920.1|  PREDICTED: uncharacterized protein LOC103488802    127   5e-31   Cucumis melo [Oriental melon]
ref|XP_011075114.1|  PREDICTED: uncharacterized protein LOC105159...    125   1e-30   Sesamum indicum [beniseed]
ref|XP_010504239.1|  PREDICTED: uncharacterized protein LOC104781301    126   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006432513.1|  hypothetical protein CICLE_v10001427mg             125   1e-30   Citrus clementina [clementine]
ref|XP_006291209.1|  hypothetical protein CARUB_v10017338mg             125   2e-30   Capsella rubella
ref|XP_011034631.1|  PREDICTED: uncharacterized protein LOC105132695    124   3e-30   Populus euphratica
ref|XP_011075118.1|  PREDICTED: uncharacterized protein LOC105159...    123   3e-30   Sesamum indicum [beniseed]
ref|XP_010427133.1|  PREDICTED: uncharacterized protein LOC104712035    124   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010067651.1|  PREDICTED: uncharacterized protein LOC104454492    124   4e-30   Eucalyptus grandis [rose gum]
gb|KCW65831.1|  hypothetical protein EUGRSUZ_G03178                     124   4e-30   Eucalyptus grandis [rose gum]
ref|XP_004147090.1|  PREDICTED: uncharacterized protein LOC101210945    124   4e-30   Cucumis sativus [cucumbers]
gb|KCW65832.1|  hypothetical protein EUGRSUZ_G03178                     122   5e-30   Eucalyptus grandis [rose gum]
ref|XP_002525579.1|  ubiquitin-protein ligase, putative                 123   1e-29   Ricinus communis
emb|CDX78232.1|  BnaA09g34270D                                          122   3e-29   
ref|XP_010515962.1|  PREDICTED: uncharacterized protein LOC104791708    122   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009116123.1|  PREDICTED: uncharacterized protein LOC103841350    122   3e-29   Brassica rapa
ref|XP_002877973.1|  binding protein                                    121   6e-29   
ref|NP_191004.1|  zinc ion binding protein                              120   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002297702.1|  hypothetical protein POPTR_0001s07350g             120   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008782756.1|  PREDICTED: uncharacterized protein LOC103702200    120   1e-28   Phoenix dactylifera
emb|CDX67597.1|  BnaA07g16370D                                          119   2e-28   
emb|CDX73486.1|  BnaC08g25170D                                          119   2e-28   
ref|XP_006403583.1|  hypothetical protein EUTSA_v10010421mg             119   2e-28   Eutrema salsugineum [saltwater cress]
gb|EYU39947.1|  hypothetical protein MIMGU_mgv1a009191mg                119   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_009103916.1|  PREDICTED: uncharacterized protein LOC103829975    117   1e-27   Brassica rapa
gb|ACU19631.1|  unknown                                                 113   2e-27   Glycine max [soybeans]
ref|XP_003522869.1|  PREDICTED: uncharacterized protein LOC100813...    115   6e-27   Glycine max [soybeans]
ref|XP_010689828.1|  PREDICTED: uncharacterized protein LOC104903488    114   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007148770.1|  hypothetical protein PHAVU_005G012800g             112   4e-26   Phaseolus vulgaris [French bean]
gb|KJB67761.1|  hypothetical protein B456_010G208800                    112   9e-26   Gossypium raimondii
gb|KHF99857.1|  E3 ubiquitin-protein ligase CHFR                        111   1e-25   Gossypium arboreum [tree cotton]
ref|XP_010921286.1|  PREDICTED: uncharacterized protein LOC105044901    111   2e-25   Elaeis guineensis
ref|XP_004516522.1|  PREDICTED: uncharacterized protein LOC101498396    110   2e-25   Cicer arietinum [garbanzo]
ref|XP_007010628.1|  Zinc ion binding                                   110   3e-25   
ref|XP_003527531.1|  PREDICTED: uncharacterized protein LOC100813844    109   6e-25   Glycine max [soybeans]
gb|ACU21424.1|  unknown                                                 106   7e-25   Glycine max [soybeans]
gb|KHN26422.1|  Polycomb complex protein BMI-1                          108   1e-24   Glycine soja [wild soybean]
gb|KEH32916.1|  zinc ion-binding protein, putative                      108   1e-24   Medicago truncatula
ref|XP_010533372.1|  PREDICTED: uncharacterized protein LOC104809184    108   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_010938114.1|  PREDICTED: uncharacterized protein LOC105057...    108   2e-24   
gb|KEH32917.1|  zinc ion-binding protein, putative                      107   4e-24   Medicago truncatula
ref|XP_010938116.1|  PREDICTED: uncharacterized protein LOC105057...    107   4e-24   
ref|XP_010091318.1|  E3 ubiquitin-protein ligase CHFR                   105   2e-23   
ref|XP_010276468.1|  PREDICTED: uncharacterized protein LOC104611195    103   6e-23   Nelumbo nucifera [Indian lotus]
emb|CDM81302.1|  unnamed protein product                                103   1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009420238.1|  PREDICTED: uncharacterized protein LOC104000028    103   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793368.1|  PREDICTED: uncharacterized protein LOC103709685    102   3e-22   
ref|XP_010554493.1|  PREDICTED: uncharacterized protein LOC104824200    100   1e-21   Tarenaya hassleriana [spider flower]
gb|EMS59099.1|  E3 ubiquitin-protein ligase CHFR                        100   4e-21   Triticum urartu
gb|KHN45782.1|  Polycomb complex protein BMI-1-B                      98.6    4e-21   Glycine soja [wild soybean]
ref|XP_008375385.1|  PREDICTED: uncharacterized protein LOC103438629  98.6    5e-21   
gb|EMT10100.1|  E3 ubiquitin-protein ligase CHFR                        100   5e-21   
ref|XP_003559441.1|  PREDICTED: uncharacterized protein LOC100832811  98.2    7e-21   Brachypodium distachyon [annual false brome]
ref|XP_008231724.1|  PREDICTED: uncharacterized protein LOC103330891  97.8    9e-21   Prunus mume [ume]
ref|XP_007218231.1|  hypothetical protein PRUPE_ppa007956mg           96.7    2e-20   Prunus persica
ref|XP_006643640.1|  PREDICTED: uncharacterized protein LOC102704921  95.1    7e-20   Oryza brachyantha
ref|XP_004306461.1|  PREDICTED: uncharacterized protein LOC101299030  94.7    9e-20   Fragaria vesca subsp. vesca
dbj|BAJ86803.1|  predicted protein                                    95.1    9e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563481.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...  94.7    1e-19   Brachypodium distachyon [annual false brome]
dbj|BAJ90412.1|  predicted protein                                    94.7    1e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO48653.1|  hypothetical protein CISIN_1g0162582mg                90.9    1e-19   Citrus sinensis [apfelsine]
ref|XP_004978719.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...  94.4    2e-19   Setaria italica
ref|XP_006829771.1|  hypothetical protein AMTR_s00119p00030390        92.8    2e-19   
gb|EEC69773.1|  hypothetical protein OsI_00037                        94.4    2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001041762.2|  Os01g0104100                                     92.4    6e-19   
ref|XP_001754304.1|  predicted protein                                92.4    6e-19   
gb|EPS69962.1|  hypothetical protein M569_04796                       90.1    3e-18   Genlisea aurea
ref|XP_002444897.1|  hypothetical protein SORBIDRAFT_07g001060        86.7    1e-16   Sorghum bicolor [broomcorn]
ref|XP_002981629.1|  hypothetical protein SELMODRAFT_154638           85.9    1e-16   Selaginella moellendorffii
gb|ACG25350.1|  hypothetical protein                                  84.7    3e-16   Zea mays [maize]
ref|NP_001048384.1|  Os02g0795300                                     84.7    3e-16   
ref|NP_001140913.1|  LOC100272990                                     84.7    4e-16   Zea mays [maize]
ref|XP_004967927.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...  84.7    4e-16   Setaria italica
gb|EEC74169.1|  hypothetical protein OsI_09273                        83.6    4e-15   Oryza sativa Indica Group [Indian rice]
gb|KJB73245.1|  hypothetical protein B456_011G224300                  68.6    7e-11   Gossypium raimondii
gb|KJB73244.1|  hypothetical protein B456_011G224300                  67.8    8e-11   Gossypium raimondii
ref|XP_011402355.1|  hypothetical protein F751_5740                   63.2    2e-08   Auxenochlorella protothecoides
gb|AFW74750.1|  hypothetical protein ZEAMMB73_787325                  58.2    1e-07   
emb|CDY07544.1|  BnaC06g15200D                                        58.9    2e-07   Brassica napus [oilseed rape]
dbj|BAH20367.1|  AT3G54360                                            53.1    2e-05   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009765278.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765279.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765280.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 113/151 (75%), Gaps = 9/151 (6%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  308
            M PVCPFV+A+RPDD S+KKPGE+Q+KQ    E KPKQESGE A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSIKKPGENQNKQPASQESKPKQESGESAIVSPKCPFGY----GQ  56

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
            E KP + SGE A  S +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ETKPKEASGESAVASPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SCMICQALLYDCSRCVPCSHVFCK C++RFK
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLSRFK  143



>ref|XP_009765281.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
sylvestris]
Length=347

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 113/151 (75%), Gaps = 9/151 (6%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  308
            M PVCPFV+A+RPDD S+KKPGE+Q+KQ    E KPKQESGE A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSIKKPGENQNKQPASQESKPKQESGESAIVSPKCPFGY----GQ  56

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
            E KP + SGE A  S +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ETKPKEASGESAVASPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SCMICQALLYDCSRCVPCSHVFCK C++RFK
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLSRFK  143



>ref|XP_009610506.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610507.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610508.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
Length=409

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 111/151 (74%), Gaps = 9/151 (6%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  308
            M PVCPFV+A+RPDD S KKPGE+Q+KQ    E KPKQES E A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSTKKPGENQNKQPASQESKPKQESRESAIVSPKCPFGY----GQ  56

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
            E KP + SGE A VS +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ESKPKEASGESAVVSPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SCMICQALLYDCSRCVPCSHVFCK C+ RFK
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLLRFK  143



>ref|XP_009610509.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
tomentosiformis]
Length=347

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 111/151 (74%), Gaps = 9/151 (6%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  308
            M PVCPFV+A+RPDD S KKPGE+Q+KQ    E KPKQES E A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSTKKPGENQNKQPASQESKPKQESRESAIVSPKCPFGY----GQ  56

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
            E KP + SGE A VS +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ESKPKEASGESAVVSPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SCMICQALLYDCSRCVPCSHVFCK C+ RFK
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLLRFK  143



>ref|XP_006351347.1| PREDICTED: uncharacterized protein LOC102597556 isoform X1 [Solanum 
tuberosum]
Length=415

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 110/162 (68%), Gaps = 19/162 (12%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-------  290
            M PVCPF  A+RPDDA++ KP +   +Q     +PK+ESGE A V  KCPF +       
Sbjct  1    MIPVCPFAGASRPDDATLNKPHDENKQQA----QPKKESGEAATVSPKCPFGYDSTLKKP  56

Query  291  -----KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLG  455
                 KQQ G E KP Q+SGE A VS KCPFGY    G E+KPKQ S +   MSPKCP G
Sbjct  57   CDDQNKQQDGQESKPKQDSGESATVSPKCPFGYD---GQESKPKQDSGESATMSPKCPFG  113

Query  456  FDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            +DSQ FKLGP SCMICQALLYD SRCVPCSHVFCK C++RFK
Sbjct  114  YDSQAFKLGPFSCMICQALLYDSSRCVPCSHVFCKACLSRFK  155



>ref|XP_006351348.1| PREDICTED: uncharacterized protein LOC102597556 isoform X2 [Solanum 
tuberosum]
Length=400

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 107/150 (71%), Gaps = 10/150 (7%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            M PVCPF  A+RPDDA++ KP +   +Q     +PK+ESGE A V  KCPF +    G E
Sbjct  1    MIPVCPFAGASRPDDATLNKPHDENKQQA----QPKKESGEAATVSPKCPFGYD---GQE  53

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             KP Q+SGE A VS KCPFGY    G E+KPKQ S +   MSPKCP G+DSQ FKLGP S
Sbjct  54   SKPKQDSGESATVSPKCPFGYD---GQESKPKQDSGESATMSPKCPFGYDSQAFKLGPFS  110

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALLYD SRCVPCSHVFCK C++RFK
Sbjct  111  CMICQALLYDSSRCVPCSHVFCKACLSRFK  140



>ref|XP_004249287.1| PREDICTED: uncharacterized protein LOC101263558 [Solanum lycopersicum]
Length=443

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 115/184 (63%), Gaps = 35/184 (19%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-------  290
            M PVCPF  A+RPDDA++ KP + ++KQ     KPK+ESGE A V  KCPF +       
Sbjct  1    MIPVCPFAGASRPDDATLNKPYD-ENKQQAQESKPKKESGEVATVSPKCPFGYDSTLKKP  59

Query  291  -----KQQAGSEIKPNQESGEQAKVSSKCPFGYT-QEA---------------------G  389
                 KQQ G E KP Q+SGE A VS KCPFGY  QE+                     G
Sbjct  60   CDDQNKQQDGQESKPKQDSGESATVSPKCPFGYDGQESKPKQDSGESATVSPKCPFGYDG  119

Query  390  GENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCI  569
             ++KPKQ S +   MSPKCP G+DSQ FKLGP SCMICQALLY+ SRCVPCSHVFCK C+
Sbjct  120  QKSKPKQDSGESATMSPKCPFGYDSQAFKLGPFSCMICQALLYESSRCVPCSHVFCKACL  179

Query  570  TRFK  581
            +RFK
Sbjct  180  SRFK  183



>gb|KDP40599.1| hypothetical protein JCGZ_24598 [Jatropha curcas]
Length=393

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 103/153 (67%), Gaps = 27/153 (18%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE--KPKQESGEPAMV-PSKCPFVHKQQA  302
            MTPVCPFVKAARPDD+S+KKPGE+ SK HG     K K++SG+ A   P+KCPF +    
Sbjct  1    MTPVCPFVKAARPDDSSLKKPGENPSK-HGAEHDGKGKKDSGDSATASPAKCPFGY----  55

Query  303  GSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  482
                       + A  S KCP GY   +         S K G +SPKCPLG+DSQ+FK+G
Sbjct  56   -----------DSANASPKCPVGYDSAS--------TSPKSGSISPKCPLGYDSQSFKIG  96

Query  483  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            PLSC++CQALL++ S+CVPCSHVFCK CI+RF+
Sbjct  97   PLSCILCQALLFESSKCVPCSHVFCKACISRFR  129



>emb|CBI29160.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 89/156 (57%), Gaps = 45/156 (29%)
 Frame = +3

Query  114  HGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHK  293
            H LLIKMTPVCPFVKAARPDDA+ +KP E                         CP  HK
Sbjct  20   HVLLIKMTPVCPFVKAARPDDATSRKPNE-------------------------CP--HK  52

Query  294  QQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTF  473
             Q   E K  ++SG+ A                    K+ S     +SPKCP G+DSQTF
Sbjct  53   HQLELEGKGKKDSGDSAST------------------KKDSVDAASISPKCPFGYDSQTF  94

Query  474  KLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            KLGPLSCMICQALL++ S+CVPCSHV+CK CI+RFK
Sbjct  95   KLGPLSCMICQALLFESSKCVPCSHVYCKACISRFK  130



>emb|CDP10151.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 85/153 (56%), Gaps = 50/153 (33%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MT VCPF KA RPDDA+VKK  E+QSK                                 
Sbjct  1    MTTVCPFAKAGRPDDAAVKKCPENQSK---------------------------------  27

Query  312  IKPNQESGEQAKVSSKCPFGY---TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  482
                          SKCPFGY   T  AG E+KP+Q S +   ++PKCP G+DS TFKLG
Sbjct  28   --------------SKCPFGYDSATSAAGNESKPEQESGESARVTPKCPFGYDSDTFKLG  73

Query  483  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            P SCMICQALL+DCS+C+PCSHV+CKVCI R K
Sbjct  74   PFSCMICQALLFDCSKCIPCSHVYCKVCILRLK  106



>gb|ABK96344.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 88/150 (59%), Gaps = 52/150 (35%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKA+RPDD S +KPGE                         CP  H    G+E
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH----GAE  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                 E G +AK          +E+GGE+           +SPKCP G+DSQTFKLGPLS
Sbjct  32   ----HEGGGKAK----------KESGGES---------ATVSPKCPFGYDSQTFKLGPLS  68

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DCS+CVPCSHV+CKVCI+RFK
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFK  98



>ref|XP_002304823.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
 gb|EEE79802.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
Length=371

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 88/150 (59%), Gaps = 52/150 (35%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKA+RPDD S +KPGE                         CP  H    G+E
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH----GAE  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                 E G +AK          +E+GGE+           +SPKCP G+DSQTFKLGPLS
Sbjct  32   ----HEGGGKAK----------KESGGES---------ATVSPKCPFGYDSQTFKLGPLS  68

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DCS+CVPCSHV+CKVCI+RFK
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFK  98



>ref|XP_011020515.1| PREDICTED: uncharacterized protein LOC105122866 [Populus euphratica]
Length=363

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 83/150 (55%), Gaps = 52/150 (35%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKA+RPDD S +KPGE                         CP  H       
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH-------  28

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                               G   E GG+ K K+ S +   +SPKCP G+DSQTFKLGPLS
Sbjct  29   -------------------GAEHEGGGKAK-KESSGESATVSPKCPFGYDSQTFKLGPLS  68

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DCS+CVPCSHV+CKVCI+RFK
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFK  98



>gb|KDO48650.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
 gb|KDO48651.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
 gb|KDO48652.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
Length=192

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 29/150 (19%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPF KA RPDDAS +KPGE+ +K                  P++CPF       S+
Sbjct  1    MTPVCPFAKA-RPDDASPRKPGENSNK-----------------YPAECPF-------SK  35

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             +P+  +  +A  +S  P    Q     +K K  S     + PKCP G+D+Q+FK+GPLS
Sbjct  36   ARPDDAASRKAVENSAKP----QAEHDGDKAKSDSMDSASIPPKCPFGYDAQSFKIGPLS  91

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL++CS+C PCSHV+CK CI+RFK
Sbjct  92   CMICQALLFECSKCTPCSHVYCKACISRFK  121



>ref|XP_002276838.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659029.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659030.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659031.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
Length=369

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 84/150 (56%), Gaps = 45/150 (30%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKAARPDDA+ +KP E                         CP  HK Q   E
Sbjct  1    MTPVCPFVKAARPDDATSRKPNE-------------------------CP--HKHQLELE  33

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             K  ++SG+ A                    K+ S     +SPKCP G+DSQTFKLGPLS
Sbjct  34   GKGKKDSGDSAST------------------KKDSVDAASISPKCPFGYDSQTFKLGPLS  75

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL++ S+CVPCSHV+CK CI+RFK
Sbjct  76   CMICQALLFESSKCVPCSHVYCKACISRFK  105



>ref|XP_008445920.1| PREDICTED: uncharacterized protein LOC103488802 [Cucumis melo]
Length=404

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 89/160 (56%), Gaps = 36/160 (23%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKK-PGESQ-------SKQHGGSEKPKQESGEPAMVPSKCPFV  287
            MTPVCPFVK+ARPDDAS +K  GES              S KP+ ES         CPF 
Sbjct  1    MTPVCPFVKSARPDDASSRKHQGESACPFAKSGRSDDASSRKPQSESA--------CPFS  52

Query  288  H--KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFD  461
               +    S ++ NQ  GE     ++   G    AGG                KCP G+D
Sbjct  53   KSVRSDDASSLEKNQAEGESN--GAEKDVGDAAGAGG----------------KCPFGYD  94

Query  462  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SQTFK+GPLSCMICQALL++CSRCVPCSH+FCK CI+RF 
Sbjct  95   SQTFKIGPLSCMICQALLFECSRCVPCSHIFCKACISRFN  134



>ref|XP_011075114.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075115.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075116.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075117.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
Length=353

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 83/150 (55%), Gaps = 59/150 (39%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPF+KA+RPDDAS KKP E+Q                           +KQQA ++
Sbjct  1    MTPVCPFIKASRPDDASGKKPSENQ---------------------------NKQQAVND  33

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             KP Q+S                                 +SPKCP G+DSQTFKLGPLS
Sbjct  34   NKPQQDSA--------------------------------ISPKCPFGYDSQTFKLGPLS  61

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            C+ICQALL++CS+CVPCSHV+CK CI+RFK
Sbjct  62   CVICQALLFECSKCVPCSHVYCKACISRFK  91



>ref|XP_010504239.1| PREDICTED: uncharacterized protein LOC104781301 [Camelina sativa]
Length=417

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 94/157 (60%), Gaps = 21/157 (13%)
 Frame = +3

Query  135  TPVCPFVKAARPDDAS-VKKPGES-------QSKQHGGSEKPKQESGEPAMVPSKCPFVH  290
            T VCPF KAARPDDAS  +K GE+        SK     +   ++ GE A   S CPF  
Sbjct  3    TSVCPFSKAARPDDASSTRKQGETAASGCPFSSKAARPDDASARKQGETA--ASGCPF--  58

Query  291  KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  470
             + A S+    ++ GE A  S  CP    +E G  NK    S     +  KCP G+DSQT
Sbjct  59   SKSARSDDASARKKGEIA--SKGCP----EEEGKLNKD---STDSATVPAKCPFGYDSQT  109

Query  471  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            FKLGP SCM+CQALLYD SRCVPC+HVFCKVC++RFK
Sbjct  110  FKLGPFSCMLCQALLYDSSRCVPCTHVFCKVCLSRFK  146



>ref|XP_006432513.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006432514.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006471276.1| PREDICTED: uncharacterized protein LOC102626165 [Citrus sinensis]
 gb|ESR45753.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 gb|ESR45754.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
Length=392

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 29/150 (19%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPF KA RPDDAS +KPGE+ +K                  P++CPF       S+
Sbjct  1    MTPVCPFAKA-RPDDASPRKPGENSNK-----------------YPAECPF-------SK  35

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             +P+  +  +A  +S  P    Q     +K K  S     + PKCP G+D+Q+FK+GPLS
Sbjct  36   ARPDDAASRKAVENSAKP----QAEHDGDKAKSDSIDSASIPPKCPFGYDAQSFKIGPLS  91

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL++CS+C PCSHV+CK CI+RFK
Sbjct  92   CMICQALLFECSKCTPCSHVYCKACISRFK  121



>ref|XP_006291209.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
 gb|EOA24107.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
Length=415

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 92/157 (59%), Gaps = 23/157 (15%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQ------SKQHGGSEKPKQESGEPAMVPSKCPFVHKQ  296
            T VCPF KAARPDD S++K GE        SK     +   ++ GE A   S CPF    
Sbjct  3    TSVCPFSKAARPDDVSIRKQGEMNASGCPFSKAARPDDASARKQGETA--ASGCPF----  56

Query  297  QAGSEIKPNQESG-EQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  470
                  +P+  S   Q ++S+K CP    ++ G  NK    S     +  KCP G+DSQT
Sbjct  57   --SKSARPDDASARNQGEISNKGCP----EDEGKLNKD---STDSATVPAKCPFGYDSQT  107

Query  471  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            FKLGP SCM+CQALLY+ SRCVPC+HVFCKVC+ RFK
Sbjct  108  FKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLARFK  144



>ref|XP_011034631.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034632.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034633.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
Length=363

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 80/150 (53%), Gaps = 52/150 (35%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKA+RPDD S +KPGE                         CP  H  +    
Sbjct  1    MTPVCPFVKASRPDDGSSRKPGE-------------------------CPEKHAAE----  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                                   E GG+ K + V     V SPKCP G+DSQTFKLGP S
Sbjct  32   ----------------------HEGGGKAKEESVGASATV-SPKCPFGYDSQTFKLGPHS  68

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DCS+CVPCSHV+CKVCI+RFK
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFK  98



>ref|XP_011075118.1| PREDICTED: uncharacterized protein LOC105159671 isoform X2 [Sesamum 
indicum]
Length=314

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 83/150 (55%), Gaps = 59/150 (39%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPF+KA+RPDDAS KKP E+Q                           +KQQA ++
Sbjct  1    MTPVCPFIKASRPDDASGKKPSENQ---------------------------NKQQAVND  33

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             KP Q+S                                 +SPKCP G+DSQTFKLGPLS
Sbjct  34   NKPQQDSA--------------------------------ISPKCPFGYDSQTFKLGPLS  61

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            C+ICQALL++CS+CVPCSHV+CK CI+RFK
Sbjct  62   CVICQALLFECSKCVPCSHVYCKACISRFK  91



>ref|XP_010427133.1| PREDICTED: uncharacterized protein LOC104712035 [Camelina sativa]
Length=417

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 94/159 (59%), Gaps = 25/159 (16%)
 Frame = +3

Query  135  TPVCPFVKAARPDDAS-VKKPGES-------QSKQHGGSEKPKQESGEPAMVPSKCPFVH  290
            T VCPF KAARPDDAS  +K G+         SK     +   ++ GE A   S CPF  
Sbjct  3    TSVCPFSKAARPDDASSTRKQGDMTASGCPFSSKAARPDDASARKQGETA--ASGCPF--  58

Query  291  KQQAGSEIKPNQESG-EQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDS  464
                    +P+  S  +Q +++SK CP    +E G  NK    S     +  KCP G+DS
Sbjct  59   ----SKSARPDDASARKQGEIASKGCP----EEEGKLNKD---STDSATVPAKCPFGYDS  107

Query  465  QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            QTFKLGP SCM+CQALLYD SRCVPC+HVFCKVC+TRFK
Sbjct  108  QTFKLGPFSCMLCQALLYDSSRCVPCTHVFCKVCLTRFK  146



>ref|XP_010067651.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 ref|XP_010067652.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 gb|KCW65829.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
 gb|KCW65830.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=366

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 86/150 (57%), Gaps = 49/150 (33%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DC++CVPCSHVFCK CI RFK
Sbjct  72   CMICQALLFDCAKCVPCSHVFCKACILRFK  101



>gb|KCW65831.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=396

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 86/150 (57%), Gaps = 49/150 (33%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DC++CVPCSHVFCK CI RFK
Sbjct  72   CMICQALLFDCAKCVPCSHVFCKACILRFK  101



>ref|XP_004147090.1| PREDICTED: uncharacterized protein LOC101210945 [Cucumis sativus]
 ref|XP_004161939.1| PREDICTED: uncharacterized LOC101210945 [Cucumis sativus]
 gb|KGN51585.1| hypothetical protein Csa_5G581690 [Cucumis sativus]
Length=404

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 87/160 (54%), Gaps = 36/160 (23%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKK-PGESQ-------SKQHGGSEKPKQESGEPAMVPSKCPFV  287
            MTPVCPFVK+ARPDDAS +K  GES              S KP+ ES         CP  
Sbjct  1    MTPVCPFVKSARPDDASSRKHQGESACPFAKSGRSDDASSRKPQSESA--------CPVS  52

Query  288  H--KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFD  461
               +    S +K NQ                  EA      K V++  G    KCP G+D
Sbjct  53   KSVRSDDASSLKKNQ-----------------AEAESNGAEKDVADAAGA-GGKCPFGYD  94

Query  462  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SQTFK+GPLSCMICQALL++CSRCVPC+H+FCK CI+RF 
Sbjct  95   SQTFKIGPLSCMICQALLFECSRCVPCTHIFCKACISRFN  134



>gb|KCW65832.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=301

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 84/150 (56%), Gaps = 49/150 (33%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                      A VS KCPFGY                 G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-----------DAPPDSGAISPKCPLGYDSQTFKLGPLS  71

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DC++CVPCSHVFCK CI RFK
Sbjct  72   CMICQALLFDCAKCVPCSHVFCKACILRFK  101



>ref|XP_002525579.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF36838.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=392

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 92/155 (59%), Gaps = 36/155 (23%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKA+RPDD+  KK  E+QSK                         H Q+   E
Sbjct  1    MTPVCPFVKASRPDDSPAKKTSENQSK-------------------------HGQEL--E  33

Query  312  IKPNQES---GEQAKVSS-KCPFGY-TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFK  476
            +K  +ES   G+    +S KCPFGY +  A     PK  +  P     KCPLG+DS++FK
Sbjct  34   LKAKKESCGGGDSVNSNSPKCPFGYDSVNADANASPKSAATIPA----KCPLGYDSRSFK  89

Query  477  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            +GPLSC+ICQALL+D ++CVPC+H+FCK C++ F+
Sbjct  90   IGPLSCIICQALLFDTTKCVPCNHIFCKACVSPFR  124



>emb|CDX78232.1| BnaA09g34270D [Brassica napus]
Length=409

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 89/153 (58%), Gaps = 19/153 (12%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQ---HGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            T VCPF KAARPDDAS  +     +        ++   ++ GE     S CPF       
Sbjct  3    TSVCPFSKAARPDDASAARKQADTTPSACPFSKADASARKQGET--TASACPFS------  54

Query  306  SEIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  482
               K +  + +Q +V+SK CP    +  G  NK +  +     +  KCP G+DSQTFKLG
Sbjct  55   ---KSDASARKQGEVASKGCP----ENEGRVNKEEDSTPDSATVPAKCPFGYDSQTFKLG  107

Query  483  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            P SCM+CQALLYD SRCVPC+HVFCKVC++RFK
Sbjct  108  PFSCMLCQALLYDSSRCVPCTHVFCKVCVSRFK  140



>ref|XP_010515962.1| PREDICTED: uncharacterized protein LOC104791708 [Camelina sativa]
Length=408

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 88/161 (55%), Gaps = 38/161 (24%)
 Frame = +3

Query  135  TPVCPFVKAARPDDAS-VKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            T VCPF KAARPDDAS  +K G+                    M  S CPF  K  A  +
Sbjct  3    TSVCPFSKAARPDDASSTRKQGD--------------------MTASGCPFSSKA-ARPD  41

Query  312  IKPNQESGEQAKVSSKCPFGYT-----------QEAGGENKPKQVSEKPGVMSPKCPLGF  458
                ++ GE A  +S CPF  +           +E G  NK    S     +  KCP G+
Sbjct  42   DASARKQGETA--ASGCPFSKSARPDDGSKGCPEEEGKLNKD---STDSATVPAKCPFGY  96

Query  459  DSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            DSQTFKLGP SCM+CQALLYD SRCVPC+HVFCKVC+TRFK
Sbjct  97   DSQTFKLGPFSCMLCQALLYDSSRCVPCTHVFCKVCLTRFK  137



>ref|XP_009116123.1| PREDICTED: uncharacterized protein LOC103841350 [Brassica rapa]
Length=409

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 87/153 (57%), Gaps = 19/153 (12%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQ---HGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            T VCPF KAARPDDAS  +     +        ++   ++ GE     S CPF       
Sbjct  3    TSVCPFSKAARPDDASASRKQADTTPSVCPFSKADASARKQGET--TASGCPFS------  54

Query  306  SEIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  482
               K +  + +Q +V+SK CP       G  NK +  +     +  KCP G+DSQTFKLG
Sbjct  55   ---KSDASARKQGEVASKGCPVN----EGRVNKEEDSTTDSATVPAKCPFGYDSQTFKLG  107

Query  483  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            P SCM+CQALLYD SRCVPC+HVFCKVC+ RFK
Sbjct  108  PFSCMLCQALLYDSSRCVPCTHVFCKVCVARFK  140



>ref|XP_002877973.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54232.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 92/157 (59%), Gaps = 23/157 (15%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQ------SKQHGGSEKPKQESGEPAMVPSKCPFVHKQ  296
            T VCPF KAARPDDAS +K G++       SK     +   ++ GE  +  S CPF    
Sbjct  3    TSVCPFSKAARPDDASTRKQGDTAASGCPFSKAARPDDASARKQGE--ITASGCPF----  56

Query  297  QAGSEIKPNQESG-EQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  470
                  +P+  S  +Q +++S  CP    +  G  NK    S     +  KCP G+DSQT
Sbjct  57   --SKAARPDDASARKQDEIASNGCP----EHEGKLNKD---STDSATVPAKCPFGYDSQT  107

Query  471  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            FKLGP SCM+CQALLY+ SRCVPC+HVFCKVC++RF 
Sbjct  108  FKLGPFSCMLCQALLYESSRCVPCTHVFCKVCVSRFN  144



>ref|NP_191004.1| zinc ion binding protein [Arabidopsis thaliana]
 gb|AAK95259.1|AF410273_1 AT3g54360/T12E18_50 [Arabidopsis thaliana]
 emb|CAB81801.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAM63273.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAN18187.1| At3g54360/T12E18_50 [Arabidopsis thaliana]
 gb|AEE79220.1| zinc ion binding protein [Arabidopsis thaliana]
Length=405

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 86/163 (53%), Gaps = 37/163 (23%)
 Frame = +3

Query  126  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            +  T VCPF KAARPDD S +K GE                    +  S CPF       
Sbjct  1    MTTTSVCPFSKAARPDDGSTRKQGE--------------------ITASGCPF------S  34

Query  306  SEIKPNQESGEQ--AKVSSKCPFGYT---QEAGGENKPKQ------VSEKPGVMSPKCPL  452
               +P+  S  +     +S CPF  +    E G +  P+Q       S     +  KCP 
Sbjct  35   KAARPDDASARKQGETTASGCPFSKSARPDENGSKGCPEQEGNLNKDSTDSATVPAKCPF  94

Query  453  GFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            G+DSQTFKLGP SCM+CQALLY+ SRCVPC+HVFCKVC+TRFK
Sbjct  95   GYDSQTFKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLTRFK  137



>ref|XP_002297702.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
 gb|EEE82507.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
Length=363

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 78/150 (52%), Gaps = 52/150 (35%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MT VCP VKA+RPDD S +KPGE                         CP  H  +    
Sbjct  1    MTTVCPLVKASRPDDGSSRKPGE-------------------------CPEKHAAE----  31

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                                   E GG+ K + V     V SPKCP G+DSQTFKLGP S
Sbjct  32   ----------------------HEGGGKAKKESVGASATV-SPKCPFGYDSQTFKLGPHS  68

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+DCS+CVPCSHV+CKVCI+RFK
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFK  98



>ref|XP_008782756.1| PREDICTED: uncharacterized protein LOC103702200 [Phoenix dactylifera]
Length=428

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 89/161 (55%), Gaps = 11/161 (7%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVH-----K  293
            M+ VCPF KAA    +   K  E+ S+Q     +K   +S +   V   CP  H     +
Sbjct  1    MSFVCPFAKAAGAGASYPMKHEENHSRQQAECDDKGDTKSNDSTSVGDGCPMKHEGNYNR  60

Query  294  QQAGSEIKPNQESGEQAKVSSKCPFGY-----TQEAGGENKPKQVSEKPGVMSPKCPLGF  458
             QA  + K + +S +   V   CP  +       +A  ++K    S    V+SPKCP G+
Sbjct  61   HQAECDDKVDTKSNDSTSVGGGCPMKHEGNYNRHQAECDDKVDTKSNDSAVISPKCPFGY  120

Query  459  DSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            DS TFKLGPLSCMICQALLY  S+C+PCSH FCK CI+RFK
Sbjct  121  DSHTFKLGPLSCMICQALLYQSSKCLPCSHKFCKACISRFK  161



>emb|CDX67597.1| BnaA07g16370D [Brassica napus]
Length=401

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 82/155 (53%), Gaps = 31/155 (20%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  314
            T VCPF KAARPD+AS                 PKQ        PS CPF          
Sbjct  3    TSVCPFSKAARPDNAS---------------SAPKQAD----TTPSACPF------SKST  37

Query  315  KPNQESGEQAKVSSKCPFGYTQEAGG------ENKPKQVSEKPGVMSPKCPLGFDSQTFK  476
            +P+     +   S+ CPF  + +A        E + +   E    +  KCP G+DSQTFK
Sbjct  38   RPDDTKQGETTASAACPFSKSADASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFK  97

Query  477  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LGP SCM+CQ+LL+D +RCVPC+HVFCKVC+ RFK
Sbjct  98   LGPFSCMLCQSLLFDSTRCVPCTHVFCKVCLARFK  132



>emb|CDX73486.1| BnaC08g25170D [Brassica napus]
Length=409

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQ--HGGSEKPKQESGEPAMVPSKCPFVHKQQAGS  308
            T VCPF KAARPDDAS +K  ++         ++   ++ GE     S CPF        
Sbjct  3    TSVCPFSKAARPDDASARKQADTTPSACPFSKADAFARKQGET--TASACPFS-------  53

Query  309  EIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
              K +  + +Q +V+SK CP    +  G   K +  +     +  KCP G+DSQTFKLGP
Sbjct  54   --KSDASARKQGEVASKGCP----ENEGIVQKEEDSTTDSATVPAKCPFGYDSQTFKLGP  107

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
             SCM+CQALL++ SRCVPC+HVFCKVC++RFK
Sbjct  108  FSCMLCQALLFESSRCVPCTHVFCKVCVSRFK  139



>ref|XP_006403583.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
 gb|ESQ45036.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
Length=408

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 87/160 (54%), Gaps = 37/160 (23%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  314
            T VCPF KAARPDDAS +K GE                    +  S CPF          
Sbjct  3    TSVCPFSKAARPDDASARKQGE--------------------VTASGCPF------SKAA  36

Query  315  KPNQESG-EQAKVS-SKCPFGYT------QEAGGENKPK---QVSEKPGVMSPKCPLGFD  461
            +P+  S  +Q +V+ S CPF          E   +  PK   + S     +  KCP G+D
Sbjct  37   RPDDASARKQGEVTASGCPFSKAARPNEGDEMASKESPKLESRDSTASATVPAKCPFGYD  96

Query  462  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SQTFKLGP SCM+CQALLY+ SRCVPC+HVFCKVC++RFK
Sbjct  97   SQTFKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLSRFK  136



>gb|EYU39947.1| hypothetical protein MIMGU_mgv1a009191mg [Erythranthe guttata]
Length=350

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 78/150 (52%), Gaps = 59/150 (39%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPF KA+RPDDAS K+PGE+Q+KQ   ++   Q+ G                    
Sbjct  1    MTPVCPFTKASRPDDASCKRPGENQNKQQTVNDSKSQQEG--------------------  40

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                        +S KCPFGY                            DSQTFKLGPLS
Sbjct  41   -----------AISPKCPFGY----------------------------DSQTFKLGPLS  61

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CMICQALL+ CS+C+PCSHV+CK CI+RFK
Sbjct  62   CMICQALLFQCSKCMPCSHVYCKACISRFK  91



>ref|XP_009103916.1| PREDICTED: uncharacterized protein LOC103829975 [Brassica rapa]
Length=401

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 84/155 (54%), Gaps = 31/155 (20%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  314
            T VCPF KAARPD+AS                 PKQ        PS CPF    ++    
Sbjct  3    TSVCPFSKAARPDNAS---------------SAPKQAD----TTPSACPFSKAARSD---  40

Query  315  KPNQESGEQAKVSSKCPFGYTQEAGG------ENKPKQVSEKPGVMSPKCPLGFDSQTFK  476
              + + GE    S+ CPF  + +A        E + +   E    +  KCP G+DSQTFK
Sbjct  41   --DAKQGE-TTASAACPFSKSADASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFK  97

Query  477  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LGP SCM+CQ+LL+D +RCVPC+HVFCKVC+ RFK
Sbjct  98   LGPFSCMLCQSLLFDSTRCVPCTHVFCKVCLARFK  132



>gb|ACU19631.1| unknown [Glycine max]
Length=188

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 79/152 (52%), Gaps = 54/152 (36%)
 Frame = +3

Query  126  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            + MTPVCPFVKAARPDD +  K                 +SGE +M         K QA 
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KSGENSM---------KHQAE  34

Query  306  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
            SE K  +E  + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEVNDSASTS----------------------------PKCPFGYDSQSFKIGP  66

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LSC +CQALL+D S+CVPCSHVFCK CI+RFK
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACISRFK  98



>ref|XP_003522869.1| PREDICTED: uncharacterized protein LOC100813258 isoform X1 [Glycine 
max]
 ref|XP_006578395.1| PREDICTED: uncharacterized protein LOC100813258 isoform X2 [Glycine 
max]
Length=367

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 79/152 (52%), Gaps = 54/152 (36%)
 Frame = +3

Query  126  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            + MTPVCPFVKAARPDD +  K                 +SGE +M         K QA 
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KSGENSM---------KHQAE  34

Query  306  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
            SE K  +E  + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEVNDSASTS----------------------------PKCPFGYDSQSFKIGP  66

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LSC +CQALL+D S+CVPCSHVFCK CI+RFK
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACISRFK  98



>ref|XP_010689828.1| PREDICTED: uncharacterized protein LOC104903488 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 78/150 (52%), Gaps = 55/150 (37%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVK ARPDDAS K+ GE+Q                                   
Sbjct  1    MTPVCPFVKVARPDDASSKRNGENQ-----------------------------------  25

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
               N+ + E                  E+K K  S    ++ PKCPLG+DS +FK+GPLS
Sbjct  26   ---NKHAAEH-----------------ESKSKNESVDSAMIEPKCPLGYDSHSFKIGPLS  65

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            C++CQALL++ S+CVPCSH+FCK CI+RFK
Sbjct  66   CVLCQALLFESSKCVPCSHIFCKACISRFK  95



>ref|XP_007148770.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
 gb|ESW20764.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
Length=367

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 78/152 (51%), Gaps = 54/152 (36%)
 Frame = +3

Query  126  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            + MTPVCPFVKAARPDD +  K                 + GE +M         K Q  
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KLGENSM---------KHQVD  34

Query  306  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
            SE K  +E+ + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEANDSASAS----------------------------PKCPFGYDSQSFKIGP  66

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LSC +CQALL+D S+CVPCSHVFCK CI+RFK
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACISRFK  98



>gb|KJB67761.1| hypothetical protein B456_010G208800 [Gossypium raimondii]
Length=365

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 75/149 (50%), Gaps = 61/149 (41%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  314
            TPVCPFVKAARPDD      G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDD-----NGSAKKSTVGGSEATRKDSGDTATV----------------  41

Query  315  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  494
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  495  MICQALLYDCSRCVPCSHVFCKVCITRFK  581
            MICQALL+DC++C+PCSH+FCKVCI+RFK
Sbjct  62   MICQALLFDCTKCIPCSHLFCKVCISRFK  90



>gb|KHF99857.1| E3 ubiquitin-protein ligase CHFR [Gossypium arboreum]
Length=365

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 75/149 (50%), Gaps = 61/149 (41%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  314
            TPVCPFVKAARPDD      G ++    GGSE  +++SG+ A                  
Sbjct  3    TPVCPFVKAARPDD-----NGSAKKSTVGGSEATRKDSGDSA------------------  39

Query  315  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  494
                       VS KCPFGY                            DS  FKLGPLSC
Sbjct  40   ----------TVSPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  495  MICQALLYDCSRCVPCSHVFCKVCITRFK  581
            MICQALL+DC++C+PCSH+FCKVCI+RFK
Sbjct  62   MICQALLFDCTKCIPCSHLFCKVCISRFK  90



>ref|XP_010921286.1| PREDICTED: uncharacterized protein LOC105044901 [Elaeis guineensis]
Length=395

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 82/159 (52%), Gaps = 41/159 (26%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH----KQQ  299
            M+ VCPF KAA  D               GG                 CP  H    +QQ
Sbjct  1    MSSVCPFAKAACAD---------------GG-----------------CPVKHEKQSRQQ  28

Query  300  AGSEIKPNQESGEQAKVSSKCPFGY-----TQEAGGENKPKQVSEKPGVMSPKCPLGFDS  464
            A  + K + +S + A V   CP  +       +A  ++K    S    V+SPKCP G+DS
Sbjct  29   AECDDKVDTKSNDSASVDGGCPMKHEGNYNRHKAECDDKVDTKSNDSAVVSPKCPFGYDS  88

Query  465  QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
             TFKLGPLSCMICQALLY  S+C+PCSH FCKVCI+RFK
Sbjct  89   HTFKLGPLSCMICQALLYQSSKCLPCSHKFCKVCISRFK  127



>ref|XP_004516522.1| PREDICTED: uncharacterized protein LOC101498396 [Cicer arietinum]
Length=365

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 80/151 (53%), Gaps = 56/151 (37%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASV-KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGS  308
            MTPVCPFVK  RPDD +  KK GE+ +K                         H  +  S
Sbjct  1    MTPVCPFVKIPRPDDNNASKKSGENSNK-------------------------HHAEHES  35

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
            ++K                             K+V++   V SPKCPLG+DSQTFK+GPL
Sbjct  36   KVK-----------------------------KEVNDSASV-SPKCPLGYDSQTFKIGPL  65

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SCM+CQALLY+ S+CVPCSHVFCK C++RFK
Sbjct  66   SCMVCQALLYETSKCVPCSHVFCKACVSRFK  96



>ref|XP_007010628.1| Zinc ion binding [Theobroma cacao]
 gb|EOY19438.1| Zinc ion binding [Theobroma cacao]
Length=366

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 75/149 (50%), Gaps = 61/149 (41%)
 Frame = +3

Query  135  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  314
            TPVCPFVKAARPDDA     G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDDA-----GSAKKAATGGSEAARKDSGDTATV----------------  41

Query  315  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  494
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  495  MICQALLYDCSRCVPCSHVFCKVCITRFK  581
            MICQALL+D ++C+PCSH+FCKVCI+RFK
Sbjct  62   MICQALLFDSTKCIPCSHLFCKVCISRFK  90



>ref|XP_003527531.1| PREDICTED: uncharacterized protein LOC100813844 [Glycine max]
Length=367

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 76/152 (50%), Gaps = 54/152 (36%)
 Frame = +3

Query  126  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            + MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  
Sbjct  1    MNMTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVE  34

Query  306  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
            SE K  +E  + A  S                            PKCP G+DS +FK+GP
Sbjct  35   SESKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGP  66

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LSC +CQALL+D S+CVPCSHVFCK CI RFK
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACILRFK  98



>gb|ACU21424.1| unknown [Glycine max]
Length=189

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 76/152 (50%), Gaps = 54/152 (36%)
 Frame = +3

Query  126  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  305
            + MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  
Sbjct  1    MNMTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVE  34

Query  306  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
            SE K  +E  + A  S                            PKCP G+DS +FK+GP
Sbjct  35   SESKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGP  66

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LSC +CQALL+D S+CVPCSHVFCK CI RFK
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACILRFK  98



>gb|KHN26422.1| Polycomb complex protein BMI-1 [Glycine soja]
Length=365

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 75/150 (50%), Gaps = 54/150 (36%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  SE
Sbjct  1    MTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVESE  34

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
             K  +E  + A  S                            PKCP G+DS +FK+GPLS
Sbjct  35   SKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGPLS  66

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            C +CQALL+D S+CVPCSHVFCK CI RFK
Sbjct  67   CTVCQALLFDTSKCVPCSHVFCKACILRFK  96



>gb|KEH32916.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=379

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 76/159 (48%), Gaps = 54/159 (34%)
 Frame = +3

Query  105  CRSHGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPF  284
            CR       M PVCPFVK  RPDD++  K     S +                       
Sbjct  5    CRFLLWRFNMKPVCPFVKIPRPDDSNASKKSNENSNK-----------------------  41

Query  285  VHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDS  464
             H  +  S++K                             K+V +   V SPKCPLG+DS
Sbjct  42   -HHVEHDSKVK-----------------------------KEVKDSASV-SPKCPLGYDS  70

Query  465  QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            QTFK+GPLSCM+CQALL+D S+CVPCSHVFCK CI RFK
Sbjct  71   QTFKIGPLSCMVCQALLFDTSKCVPCSHVFCKACILRFK  109



>ref|XP_010533372.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
 ref|XP_010533373.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
Length=364

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 76/152 (50%), Gaps = 59/152 (39%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MTPVCPF K+ARP+D+                                CP   ++ A   
Sbjct  1    MTPVCPFAKSARPEDS--------------------------------CPRKQRETAN--  26

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGEN--KPKQVSEKPGVMSPKCPLGFDSQTFKLGP  485
                                   +AG EN  K K+ S +   +SPKCP G+DSQTFK+GP
Sbjct  27   -----------------------KAGSENECKAKKDSTESATVSPKCPFGYDSQTFKIGP  63

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
             SCMICQALLY+ SRCVPC+HVFCK C++RFK
Sbjct  64   FSCMICQALLYESSRCVPCTHVFCKACVSRFK  95



>ref|XP_010938114.1| PREDICTED: uncharacterized protein LOC105057260 isoform X1 [Elaeis 
guineensis]
Length=405

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 82/154 (53%), Gaps = 24/154 (16%)
 Frame = +3

Query  123  LIKMTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVHKQQ  299
            L  M+ +CPF KAA  D     K  E+ S+Q     +   ++S   A +   CP  ++  
Sbjct  7    LSNMSSICPFAKAASADGGCPMKHEENHSQQQAKCDDNVDRKSHGSASIDGGCPVKYE--  64

Query  300  AGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKL  479
                       G+  K  ++C          ++K    +    V+SPKCP G+DS TFKL
Sbjct  65   -----------GDHNKHQAEC----------DDKADTKTNDSAVVSPKCPFGYDSHTFKL  103

Query  480  GPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            GPLSCMICQALLY  S+C+PC+H FCK CI+RFK
Sbjct  104  GPLSCMICQALLYQSSKCLPCAHKFCKACISRFK  137



>gb|KEH32917.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=366

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 74/150 (49%), Gaps = 54/150 (36%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            M PVCPFVK  RPDD++  K     S +                        H  +  S+
Sbjct  1    MKPVCPFVKIPRPDDSNASKKSNENSNK------------------------HHVEHDSK  36

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
            +K                             K+V +   V SPKCPLG+DSQTFK+GPLS
Sbjct  37   VK-----------------------------KEVKDSASV-SPKCPLGYDSQTFKIGPLS  66

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            CM+CQALL+D S+CVPCSHVFCK CI RFK
Sbjct  67   CMVCQALLFDTSKCVPCSHVFCKACILRFK  96



>ref|XP_010938116.1| PREDICTED: uncharacterized protein LOC105057260 isoform X2 [Elaeis 
guineensis]
Length=396

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 81/151 (54%), Gaps = 24/151 (16%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVHKQQAGS  308
            M+ +CPF KAA  D     K  E+ S+Q     +   ++S   A +   CP  ++     
Sbjct  1    MSSICPFAKAASADGGCPMKHEENHSQQQAKCDDNVDRKSHGSASIDGGCPVKYE-----  55

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
                    G+  K  ++C          ++K    +    V+SPKCP G+DS TFKLGPL
Sbjct  56   --------GDHNKHQAEC----------DDKADTKTNDSAVVSPKCPFGYDSHTFKLGPL  97

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SCMICQALLY  S+C+PC+H FCK CI+RFK
Sbjct  98   SCMICQALLYQSSKCLPCAHKFCKACISRFK  128



>ref|XP_010091318.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
 gb|EXB44292.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
Length=438

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 74/151 (49%), Gaps = 57/151 (38%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPF-VHKQQAGS  308
            MTPVCPFVKA+RPD+AS                            P KCPF    Q   S
Sbjct  1    MTPVCPFVKASRPDEAS----------------------------PKKCPFGFDSQTTTS  32

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  488
              K  Q+  + + V +KCPFGY                            DSQTFKLGPL
Sbjct  33   NNKQQQQQQQSSVVEAKCPFGY----------------------------DSQTFKLGPL  64

Query  489  SCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            SC+ICQAL + CSRCVPC+H FCK CI+RFK
Sbjct  65   SCVICQALTFQCSRCVPCTHAFCKACISRFK  95



>ref|XP_010276468.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276469.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276470.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
Length=362

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 74/150 (49%), Gaps = 55/150 (37%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MT VCPF K+ARPDDAS +K  ++ S+                                 
Sbjct  1    MTSVCPFAKSARPDDASPRKSMDNHSRDQA------------------------------  30

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                                   E GG  K ++ S+    +SPKCP G+DS TFKLGPLS
Sbjct  31   -----------------------EPGG--KVRRESDDSASVSPKCPFGYDSHTFKLGPLS  65

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            C+ICQALLY+ S+CVPCSH +CK CI+RFK
Sbjct  66   CVICQALLYESSKCVPCSHKYCKACISRFK  95



>emb|CDM81302.1| unnamed protein product [Triticum aestivum]
Length=373

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 6/112 (5%)
 Frame = +3

Query  264  VPSKCPFVHKQQAG-----SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKP-KQVSEKP  425
            + S CPF      G     S+ KP++  G    V+ K      +E+G +    ++ +E P
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAACPVTGKSHGSENKESGADRATGEEGAEDP  60

Query  426  GVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
             V+  KCP G+DS TFKLGPLSCM+CQALL+D S+C+PCSH FCK CI+RFK
Sbjct  61   RVVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCLPCSHKFCKACISRFK  112



>ref|XP_009420238.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420239.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +3

Query  342  AKVSSKCPF----GYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQA  509
            A V   CP        Q+A  ENK  + S     +SPKCP GFDS TFKLGPLSCMICQ+
Sbjct  11   ASVGGACPMKSVNNEKQQAENENKGDEESNPSDTVSPKCPYGFDSHTFKLGPLSCMICQS  70

Query  510  LLYDCSRCVPCSHVFCKVCITRFK  581
            LLY  S+C+PCSH FC+VCI+RFK
Sbjct  71   LLYQSSKCIPCSHKFCRVCISRFK  94



>ref|XP_008793368.1| PREDICTED: uncharacterized protein LOC103709685 [Phoenix dactylifera]
Length=378

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +3

Query  291  KQQAGSEIKPNQESGEQAKVSSKCPFGYT-----QEAGGENKPKQVSEKPGVMSPKCPLG  455
            +QQA  +   + +S   A +   CP  +       +A  ++K    S    V+SPKCP G
Sbjct  9    QQQAKCDDNVDTKSSGSASIDVGCPMKHEGDYNKHQADCDDKADTKSNDSAVVSPKCPFG  68

Query  456  FDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            +DS TFKLGPLSCMICQALLY  S+C+PC+H FCK CI+RFK
Sbjct  69   YDSHTFKLGPLSCMICQALLYQSSKCLPCAHKFCKACISRFK  110



>ref|XP_010554493.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554494.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554495.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
Length=367

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 72/150 (48%), Gaps = 55/150 (37%)
 Frame = +3

Query  132  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  311
            MT VCPF K+ARPD++                                CP   ++ A   
Sbjct  1    MTSVCPFAKSARPDES--------------------------------CPRKQREAA---  25

Query  312  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  491
                         S  CP         E K K+       +SPKCP G+DSQTFK+GP S
Sbjct  26   -------------SKSCP-------ELEGKAKKDCTDSATVSPKCPFGYDSQTFKIGPFS  65

Query  492  CMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            C+ICQALLY+ SRCVPC+HVFCK CI+RFK
Sbjct  66   CVICQALLYETSRCVPCTHVFCKACISRFK  95



>gb|EMS59099.1| E3 ubiquitin-protein ligase CHFR [Triticum urartu]
Length=573

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 70/118 (59%), Gaps = 8/118 (7%)
 Frame = +3

Query  252  EPAMVPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQ-  410
            E   + S CPF      G     S+ KP++  G  A  V+ K      +E+G +    + 
Sbjct  94   ETIAMSSLCPFAKATTGGVCPMKSDKKPDKSGGGAACPVTGKSHGSENKESGADRAAGEE  153

Query  411  -VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
               E P V+  KCP G+DS TFKLGPLSCM+CQALL+D S+C+PCSH FCK CI+RFK
Sbjct  154  GAEEDPRVVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCMPCSHKFCKACISRFK  211



>gb|KHN45782.1| Polycomb complex protein BMI-1-B [Glycine soja]
Length=339

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  378  QEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFC  557
             +A  E+K K+        SPKCP G+DSQ+FK+GPLSC +CQALL+D S+CVPCSHVFC
Sbjct  3    HQAESESKVKKEVNDSASTSPKCPFGYDSQSFKIGPLSCTVCQALLFDTSKCVPCSHVFC  62

Query  558  KVCITRFK  581
            K CI+RFK
Sbjct  63   KACISRFK  70



>ref|XP_008375385.1| PREDICTED: uncharacterized protein LOC103438629 [Malus domestica]
Length=364

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +3

Query  360  CPFGYTQEAGGENKP--KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRC  533
            CPF    +AG  ++P  K+ S     + PKCPLG+DSQTFKLGPLSCMIC AL++D ++C
Sbjct  6    CPFA---KAGRPSEPSKKETSADTATIPPKCPLGYDSQTFKLGPLSCMICHALMFDSAKC  62

Query  534  VPCSHVFCKVCITRFK  581
            VPCSH FC+ CI+RFK
Sbjct  63   VPCSHSFCQACISRFK  78



>gb|EMT10100.1| E3 ubiquitin-protein ligase CHFR [Aegilops tauschii]
Length=540

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 96/182 (53%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   STEIQCRSHGLLIKMTPVCPFVK-----AARPDDASVKKPGESQSKQHG-GSEKPK---Q  242
            +TE     +G L  +  VC         +A   D++V     S +  HG G+   K   Q
Sbjct  73   NTEGGISMYGNLTIVLSVCQLTNWWVDTSANIHDSTVLMENGSPASVHGIGTTNLKFILQ  132

Query  243  E---SGEPAMVPSKCPFVHKQQAG-----SEIKPNQESGEQAKVSSKCPFGYTQEAGGEN  398
            E   + E   + S CPF      G     S+ KP++ SG    V+ K   G  +E   ++
Sbjct  133  EGTINKESIAMSSLCPFAKATTGGVCPMKSDKKPDKSSGAACPVTGKG--GEPKETSADH  190

Query  399  KP-KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR  575
               ++ +E P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PCSH FCK CI+R
Sbjct  191  AAGEESAEDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCKPCSHKFCKACISR  250

Query  576  FK  581
            FK
Sbjct  251  FK  252



>ref|XP_003559441.1| PREDICTED: uncharacterized protein LOC100832811 [Brachypodium 
distachyon]
Length=380

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = +3

Query  264  VPSKCPFVHKQQAGSEI---KPNQES---GEQAKVSSKCPF-----GYTQEAGGENKPKQ  410
            + S CPF      G  +   K N+ S     +   SS CP      G   E  G +   +
Sbjct  1    MSSLCPFAKATTGGGGVCPMKSNKNSTVKSNKNDSSSVCPVTGKNNGEEHEESGTDHAGE  60

Query  411  VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
             S  P V+  KCP G+DS TFKLGPLSCM+CQALL+D S+C PCSH FCK CI+RFK
Sbjct  61   ESPDPRVVPAKCPFGYDSNTFKLGPLSCMVCQALLHDTSKCKPCSHKFCKACISRFK  117



>ref|XP_008231724.1| PREDICTED: uncharacterized protein LOC103330891 [Prunus mume]
Length=350

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  405  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            K+ S     +SPKCPLG+DSQTFKLGPLSCMIC ALL+D ++C PCSH FCK CI+RFK
Sbjct  19   KESSADTATISPKCPLGYDSQTFKLGPLSCMICHALLFDSAKCAPCSHSFCKACISRFK  77



>ref|XP_007218231.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
 gb|EMJ19430.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
Length=350

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  405  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            K+ S     +SPKCPLG+DSQTFKLGPLSCMIC ALL+D ++ VPCSH FCK CI+RFK
Sbjct  19   KESSADTATISPKCPLGYDSQTFKLGPLSCMICHALLFDSAKSVPCSHSFCKACISRFK  77



>ref|XP_006643640.1| PREDICTED: uncharacterized protein LOC102704921 [Oryza brachyantha]
Length=361

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 63/108 (58%), Gaps = 11/108 (10%)
 Frame = +3

Query  264  VPSKCPFVHKQQAGSE--IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMS  437
            + S CPF     AG++  +K ++ +      ++ CP          +K     + P ++ 
Sbjct  1    MSSLCPFAKLASAGAKCPVKSDKNNS----TTASCPAN-----SHHHKEDDAQQNPSMVP  51

Query  438  PKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            PKCP G+DS TFKLGPLSCM+C ALLY  S+C PCSH FCK CI RFK
Sbjct  52   PKCPFGYDSNTFKLGPLSCMVCHALLYQTSKCTPCSHKFCKTCILRFK  99



>ref|XP_004306461.1| PREDICTED: uncharacterized protein LOC101299030 [Fragaria vesca 
subsp. vesca]
Length=338

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  432  MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            +SPKCPLG+DSQTFKLGPLSCMIC ALL+D + CVPCSH FCK C++RFK
Sbjct  31   VSPKCPLGYDSQTFKLGPLSCMICHALLFDSANCVPCSHSFCKACVSRFK  80



>dbj|BAJ86803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 9/115 (8%)
 Frame = +3

Query  264  VPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQVSE--  419
            + S CPF      G     S+ KP++  G  A  V+ K   G  +E G +          
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAAACPVTGKTHGGEDKETGADRAAAGEEGAE  60

Query  420  -KPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
              P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PC+H FCK CI+RFK
Sbjct  61   GDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCKPCAHKFCKACISRFK  115



>ref|XP_003563481.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Brachypodium 
distachyon]
Length=379

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 65/118 (55%), Gaps = 12/118 (10%)
 Frame = +3

Query  264  VPSKCPFVHKQQAGSEIKPNQESGEQAKV-------SSKCPF-----GYTQEAGGENKPK  407
            + S CPF      G  + P +     + V       SS CP      G   +  G +   
Sbjct  1    MSSLCPFAKATTGGGGVCPMKSDKNSSTVKSNKNDSSSVCPVTGKNNGEEHKESGTDHAG  60

Query  408  QVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            + S  P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PCSH FCK CI+RFK
Sbjct  61   EESPDPRMVPAKCPFGYDSNTFKLGPLSCMVCQALLHDTSKCKPCSHKFCKTCISRFK  118



>dbj|BAJ90412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 9/115 (8%)
 Frame = +3

Query  264  VPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQVSE--  419
            + S CPF      G     S+ KP++  G  A  V+ K   G  +E G +          
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAAACPVTGKTHGGEDKETGADRAAAGEEGAE  60

Query  420  -KPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
              P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PC+H FCK CI+RFK
Sbjct  61   GDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCKPCAHKFCKACISRFK  115



>gb|KDO48653.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
Length=126

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  438  PKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            PKCP G+D+Q+FK+GPLSCMICQALL++CS+C PCSHV+CK CI+RFK
Sbjct  8    PKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFK  55



>ref|XP_004978719.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=361

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 10/100 (10%)
 Frame = +3

Query  312  IKPNQESG------EQAKVSSKCPFGY----TQEAGGENKPKQVSEKPGVMSPKCPLGFD  461
            +K N+ SG          +S  CP        +E G     +  S  P ++  KCP G+D
Sbjct  1    MKSNRSSGGVCPAKSDKNISGVCPVTGKNHGAEEQGSTGNAEGKSSDPRLVPAKCPFGYD  60

Query  462  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            S TFKLGPLSCMICQALL++CSRC PCSH FCK C++RFK
Sbjct  61   SGTFKLGPLSCMICQALLHECSRCKPCSHKFCKACVSRFK  100



>ref|XP_006829771.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
 gb|ERM97187.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
Length=221

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  405  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            K+ SE P  +SPKCP G+DS  FKLGPLSC+IC+ALL++ S+C+PCSH +CKVCI+RFK
Sbjct  38   KEESEAPNTVSPKCPFGYDSHAFKLGPLSCVICRALLFETSKCLPCSHKYCKVCISRFK  96



>gb|EEC69773.1| hypothetical protein OsI_00037 [Oryza sativa Indica Group]
Length=409

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 69/122 (57%), Gaps = 8/122 (7%)
 Frame = +3

Query  219  GGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN  398
            G +  P  ++  P M  S CPF     AG+   P + S +     +K    +T +   +N
Sbjct  33   GVNNPPTIDTTNPIM-SSLCPFAKLASAGATC-PVKSSSD-----NKTTINHTDDDDDDN  85

Query  399  -KPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR  575
             K    +  P V+ PKCP G+DS TFKLGPLSCM+C ALL+  S+C PCSH FCK CI R
Sbjct  86   EKTGNANTDPRVVPPKCPFGYDSNTFKLGPLSCMVCHALLHQSSKCTPCSHKFCKACILR  145

Query  576  FK  581
            FK
Sbjct  146  FK  147



>ref|NP_001041762.2| Os01g0104100 [Oryza sativa Japonica Group]
 dbj|BAD44834.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG96566.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53706.1| hypothetical protein OsJ_00033 [Oryza sativa Japonica Group]
 dbj|BAF03676.2| Os01g0104100 [Oryza sativa Japonica Group]
Length=363

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 63/107 (59%), Gaps = 7/107 (7%)
 Frame = +3

Query  264  VPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN-KPKQVSEKPGVMSP  440
            + S CPF     AG+   P + S +     +K    +T +   +N K    +  P V+ P
Sbjct  1    MSSLCPFAKLASAGATC-PVKSSSD-----NKTTINHTDDDDDDNEKTGNANTDPRVVPP  54

Query  441  KCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            KCP G+DS TFKLGPLSCM+C ALL+  S+C PCSH FCK CI RFK
Sbjct  55   KCPFGYDSNTFKLGPLSCMVCHALLHQSSKCTPCSHKFCKACILRFK  101



>ref|XP_001754304.1| predicted protein [Physcomitrella patens]
 gb|EDQ80754.1| predicted protein [Physcomitrella patens]
Length=372

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 59/98 (60%), Gaps = 16/98 (16%)
 Frame = +3

Query  327  ESGEQAKVSSKCPFGY-------------TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQ  467
            E+ +   +S +CPFGY               E G E K +      G    KCPLG+DS 
Sbjct  13   EAKKSDNISGQCPFGYGKSEGSKESHENGVDEQGKERKDENTEASAG---GKCPLGYDSV  69

Query  468  TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            +FK+GP SC++C+ALL+D SRCVPC H+FC+ CI+RF+
Sbjct  70   SFKIGPFSCVLCRALLHDSSRCVPCRHIFCRGCISRFQ  107



>gb|EPS69962.1| hypothetical protein M569_04796, partial [Genlisea aurea]
Length=307

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  441  KCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            KCP G+DSQTFKLGPLSCMICQALL++C +CVPCSH FC+ C+++FK
Sbjct  1    KCPFGYDSQTFKLGPLSCMICQALLFECIKCVPCSHAFCRACVSKFK  47



>ref|XP_002444897.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
 gb|EES14392.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
Length=382

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = +3

Query  387  GGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVC  566
            GGE K    ++ P ++  KCP G+DS TFKLGPLSC++CQALL++ S+C PC+H FCK C
Sbjct  60   GGEEKG---TDDPRMVPAKCPFGYDSNTFKLGPLSCIVCQALLHESSKCKPCAHKFCKAC  116

Query  567  ITRFK  581
            I+RFK
Sbjct  117  ISRFK  121



>ref|XP_002981629.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
 gb|EFJ17444.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
Length=338

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 12/73 (16%)
 Frame = +3

Query  360  CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVP  539
            CPFG            +VS+     SPKCPLG+D+ +FKLGPLSC++C+ALL+  +RC+P
Sbjct  3    CPFG--------GATHEVSDS----SPKCPLGYDTASFKLGPLSCLVCRALLFKAARCLP  50

Query  540  CSHVFCKVCITRF  578
            C HVFC  CI RF
Sbjct  51   CRHVFCSACIARF  63



>gb|ACG25350.1| hypothetical protein [Zea mays]
Length=351

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  423  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            P V+  KCP G+DS TFKLGPLSC++CQALL++ S+C PC+H FCK CI+RFK
Sbjct  66   PRVVPAKCPFGYDSNTFKLGPLSCIVCQALLHESSKCKPCAHKFCKACISRFK  118



>ref|NP_001048384.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAD19269.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10298.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAG92291.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92078.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57969.1| hypothetical protein OsJ_08709 [Oryza sativa Japonica Group]
Length=365

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +3

Query  264  VPSKCPFVHKQQAGSE--IKPNQESGEQAKVSSKCPFGYTQEAGGENKPK--QVSEKPGV  431
            + S CPF     AG+   +K + ++       + CP         ++  K    +  P V
Sbjct  1    MSSLCPFAKLASAGATCPVKSDNKT-------TSCPVTANNHTDDDDNEKTGNANTDPRV  53

Query  432  MSPKCPLGFDSQ-TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            +  KCP G+DS  TFKLGPLSC++C ALL+  S+C PCSH FCK CI RFK
Sbjct  54   VPAKCPFGYDSNNTFKLGPLSCVVCHALLHQSSKCTPCSHKFCKACILRFK  104



>ref|NP_001140913.1| LOC100272990 [Zea mays]
 ref|XP_008672386.1| PREDICTED: LOC100272990 isoform X1 [Zea mays]
 gb|ACF84952.1| unknown [Zea mays]
 tpg|DAA53866.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 1 [Zea mays]
 tpg|DAA53867.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 2 [Zea mays]
 tpg|DAA53868.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 3 [Zea mays]
Length=379

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  423  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            P V+  KCP G+DS TFKLGPLSC++CQALL++ S+C PC+H FCK CI+RFK
Sbjct  66   PRVVPAKCPFGYDSNTFKLGPLSCIVCQALLHESSKCKPCAHKFCKACISRFK  118



>ref|XP_004967927.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=379

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  423  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            P ++  KCP G+DS TFKLGPLSC+ICQALL++ S+C PC+H FCK CI+RFK
Sbjct  66   PRMVPAKCPFGYDSNTFKLGPLSCIICQALLHESSKCKPCAHKFCKACISRFK  118



>gb|EEC74169.1| hypothetical protein OsI_09273 [Oryza sativa Indica Group]
Length=655

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  399  KPKQVSEKPGVMSPKCPLGFDSQ-TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR  575
            K    +  P V+  KCP G+DS  TFKLGPLSC++C ALL+  S+C PCSH FCK CI R
Sbjct  333  KTGNANTDPRVVPAKCPFGYDSNNTFKLGPLSCVVCHALLHQSSKCTPCSHKFCKACILR  392

Query  576  FK  581
            FK
Sbjct  393  FK  394



>gb|KJB73245.1| hypothetical protein B456_011G224300, partial [Gossypium raimondii]
Length=254

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  477  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LGPLSCMICQALL+D ++C+PCSH+FC+VC +RFK
Sbjct  1    LGPLSCMICQALLFDFTKCIPCSHLFCQVCTSRFK  35



>gb|KJB73244.1| hypothetical protein B456_011G224300, partial [Gossypium raimondii]
Length=228

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  477  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK  581
            LGPLSCMICQALL+D ++C+PCSH+FC+VC +RFK
Sbjct  1    LGPLSCMICQALLFDFTKCIPCSHLFCQVCTSRFK  35



>ref|XP_011402355.1| hypothetical protein F751_5740 [Auxenochlorella protothecoides]
 gb|KFM29302.1| hypothetical protein F751_5740 [Auxenochlorella protothecoides]
Length=506

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 74/151 (49%), Gaps = 21/151 (14%)
 Frame = +3

Query  138  PVCPFVKAARPDDASVKKPGESQSKQHGGSEK---PKQESGEPAMVPSKCPFVHKQQAGS  308
            P   F+  A+   + V  P  + S++  G+++   P Q S + A   + CPF H Q    
Sbjct  60   PFRRFMGGAKETSSPVPDPSRTPSERGNGNKEAGNPPQISVKAAAQAAGCPF-HSQI---  115

Query  309  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTF-KLGP  485
                  E  E  K   KCPF     +GG     Q S   G  +PKCP+GF S+   KLG 
Sbjct  116  -----PEQAEAPKAPGKCPF---LASGG----AQPSTPVGSDAPKCPMGFSSEVQQKLGS  163

Query  486  LSCMICQALLYDCSRCVPCSHVFCKVCITRF  578
              C++C++LL+DC R   C H +C+ CI R+
Sbjct  164  FHCVLCKSLLHDCVRTA-CRHEYCRACIERY  193



>gb|AFW74750.1| hypothetical protein ZEAMMB73_787325 [Zea mays]
Length=192

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +3

Query  390  GENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCI  569
            GE K K     P V+  K P G+DS T KLG LS ++CQ LL++  +C  C+H FCK CI
Sbjct  73   GEEKGKD----PHVVPAKRPFGYDSNTSKLGLLSSIVCQTLLHESRKCKLCTHKFCKACI  128

Query  570  TRFK  581
            + FK
Sbjct  129  SCFK  132



>emb|CDY07544.1| BnaC06g15200D [Brassica napus]
Length=298

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  MICQALLYDCSRCVPCSHVFCKVCITRFK  581
            M+CQ+LL+D +RCVPC+HVFCKVC+ RFK
Sbjct  1    MLCQSLLFDSTRCVPCTHVFCKVCLARFK  29



>dbj|BAH20367.1| AT3G54360 [Arabidopsis thaliana]
Length=292

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  510  LLYDCSRCVPCSHVFCKVCITRFK  581
            LLY+ SRCVPC+HVFCKVC+TRFK
Sbjct  1    LLYESSRCVPCTHVFCKVCLTRFK  24



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220