BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014N08

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                273   6e-88   Nicotiana sylvestris
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                271   4e-87   Solanum lycopersicum
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           270   6e-87   Nicotiana sylvestris
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           269   2e-86   Nicotiana tomentosiformis
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                268   3e-86   Nicotiana tomentosiformis
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           268   4e-86   Solanum tuberosum [potatoes]
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           268   6e-86   Nicotiana sylvestris
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           266   3e-85   Nicotiana tomentosiformis
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           265   9e-85   Solanum tuberosum [potatoes]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                264   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            263   2e-84   
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         263   3e-84   Prunus mume [ume]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             263   4e-84   Prunus persica
ref|NP_001274803.1|  uncharacterized protein LOC102577675               263   6e-84   Solanum tuberosum [potatoes]
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           263   6e-84   
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           262   8e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     262   8e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                262   8e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    262   9e-84   Elaeis guineensis
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             259   1e-83   
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                262   1e-83   Prunus mume [ume]
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             260   1e-83   
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         261   2e-83   Malus domestica [apple tree]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         261   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           261   2e-83   
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                261   2e-83   Malus domestica [apple tree]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                262   2e-83   Sesamum indicum [beniseed]
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         261   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    261   3e-83   
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                261   3e-83   Solanum lycopersicum
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    261   3e-83   Glycine max [soybeans]
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           260   5e-83   
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           260   6e-83   
gb|KHN36792.1|  60S ribosomal protein L5                                260   6e-83   Glycine soja [wild soybean]
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     260   6e-83   
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    260   6e-83   
gb|KHN15970.1|  60S ribosomal protein L5                                259   6e-83   Glycine soja [wild soybean]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           259   7e-83   Glycine max [soybeans]
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   256   9e-83   Citrus sinensis [apfelsine]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           259   9e-83   Glycine max [soybeans]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                259   1e-82   
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             259   1e-82   Phaseolus vulgaris [French bean]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           259   1e-82   Phoenix dactylifera
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           260   1e-82   Glycine max [soybeans]
gb|ADR71225.1|  60S ribosomal protein L5A                               259   2e-82   Hevea brasiliensis [jebe]
gb|KJB71615.1|  hypothetical protein B456_011G133700                    258   2e-82   Gossypium raimondii
emb|CDP17898.1|  unnamed protein product                                261   2e-82   Coffea canephora [robusta coffee]
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           259   2e-82   Glycine max [soybeans]
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             258   2e-82   Citrus clementina [clementine]
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           259   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK34395.1|  unknown                                                 259   2e-82   Lotus japonicus
gb|AFK36106.1|  unknown                                                 258   2e-82   Lotus japonicus
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                258   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46994.1|  unknown                                                 258   2e-82   Lotus japonicus
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             258   3e-82   Phaseolus vulgaris [French bean]
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                258   3e-82   Populus euphratica
gb|AHA84189.1|  60S ribosomal protein L5                                258   4e-82   Phaseolus vulgaris [French bean]
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           258   4e-82   Sesamum indicum [beniseed]
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             258   4e-82   Populus trichocarpa [western balsam poplar]
gb|KJB71614.1|  hypothetical protein B456_011G133700                    258   4e-82   Gossypium raimondii
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  256   5e-82   Citrus sinensis [apfelsine]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             258   5e-82   Phaseolus vulgaris [French bean]
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   257   6e-82   Phaseolus vulgaris [French bean]
ref|XP_002524859.1|  ribosomal protein L5, putative                     257   8e-82   Ricinus communis
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           257   8e-82   Cicer arietinum [garbanzo]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  257   8e-82   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           257   8e-82   Citrus sinensis [apfelsine]
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   256   9e-82   Citrus sinensis [apfelsine]
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   257   9e-82   Phaseolus vulgaris [French bean]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           257   9e-82   Fragaria vesca subsp. vesca
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           256   1e-81   Populus euphratica
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                257   1e-81   Fragaria vesca subsp. vesca
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                257   1e-81   Eucalyptus grandis [rose gum]
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           256   1e-81   Citrus sinensis [apfelsine]
gb|ACU23594.1|  unknown                                                 256   1e-81   Glycine max [soybeans]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   256   1e-81   Citrus sinensis [apfelsine]
gb|ADR71226.1|  60S ribosomal protein L5B                               256   1e-81   Hevea brasiliensis [jebe]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           256   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK93902.1|  unknown                                                 256   2e-81   Populus trichocarpa [western balsam poplar]
gb|ABK95722.1|  unknown                                                 256   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              255   4e-81   Tarenaya hassleriana [spider flower]
emb|CBI24704.3|  unnamed protein product                                256   5e-81   Vitis vinifera
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           255   5e-81   Phoenix dactylifera
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                254   7e-81   Vitis vinifera
ref|XP_002524558.1|  ribosomal protein L5, putative                     254   7e-81   Ricinus communis
gb|ACJ85054.1|  unknown                                                 254   8e-81   Medicago truncatula
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          254   8e-81   Sorghum bicolor [broomcorn]
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           254   9e-81   Sesamum indicum [beniseed]
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           254   1e-80   Cucumis melo [Oriental melon]
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             257   1e-80   
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                254   1e-80   Cucumis melo [Oriental melon]
gb|KJB84072.1|  hypothetical protein B456_N001600                       254   1e-80   Gossypium raimondii
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           254   1e-80   Tarenaya hassleriana [spider flower]
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         253   2e-80   Jatropha curcas
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           253   2e-80   Cucumis sativus [cucumbers]
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     255   3e-80   Eucalyptus grandis [rose gum]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   255   3e-80   
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   3e-80   Tarenaya hassleriana [spider flower]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    253   3e-80   Phoenix dactylifera
gb|AFK41086.1|  unknown                                                 253   5e-80   Medicago truncatula
gb|KJB22672.1|  hypothetical protein B456_004G060400                    249   5e-80   Gossypium raimondii
gb|KJB22671.1|  hypothetical protein B456_004G060400                    249   5e-80   Gossypium raimondii
ref|NP_001267659.1|  60S ribosomal protein L5                           253   5e-80   Cucumis sativus [cucumbers]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         252   6e-80   Tarenaya hassleriana [spider flower]
emb|CDP18434.1|  unnamed protein product                                253   6e-80   Coffea canephora [robusta coffee]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   252   7e-80   
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           252   7e-80   Cicer arietinum [garbanzo]
gb|ABK93596.1|  unknown                                                 252   9e-80   Populus trichocarpa [western balsam poplar]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             252   9e-80   Populus trichocarpa [western balsam poplar]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         252   1e-79   Tarenaya hassleriana [spider flower]
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                252   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          251   1e-79   
gb|KJB27799.1|  hypothetical protein B456_005G010200                    251   1e-79   Gossypium raimondii
gb|KJB27798.1|  hypothetical protein B456_005G010200                    251   2e-79   Gossypium raimondii
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   251   2e-79   
gb|KJB22668.1|  hypothetical protein B456_004G060400                    251   2e-79   Gossypium raimondii
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-79   Populus euphratica
gb|AFW84310.1|  hypothetical protein ZEAMMB73_937605                    248   2e-79   
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    251   3e-79   
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               250   4e-79   Erythranthe guttata [common monkey flower]
gb|EPS64989.1|  hypothetical protein M569_09790                         247   5e-79   Genlisea aurea
emb|CDY52294.1|  BnaA03g57870D                                          251   6e-79   Brassica napus [oilseed rape]
gb|KHN27258.1|  60S ribosomal protein L5                                249   7e-79   Glycine soja [wild soybean]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         249   8e-79   Setaria italica
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   8e-79   Camelina sativa [gold-of-pleasure]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     249   8e-79   Eucalyptus grandis [rose gum]
gb|AFK39593.1|  unknown                                                 249   9e-79   Lotus japonicus
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    248   1e-78   
gb|AFK41626.1|  unknown                                                 246   1e-78   Lotus japonicus
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         249   1e-78   Brachypodium distachyon [annual false brome]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     249   1e-78   Eucalyptus grandis [rose gum]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   2e-78   Camelina sativa [gold-of-pleasure]
gb|ACR38045.1|  unknown                                                 248   2e-78   Zea mays [maize]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           248   3e-78   Nelumbo nucifera [Indian lotus]
gb|KJB10809.1|  hypothetical protein B456_001G226000                    246   3e-78   Gossypium raimondii
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              248   3e-78   
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   3e-78   Brassica rapa
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             248   3e-78   
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              248   4e-78   Zea mays [maize]
ref|NP_198790.1|  60S ribosomal protein L5-2                            248   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151284.1|  60S ribosomal protein L5-1                         248   4e-78   Zea mays [maize]
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         247   5e-78   Zea mays [maize]
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    247   6e-78   Arabis alpina [alpine rockcress]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         247   7e-78   Brachypodium distachyon [annual false brome]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    247   7e-78   Camelina sativa [gold-of-pleasure]
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    247   7e-78   Arabis alpina [alpine rockcress]
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             247   8e-78   Arabidopsis lyrata subsp. lyrata
gb|AAM64753.1|  ribosomal protein, putative                             247   8e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              247   9e-78   Brachypodium distachyon [annual false brome]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         247   9e-78   
gb|AEV92989.1|  60S ribosomal protein L5                                247   9e-78   Triticum aestivum [Canadian hard winter wheat]
ref|NP_566767.1|  60S ribosomal protein L5-1                            247   9e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   246   1e-77   
dbj|BAJ89012.1|  predicted protein                                      246   1e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG36552.1|  60S ribosomal protein L5-1                              246   1e-77   Zea mays [maize]
emb|CDY50258.1|  BnaC07g47930D                                          247   1e-77   Brassica napus [oilseed rape]
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         246   1e-77   Jatropha curcas
gb|KJB10810.1|  hypothetical protein B456_001G226000                    246   2e-77   Gossypium raimondii
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             246   2e-77   Eutrema salsugineum [saltwater cress]
emb|CDY15088.1|  BnaC03g44490D                                          247   2e-77   Brassica napus [oilseed rape]
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           248   2e-77   
emb|CDY27889.1|  BnaA07g04790D                                          246   3e-77   Brassica napus [oilseed rape]
emb|CDY15089.1|  BnaC03g44500D                                          246   3e-77   Brassica napus [oilseed rape]
emb|CDY52293.1|  BnaA03g57860D                                          246   3e-77   Brassica napus [oilseed rape]
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         245   4e-77   Brassica rapa
gb|KDO51035.1|  hypothetical protein CISIN_1g022424mg                   243   4e-77   Citrus sinensis [apfelsine]
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             245   4e-77   Capsella rubella
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             245   4e-77   Capsella rubella
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         244   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         244   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    244   8e-77   Brassica rapa
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             243   2e-76   Capsella rubella
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         243   2e-76   Camelina sativa [gold-of-pleasure]
gb|ABK21084.1|  unknown                                                 243   3e-76   Picea sitchensis
gb|KJB84073.1|  hypothetical protein B456_N001600                       243   4e-76   Gossypium raimondii
emb|CDX86312.1|  BnaA06g30290D                                          243   5e-76   
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          241   2e-75   
gb|KJB22673.1|  hypothetical protein B456_004G060400                    237   2e-75   Gossypium raimondii
gb|KJB22670.1|  hypothetical protein B456_004G060400                    236   2e-75   Gossypium raimondii
dbj|BAD82173.1|  putative ribosomal protein L5                          241   2e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             240   3e-75   
ref|NP_001045083.1|  Os01g0896800                                       240   3e-75   
emb|CDX85331.1|  BnaC07g26420D                                          243   4e-75   
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        240   4e-75   Oryza sativa Indica Group [Indian rice]
gb|EPS61271.1|  hypothetical protein M569_13526                         238   4e-75   Genlisea aurea
gb|KJB22669.1|  hypothetical protein B456_004G060400                    239   5e-75   Gossypium raimondii
ref|XP_010101365.1|  60S ribosomal protein L5                           239   8e-75   
ref|XP_002876523.1|  predicted protein                                  239   9e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    239   1e-74   
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             239   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         238   1e-74   Oryza brachyantha
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    238   2e-74   Oryza brachyantha
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    238   2e-74   
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           238   4e-74   Elaeis guineensis
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                237   5e-74   Elaeis guineensis
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                236   1e-73   Nelumbo nucifera [Indian lotus]
gb|AES74307.2|  60S ribosomal protein L5-2                              236   2e-73   Medicago truncatula
gb|EMT23062.1|  60S ribosomal protein L5-2                              236   2e-73   
gb|EMT04099.1|  60S ribosomal protein L5-2                              235   3e-73   
gb|EMT20601.1|  60S ribosomal protein L5-2                              234   4e-73   
ref|XP_003604056.1|  60S ribosomal protein L5                           236   5e-73   
gb|EMS59984.1|  60S ribosomal protein L5-2                              233   1e-72   Triticum urartu
ref|XP_001783620.1|  predicted protein                                  233   2e-72   
ref|XP_001783411.1|  predicted protein                                  233   2e-72   
ref|XP_001767871.1|  predicted protein                                  232   3e-72   
ref|XP_001759628.1|  predicted protein                                  231   7e-72   
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        229   8e-71   
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      228   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             228   2e-70   
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             226   1e-69   Selaginella moellendorffii
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             226   1e-69   Selaginella moellendorffii
ref|XP_004310188.1|  PREDICTED: 60S ribosomal protein L5-2-like         213   4e-66   Fragaria vesca subsp. vesca
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           205   1e-61   Suberites domuncula
gb|ERG79917.1|  60s ribosomal protein l5                                196   1e-58   
gb|EPZ34992.1|  60S ribosomal protein L5                                197   1e-58   Rozella allomycis CSF55
gb|KDD76608.1|  ribosomal L18p/L5e                                      196   3e-58   Helicosporidium sp. ATCC 50920
gb|KIY93440.1|  60S ribosomal protein L5                                192   8e-58   Monoraphidium neglectum
ref|XP_005536050.1|  60S ribosomal protein L5                           195   9e-58   Cyanidioschyzon merolae strain 10D
gb|AGH70151.1|  60S ribosomal protein L5                                191   3e-57   Placozoa sp. H4
gb|EJW84695.1|  60S ribosomal protein L5                                192   2e-56   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_001897856.1|  60S ribosomal protein L5                           192   2e-56   Brugia malayi [agent of lymphatic filariasis]
ref|NP_001104213.1|  uncharacterized protein LOC100126642               191   3e-56   Xenopus laevis [clawed frog]
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           191   3e-56   Saccoglossus kowalevskii
ref|XP_005643753.1|  60S ribosomal protein L5                           191   3e-56   Coccomyxa subellipsoidea C-169
ref|XP_004337717.1|  ribosomal L18p/L5e family                          191   4e-56   Acanthamoeba castellanii str. Neff
ref|XP_008049787.1|  PREDICTED: 60S ribosomal protein L5                188   4e-56   Carlito syrichta
gb|ABB29646.1|  ribosomal protein 5 large subunit                       186   5e-56   Suberites ficus
dbj|BAB33422.1|  putative senescence-associated protein                 190   5e-56   Pisum sativum [garden pea]
tpg|DAA34076.1|  TPA: 60S ribosomal protein L5                          188   6e-56   Amblyomma variegatum
ref|XP_002109848.1|  expressed hypothetical protein                     190   1e-55   Trichoplax adhaerens
ref|XP_005717676.1|  unnamed protein product                            189   1e-55   Chondrus crispus [carageen]
gb|ACZ13335.1|  60S ribosomal protein L5                                189   2e-55   Bursaphelenchus xylophilus [pine wilt nematode]
ref|XP_001421418.1|  Ribosomal protein L5A, component of cytosoli...    189   2e-55   Ostreococcus lucimarinus CCE9901
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 189   2e-55   Ixodes scapularis [blacklegged tick]
gb|ABO26701.1|  ribosomal protein l5                                    187   2e-55   Haliotis discus discus
gb|ACN25149.1|  ribosomal-like protein                                  188   2e-55   Pectinaria gouldii
ref|XP_006197385.1|  PREDICTED: 60S ribosomal protein L5                189   2e-55   Vicugna pacos
ref|XP_001689859.1|  ribosomal protein L5, component of cytosolic...    189   2e-55   Chlamydomonas reinhardtii
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           189   2e-55   Caenorhabditis briggsae
ref|XP_002949803.1|  component of cytosolic 80S ribosome and 60S ...    189   2e-55   Volvox carteri f. nagariensis
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      189   3e-55   Caenorhabditis brenneri
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      189   3e-55   Caenorhabditis briggsae
ref|NP_495811.1|  Protein RPL-5                                         189   3e-55   Caenorhabditis elegans [roundworm]
ref|XP_002588187.1|  hypothetical protein BRAFLDRAFT_113823             189   3e-55   Branchiostoma floridae
ref|XP_001634531.1|  predicted protein                                  189   3e-55   Nematostella vectensis
gb|KHJ46023.1|  ribosomal L18p/L5e family protein                       189   4e-55   Trichuris suis
ref|XP_010948703.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   Camelus bactrianus [camel]
ref|XP_007611466.1|  PREDICTED: 60S ribosomal protein L5                188   5e-55   
ref|XP_003505203.1|  PREDICTED: 60S ribosomal protein L5                188   5e-55   Cricetulus griseus [Chinese hamsters]
gb|ADV40159.1|  putative 60S ribosomal protein L5                       187   5e-55   Latrodectus hesperus [black widow]
ref|XP_006985881.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     188   5e-55   Peromyscus maniculatus bairdii
ref|XP_006985882.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     188   5e-55   Peromyscus maniculatus bairdii
ref|XP_005385097.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     188   6e-55   Chinchilla lanigera
ref|XP_005542773.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     188   6e-55   
ref|XP_004625113.1|  PREDICTED: 60S ribosomal protein L5-like           188   6e-55   Octodon degus
ref|XP_008070593.1|  PREDICTED: 60S ribosomal protein L5                188   6e-55   Carlito syrichta
ref|XP_003479207.1|  PREDICTED: 60S ribosomal protein L5                188   6e-55   Cavia porcellus [guinea pig]
ref|XP_005385096.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   7e-55   Chinchilla lanigera
gb|AAI09371.1|  Ribosomal protein L5                                    187   7e-55   Homo sapiens [man]
ref|XP_001515074.2|  PREDICTED: 60S ribosomal protein L5                187   7e-55   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007480368.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   8e-55   Monodelphis domestica
ref|XP_004884144.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   8e-55   
gb|EHH14955.1|  hypothetical protein EGK_00972                          187   8e-55   Macaca mulatta [rhesus macaque]
ref|NP_001107756.1|  60S ribosomal protein L5                           187   8e-55   Sus scrofa [pigs]
ref|XP_007533339.1|  PREDICTED: 60S ribosomal protein L5                187   8e-55   Erinaceus europaeus [common hedgehog]
ref|XP_004018480.1|  PREDICTED: 60S ribosomal protein L5-like           187   8e-55   Ovis aries [domestic sheep]
ref|XP_007934240.1|  PREDICTED: 60S ribosomal protein L5                187   8e-55   Orycteropus afer afer
ref|XP_004884145.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   8e-55   
ref|NP_000960.2|  60S ribosomal protein L5                              187   8e-55   Homo sapiens [man]
dbj|BAD96324.1|  ribosomal protein L5 variant                           187   8e-55   Homo sapiens [man]
ref|XP_004378798.1|  PREDICTED: 60S ribosomal protein L5                187   8e-55   Trichechus manatus latirostris
gb|AAX46329.1|  ribosomal protein L5                                    187   8e-55   Bos taurus [bovine]
ref|XP_007480367.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   8e-55   Monodelphis domestica
ref|XP_007169652.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   9e-55   
ref|XP_005983309.1|  PREDICTED: 60S ribosomal protein L5                187   9e-55   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006140244.1|  PREDICTED: 60S ribosomal protein L5                187   9e-55   
ref|NP_989912.1|  60S ribosomal protein L5                              187   9e-55   Gallus gallus [bantam]
ref|XP_003418527.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   9e-55   Loxodonta africana [African bush elephant]
ref|XP_008262168.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   9e-55   Oryctolagus cuniculus [domestic rabbit]
emb|CDS19989.1|  ribosomal protein l5                                   187   9e-55   
ref|XP_004620003.1|  PREDICTED: 60S ribosomal protein L5                186   9e-55   
ref|XP_010643208.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   9e-55   
ref|XP_007169651.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   9e-55   
ref|XP_005542775.1|  PREDICTED: 60S ribosomal protein L5 isoform X3     187   9e-55   
gb|KFD48731.1|  hypothetical protein M513_10361                         189   9e-55   
ref|XP_006728911.1|  PREDICTED: 60S ribosomal protein L5                187   9e-55   
pdb|4W20|D  Chain D, Structure Of The Mammalian 60s Ribosomal Sub...    187   9e-55   
ref|XP_006758248.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   9e-55   
emb|CDI98331.1|  ribosomal protein l5                                   187   1e-54   
gb|ELW72620.1|  60S ribosomal protein L5                                187   1e-54   
ref|XP_007110786.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   1e-54   
ref|XP_005610315.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   1e-54   
ref|XP_010596404.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   1e-54   
ref|XP_004319592.1|  PREDICTED: 60S ribosomal protein L5-like           187   1e-54   
ref|XP_004402579.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|NP_001182608.1|  60S ribosomal protein L5                           187   1e-54   
ref|XP_006093256.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   1e-54   
ref|XP_005610314.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   1e-54   
gb|KFM66007.1|  60S ribosomal protein L5-A                              186   1e-54   
ref|XP_010643206.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   1e-54   
ref|XP_009908172.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   1e-54   
ref|XP_004699318.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_008578547.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_005077452.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_005879039.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_003220130.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
dbj|BAD92217.1|  ribosomal protein L5 variant                           187   1e-54   
ref|XP_005153981.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_010973953.1|  PREDICTED: 60S ribosomal protein L5                189   1e-54   
ref|XP_003117386.1|  CRE-RPL-5 protein                                  187   1e-54   
ref|XP_005706768.1|  60S ribosomal protein L5e                          187   1e-54   
ref|XP_006265613.1|  PREDICTED: 60S ribosomal protein L5                187   2e-54   
ref|XP_007437567.1|  PREDICTED: 60S ribosomal protein L5                187   2e-54   
ref|NP_001079437.1|  60S ribosomal protein L5-B                         187   2e-54   
ref|XP_011399144.1|  60S ribosomal protein L5-1                         187   2e-54   
sp|P15125.2|RL5A_XENLA  RecName: Full=60S ribosomal protein L5-A        187   2e-54   
sp|P15126.2|RL5B_XENLA  RecName: Full=60S ribosomal protein L5-B        187   2e-54   
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       187   2e-54   
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           186   2e-54   
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              186   2e-54   
sp|Q26481.3|RL5_STYCL  RecName: Full=60S ribosomal protein L5           186   2e-54   
ref|XP_003391604.1|  PREDICTED: 60S ribosomal protein L5-like           182   2e-54   
ref|XP_006001656.1|  PREDICTED: 60S ribosomal protein L5                186   2e-54   
ref|XP_008578545.1|  PREDICTED: 60S ribosomal protein L5                186   2e-54   
gb|EPY76441.1|  60S ribosomal protein L5                                187   3e-54   
ref|XP_002675028.1|  predicted protein                                  186   3e-54   
emb|CCQ18634.1|  60S ribosomal protein L5                               186   3e-54   
ref|NP_112361.1|  60S ribosomal protein L5                              186   3e-54   
ref|XP_006250647.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     186   3e-54   
ref|XP_004417183.1|  PREDICTED: 60S ribosomal protein L5-like           186   3e-54   
gb|ERE68201.1|  60S ribosomal protein L5-like protein                   187   3e-54   
ref|XP_007233671.1|  PREDICTED: 60S ribosomal protein L5-like           186   3e-54   
ref|XP_004349238.1|  ribosomal protein L5                               186   3e-54   
ref|XP_006882544.1|  PREDICTED: 60S ribosomal protein L5                186   3e-54   
emb|CBX33183.1|  ribosomal protein L5                                   186   3e-54   
ref|NP_001270867.1|  60S ribosomal protein L5                           186   3e-54   
ref|XP_005298201.1|  PREDICTED: 60S ribosomal protein L5                186   3e-54   
ref|NP_001187210.1|  ribosomal protein L5b                              186   4e-54   
gb|ACD65156.1|  putative 60S ribosomal protein RPL5                     184   4e-54   
ref|XP_005346907.1|  PREDICTED: 60S ribosomal protein L5-like           186   4e-54   
ref|XP_009288765.1|  PREDICTED: 60S ribosomal protein L5                188   4e-54   
gb|ACD65111.1|  putative 60S ribosomal protein RPL5                     182   4e-54   
ref|XP_007058944.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     186   5e-54   
ref|XP_011283311.1|  PREDICTED: 60S ribosomal protein L5                187   5e-54   
gb|KDO24705.1|  hypothetical protein SPRG_10239                         186   5e-54   
ref|NP_001291805.1|  ribosomal protein L5                               186   5e-54   
ref|XP_009273931.1|  PREDICTED: 60S ribosomal protein L5                186   5e-54   
ref|XP_009680869.1|  PREDICTED: 60S ribosomal protein L5                186   5e-54   
emb|CEG01741.1|  Ribosomal protein L18/L5                               186   5e-54   
ref|XP_005482139.1|  PREDICTED: 60S ribosomal protein L5                186   6e-54   
ref|XP_008628716.1|  PREDICTED: 60S ribosomal protein L5                186   6e-54   
pdb|2ZKR|NN  Chain n, Structure Of A Mammalian Ribosomal 60s Subu...    185   6e-54   
ref|XP_005592505.1|  PREDICTED: 60S ribosomal protein L5-like           185   6e-54   
ref|XP_005422184.1|  PREDICTED: 60S ribosomal protein L5                186   6e-54   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   185   6e-54   
ref|XP_002751148.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     185   6e-54   
ref|XP_003973919.1|  PREDICTED: 60S ribosomal protein L5-like           187   7e-54   
ref|XP_009087107.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
ref|XP_001639289.1|  predicted protein                                  185   7e-54   
gb|AFM88682.1|  ribosomal protein L5                                    185   7e-54   
ref|XP_006093255.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     185   7e-54   
gb|ELR57120.1|  60S ribosomal protein L5                                185   7e-54   
gb|KFV85217.1|  60S ribosomal protein L5                                185   7e-54   
gb|ABX44805.1|  putative 60S ribosomal protein RP5L                     181   7e-54   
ref|XP_002501941.1|  predicted protein                                  185   7e-54   
ref|XP_003145913.1|  60S ribosomal protein L5                           185   8e-54   
gb|AFM88396.1|  ribosomal protein L5                                    185   8e-54   
ref|XP_008942395.1|  PREDICTED: 60S ribosomal protein L5                185   8e-54   
ref|XP_009959874.1|  PREDICTED: 60S ribosomal protein L5                185   8e-54   
gb|ACO09827.1|  60S ribosomal protein L5                                185   8e-54   
ref|XP_005521032.1|  PREDICTED: 60S ribosomal protein L5                185   8e-54   
ref|XP_010159869.1|  PREDICTED: 60S ribosomal protein L5                185   8e-54   
gb|AFM87418.1|  60S ribosomal protein L5-B                              185   8e-54   
gb|AFM86481.1|  ribosomal protein L5                                    185   8e-54   
ref|XP_009818493.1|  PREDICTED: 60S ribosomal protein L5                185   8e-54   
gb|KFO07226.1|  60S ribosomal protein L5                                185   8e-54   
ref|XP_008334234.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
ref|XP_010713879.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
gb|KFP17477.1|  60S ribosomal protein L5                                185   8e-54   
ref|NP_001279040.1|  ribosomal protein L5                               185   9e-54   
ref|XP_010196863.1|  PREDICTED: 60S ribosomal protein L5                185   9e-54   
gb|AFM88337.1|  ribosomal protein L5                                    185   9e-54   
gb|EOA96368.1|  60S ribosomal protein L5                                185   9e-54   
emb|CAD91421.1|  ribosomal protein L5                                   184   9e-54   
gb|AFM87650.1|  60S ribosomal protein L5-like protein                   185   9e-54   
ref|XP_003767272.1|  PREDICTED: 60S ribosomal protein L5                186   9e-54   
gb|ETE73605.1|  60S ribosomal protein L5                                185   9e-54   
ref|XP_004206528.1|  PREDICTED: 60S ribosomal protein L5-like           185   9e-54   
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             185   1e-53   
ref|XP_010291146.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_007882704.1|  PREDICTED: 60S ribosomal protein L5-like           185   1e-53   
ref|XP_004752780.1|  PREDICTED: 60S ribosomal protein L5                187   1e-53   
gb|ACO07680.1|  60S ribosomal protein L5                                185   1e-53   
ref|NP_001232619.1|  putative ribosomal protein L5                      185   1e-53   
ref|XP_009512323.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_010022288.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
gb|KFO98657.1|  60S ribosomal protein L5                                185   1e-53   
gb|KFO56565.1|  60S ribosomal protein L5                                185   1e-53   
gb|AFM85809.1|  ribosomal protein L5                                    185   1e-53   
gb|KFM02490.1|  60S ribosomal protein L5                                185   1e-53   
gb|AFM90058.1|  ribosomal protein L5                                    185   1e-53   
gb|AFM89421.1|  ribosomal protein L5                                    185   1e-53   
ref|XP_010303651.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
gb|KFO69584.1|  60S ribosomal protein L5                                184   1e-53   
gb|ABI26260.1|  ribosomal protein L5                                    184   1e-53   
ref|XP_005026595.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_007641146.1|  PREDICTED: 60S ribosomal protein L5                184   1e-53   
ref|NP_001079377.1|  60S ribosomal protein L5-A                         184   1e-53   
ref|XP_009963721.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_009075975.1|  PREDICTED: 60S ribosomal protein L5                184   1e-53   
gb|AFM87698.1|  60S ribosomal protein L5-A                              184   1e-53   
ref|XP_005727289.1|  PREDICTED: 60S ribosomal protein L5-like           184   1e-53   
ref|XP_010005060.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_006790548.1|  PREDICTED: 60S ribosomal protein L5-like           184   1e-53   
ref|XP_006021921.1|  PREDICTED: 60S ribosomal protein L5                184   1e-53   
ref|XP_006534747.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     184   1e-53   
ref|XP_003283302.1|  60S ribosomal protein L5                           184   1e-53   
ref|XP_009920773.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|NP_058676.1|  60S ribosomal protein L5                              184   1e-53   
ref|XP_005445628.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_004552954.1|  PREDICTED: 60S ribosomal protein L5-like           184   1e-53   
ref|XP_008489183.1|  PREDICTED: 60S ribosomal protein L5                185   1e-53   
ref|XP_007073490.1|  PREDICTED: 60S ribosomal protein L5-like           188   1e-53   
ref|XP_005985559.1|  PREDICTED: 60S ribosomal protein L5-like           184   1e-53   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           184   1e-53   
ref|XP_005690639.1|  PREDICTED: 60S ribosomal protein L5-like           183   2e-53   
emb|CAG05644.1|  unnamed protein product                                184   2e-53   
ref|XP_009554761.1|  PREDICTED: 60S ribosomal protein L5                184   2e-53   
sp|O22608.1|RL5_DUNSA  RecName: Full=60S ribosomal protein L5           183   2e-53   
gb|EDL14330.1|  mCG1026389                                              184   2e-53   
ref|XP_537074.4|  PREDICTED: 60S ribosomal protein L5 isoform 1         187   2e-53   
ref|XP_011354001.1|  PREDICTED: 60S ribosomal protein L5                185   2e-53   
ref|XP_010581057.1|  PREDICTED: 60S ribosomal protein L5                185   2e-53   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     184   2e-53   
gb|KHG14330.1|  60S ribosomal L5                                        183   2e-53   
ref|XP_005451204.1|  PREDICTED: 60S ribosomal protein L5-like           184   2e-53   
ref|XP_007235270.1|  PREDICTED: 60S ribosomal protein L5-like           184   2e-53   
ref|NP_001030383.1|  60S ribosomal protein L5                           184   2e-53   
dbj|BAF98650.1|  ribosomal protein L5                                   184   2e-53   
ref|XP_008406082.1|  PREDICTED: 60S ribosomal protein L5                186   2e-53   
dbj|BAE31169.1|  unnamed protein product                                184   2e-53   
gb|ELK34439.1|  60S ribosomal protein L5                                185   2e-53   
ref|XP_010732697.1|  PREDICTED: 60S ribosomal protein L5                185   2e-53   
ref|XP_006727091.1|  PREDICTED: 60S ribosomal protein L5-like           182   2e-53   
ref|XP_005806012.1|  PREDICTED: 60S ribosomal protein L5-like           185   2e-53   
ref|XP_009939484.1|  PREDICTED: 60S ribosomal protein L5                185   3e-53   
gb|AFM89559.1|  ribosomal protein L5                                    184   3e-53   
emb|CDW60565.1|  Ribosomal L18p and Ribosomal L18 c domain contai...    184   3e-53   
ref|XP_004848203.1|  PREDICTED: 60S ribosomal protein L5-like           184   3e-53   
gb|ACH70882.1|  Ribosomal protein L5b                                   184   3e-53   
ref|XP_004589426.1|  PREDICTED: 60S ribosomal protein L5-like           184   3e-53   
gb|AFM86790.1|  60S ribosomal protein L5-A                              184   3e-53   
tpg|DAA23524.1|  TPA: ribosomal protein L5-like                         183   3e-53   
ref|XP_005050402.1|  PREDICTED: 60S ribosomal protein L5                184   3e-53   
ref|XP_010870379.1|  PREDICTED: 60S ribosomal protein L5                184   3e-53   
gb|KGL78260.1|  60S ribosomal protein L5                                183   3e-53   
gb|EMP36618.1|  60S ribosomal protein L5                                184   3e-53   
ref|XP_004018164.1|  PREDICTED: 60S ribosomal protein L5-like           186   3e-53   
ref|XP_004635786.1|  PREDICTED: 60S ribosomal protein L5                183   4e-53   
ref|XP_007058943.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     183   4e-53   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                183   4e-53   
ref|NP_988881.1|  ribosomal protein L5                                  183   4e-53   
gb|KFM05083.1|  60S ribosomal protein L5                                183   4e-53   
ref|NP_001187035.1|  ribosomal protein L5a                              183   4e-53   
ref|XP_006114225.1|  PREDICTED: 60S ribosomal protein L5                183   4e-53   
ref|XP_009580381.1|  PREDICTED: 60S ribosomal protein L5                186   4e-53   
ref|NP_001279541.1|  60S ribosomal protein L5-like                      183   4e-53   
gb|AFM86403.1|  60S ribosomal protein L5-A                              183   4e-53   
ref|XP_004468431.1|  PREDICTED: 60S ribosomal protein L5-like           183   4e-53   
ref|XP_009883197.1|  PREDICTED: 60S ribosomal protein L5                185   4e-53   
ref|XP_004002245.1|  PREDICTED: 60S ribosomal protein L5                183   4e-53   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     183   4e-53   
gb|ACN10317.1|  60S ribosomal protein L5                                183   5e-53   
gb|ACI34044.1|  60S ribosomal protein L5                                183   5e-53   
ref|NP_001002106.1|  ribosomal protein L5                               183   5e-53   
gb|KGG50093.1|  60S ribosomal protein L5-2                              184   5e-53   
ref|XP_010339421.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    183   5e-53   
gb|ACH70844.1|  ribosomal protein L5a                                   183   5e-53   
gb|KFZ66474.1|  60S ribosomal protein L5                                183   5e-53   
gb|KGO46596.1|  Ribosomal protein L5 eukaryotic/L18 archaeal, C-t...    183   5e-53   
ref|XP_010214453.1|  PREDICTED: 60S ribosomal protein L5                183   5e-53   
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           181   5e-53   
gb|ACO07720.1|  60S ribosomal protein L5                                183   5e-53   
gb|ADO28300.1|  60S ribosomal protein l5                                183   5e-53   
gb|ADO29334.1|  60S ribosomal protein l5                                183   6e-53   
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  181   6e-53   
ref|XP_008143036.1|  PREDICTED: 60S ribosomal protein L5                182   6e-53   
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                182   6e-53   
gb|AER35073.1|  60S ribosomal protein L5                                182   6e-53   
ref|XP_008152973.1|  PREDICTED: 60S ribosomal protein L5                185   7e-53   
ref|XP_008295524.1|  PREDICTED: 60S ribosomal protein L5                184   7e-53   
ref|XP_007554751.1|  PREDICTED: 60S ribosomal protein L5                184   7e-53   
gb|ACI69521.1|  60S ribosomal protein L5                                182   7e-53   
ref|XP_008605837.1|  50S ribosomal protein L5e                          182   8e-53   
emb|CDQ77184.1|  unnamed protein product                                183   8e-53   
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   182   8e-53   
gb|AER57859.1|  60S ribosomal protein L5                                182   8e-53   
emb|CDQ74996.1|  unnamed protein product                                184   9e-53   
gb|KDR11979.1|  60S ribosomal protein L5                                182   9e-53   
emb|CDQ69914.1|  unnamed protein product                                183   1e-52   



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   273 bits (698),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EA GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLEANGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+E  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELPRYGL+VG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN++  GEDYSVEP EGRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP+YGL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EA+GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNTEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+E  GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+VSASIAGDMILASAYA+ELPRYGL+VG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQVVSASIAGDMILASAYANELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+E  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP+YGL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EA+GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP YGL+VG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPHYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN++  GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   265 bits (676),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP++GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EA+GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFA
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L KLEMA+EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L KLEMA+EYE
Sbjct  61   VAQIISASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   263 bits (671),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN+DI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP +GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN++  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   263 bits (671),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSASIAGDMILASAYA ELP +GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   ITQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN++  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   262 bits (670),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGDMILA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EY+
Sbjct  61   IAQILSASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   262 bits (670),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASI GD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM E+YE
Sbjct  61   TAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   262 bits (670),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+RAYFKR+QVKF+RRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFRRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L KLEM +EYE
Sbjct  61   TAQIISASITGDSVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLTKLEMDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   262 bits (670),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEY+
Sbjct  61   IAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQILSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F K QK+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFAKAQKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  53   AVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  232
            A TMAF+K QKT+AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTN
Sbjct  15   AWTMAFVKAQKTKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTN  74

Query  233  KDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAE  412
            KDIIAQI+SA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +
Sbjct  75   KDIIAQILSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDD  134

Query  413  EYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EY+GN+EATGEDYSVEP + RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  135  EYQGNLEATGEDYSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  194

Query  593  RFAG  604
            RFAG
Sbjct  195  RFAG  198



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +2

Query  8    FYFPPDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKN  187
            F+   D +     +G +   ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKN
Sbjct  3    FFLWHDKYQ--HCLGFILKVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKN  60

Query  188  KYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTG  367
            KYNTPKYRFVVRF+NKDI+AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTG
Sbjct  61   KYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTG  120

Query  368  lllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgal  547
            LLLARR+L+ LEM EEYEGNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGAL
Sbjct  121  LLLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGAL  180

Query  548  kgaldggldIPHSEKRFAG  604
            KGALDGGLDIPHS+KRFAG
Sbjct  181  KGALDGGLDIPHSDKRFAG  199



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP++GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EA+GEDYSVE  E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFA
Sbjct  121  GNPEASGEDYSVELAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            +  AF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNK
Sbjct  1    MLQAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNK  60

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
            D+ AQI+SASI GD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM E+
Sbjct  61   DVTAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDED  120

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKR  595
            YEGNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KR
Sbjct  121  YEGNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKR  180

Query  596  FAG  604
            FAG
Sbjct  181  FAG  183



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            +   F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNK
Sbjct  1    MCQGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNK  60

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
            DIIAQI+SA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EE
Sbjct  61   DIIAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEE  120

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKR  595
            Y+GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KR
Sbjct  121  YQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKR  180

Query  596  FAG  604
            FAG
Sbjct  181  FAG  183



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   259 bits (663),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   256 bits (655),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   259 bits (663),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K  K+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKALKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  KTRAY KRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTLKTRAYSKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  20   PDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNT  199
            P    A        M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNT
Sbjct  28   PKETQALLPFSPSAMVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNT  87

Query  200  PKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGllla  379
            PKYRFVVRF+NKDI+AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLA
Sbjct  88   PKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLA  147

Query  380  rrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgal  559
            RR+L+ LEM EEYEGNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGAL
Sbjct  148  RRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGAL  207

Query  560  dggldIPHSEKRFAG  604
            DGGLDIPHS+KRFAG
Sbjct  208  DGGLDIPHSDKRFAG  222



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGDM+LA+AY+HELP++GLEVG TNYAAAYCTGLLLARR L+KLEM EEYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM EEY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +2

Query  44   AIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  223
            A  AV MAF+K QKT+AYFKR+QV FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  49   APTAVAMAFVKAQKTKAYFKRYQVPFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVR  108

Query  224  FTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklE  403
            FT KDIIAQIVSASIAGD++LA+AY+HELP +GLEVG TNYAAAY TGLLLARR+L+KLE
Sbjct  109  FTKKDIIAQIVSASIAGDLVLAAAYSHELPHFGLEVGLTNYAAAYATGLLLARRVLKKLE  168

Query  404  MAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPH  583
            M EEYEGNVEATGEDYSVEPG+ RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH
Sbjct  169  MDEEYEGNVEATGEDYSVEPGDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  228

Query  584  SEKRFAG  604
            SEKRFAG
Sbjct  229  SEKRFAG  235



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELP+YGLEVG TNYAAAYCTGLLLARR+L  LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLNTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AY KR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTQKTKAYSKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQ++SASIAGD++LASAYAHELP+YGLEVG TNYAAAYCTGLLLARR+L+ LEM +EY+
Sbjct  61   CAQVISASIAGDLVLASAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGD++LASAYAHELPRYGLE+G TNYAAAYCTGLLLARR LQKLEM EEYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKR+QVK+KRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSQKTKAYFKRYQVKYKRRRVGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELP YGLE G TNYAAAYCTGLLLARR+L+ LEM EEY+
Sbjct  61   AAQIISASIAGDLVLASAYAHELPHYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEPGE RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGD++LASAYAHELPRYGLE+G TNYAAAYCTGLLLARR LQKLEM EEYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LASAYAHELPRYGLE G TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQITSASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASI GDM+LA+AYAHELP YGLEVG +NYAAAYCTGLLLARR+L+KLEM +EY+
Sbjct  61   VAQIVSASITGDMVLAAAYAHELPHYGLEVGLSNYAAAYCTGLLLARRVLKKLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LASAYAHELPRYGLE G TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIASASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM EEY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGL+VG TNYAAAYCTGLLLARR L+ LEM EEY+
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHYGLDVGLTNYAAAYCTGLLLARRTLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   257 bits (657),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP +GLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEA+GEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   257 bits (656),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS++RFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   257 bits (656),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  K RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+S++I+GD++LASAY+HELPRYGL VG TNYAA+YCTGLLLARR L+KLEM EEYE
Sbjct  61   VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEPGE RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D+PHSEKRFA
Sbjct  121  GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA+ K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSRAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAYAHELP YGL+ G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPHYGLDFGLTNYAAAYCTGLLLARRVLKTLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SA+I GDM+LASAY+HELP YGLE G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+S+EP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K +K++AYFKR++VKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSRKSKAYFKRYRVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPVESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGDM+LA+AY+HELP++GLEVG TNYAAAYCTGLLLARR L+KLEM EEYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EATGEDYSVEP E RRPFRALLDVGL+RTTTGN VFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+S+SIAGD++LASA+AHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEY+
Sbjct  61   VAQIISSSIAGDLVLASAFAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLD+PHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARRLL+ LEM EEYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARRLL+ LEM EEYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   256 bits (654),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  53   AVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  232
            A  M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTN
Sbjct  30   ASAMVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTN  89

Query  233  KDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAE  412
            KDIIAQI SASIAGD++LASAY+HELP YGLEVG TNYAAAYCTGLLLARR+L+ LEM  
Sbjct  90   KDIIAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDG  149

Query  413  EYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EYEGNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  150  EYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  209

Query  593  RFAG  604
            RFAG
Sbjct  210  RFAG  213



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  KTRAYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTLKTRAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   TAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATG+D+SVE  E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGDDFSVESAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LASAY+HELP YGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKTRAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKTRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ++ + I GD++LA+AY+HELP YGL+VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQVIHSRIVGDIVLAAAYSHELPCYGLDVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EATGEDYSVEPGE RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNTEATGEDYSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AY+HELP +GL+VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  5    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  64

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSASIAGDM+LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEGN
Sbjct  65   QIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  124

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP EGRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  125  VEATGEDFSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  183



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   254 bits (650),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+ SASIAGD +LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KL+M +EYE
Sbjct  61   IAQVSSASIAGDHVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLRKLDMDKEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVS+SIAGDM+LASAY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   TAQIVSSSIAGDMVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFA
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  88   MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  147

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  148  IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  207

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  208  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  267

Query  602  G  604
            G
Sbjct  268  G  268



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+ ASI+GD++LA+AY HELP YGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEPGE RRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEA+GED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAY+HELP YGLEVG TNYAAAYCTGLLLARR L+ LEM +EY+
Sbjct  61   VAQIVSASIAGDLVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRTLKMLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDNRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+R TNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRITNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVS+SIAGDMILA+AY+HELPRYGLEVG TNYAAAYCTGLL+ARR+L+KLEM +EYE
Sbjct  61   TAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFA
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  47   IGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRF  226
            +  +   F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF
Sbjct  60   VSGLKQVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRF  119

Query  227  TNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEM  406
            TNKDI AQI+SA+I GDM+LASAY+HELP YGLE G TNYAAAYCTGLLLARR+L+ LEM
Sbjct  120  TNKDITAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEM  179

Query  407  AEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHS  586
              EYEGNVEATGED+S+EP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS
Sbjct  180  DSEYEGNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS  239

Query  587  EKRFAG  604
            EKRFAG
Sbjct  240  EKRFAG  245



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD+
Sbjct  57   MAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDL  116

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIV ASIAGD++LASAYAHELPRYGLEVG TNYAAAYC GLLLARR+L++LEM  EYE
Sbjct  117  IAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYE  176

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  177  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFA  236

Query  602  G  604
            G
Sbjct  237  G  237



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EATGED+SVEP + RRPFRALLDVGLLRTTTGNR+FGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNTEATGEDFSVEPTDTRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ++SASIAGD++LA+A  HELPRYGLEVG TNYAAAYC GLLLARR+L+ LEM EEY+
Sbjct  61   IAQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATG D+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AY+HELP +GL+VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TT GNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAY+HELP+YGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAY HELPRYGLEVG T+YAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDIVLASAYGHELPRYGLEVGLTSYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  80   QKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVS  259
            QKT+AYFKR+QV+FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+AQIVS
Sbjct  37   QKTKAYFKRYQVQFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  96

Query  260  ASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEAT  439
            ASIAGD++LASAYAHELPRYGLE+G TNYAAAYCTGLLLARR+L++L+M EEYEGNVEAT
Sbjct  97   ASIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRVLKELQMDEEYEGNVEAT  156

Query  440  GEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            GEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAG
Sbjct  157  GEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAG  211



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            +  A++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNK
Sbjct  1    MVQAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNK  60

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
            D+IAQIV ASIAGD++LASAYAHELPRYGLEVG TNYAAAYC GLLLARR+L++LEM  E
Sbjct  61   DLIAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAE  120

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKR  595
            YEGNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KR
Sbjct  121  YEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKR  180

Query  596  FAG  604
            FAG
Sbjct  181  FAG  183



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGD++LA+AY+HELP +GLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQIVSASIAGDIVLAAAYSHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEA+GED+SVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPADTRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYCKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ AS+AGD+++A+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ AS+AGD+++A+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAHKSRAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+IAGD++L +AY+HELPRYGLE+G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSATIAGDVVLTAAYSHELPRYGLEIGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSA+I GD +LA+AYAHELP +GLEVG +NYAAAYCTGLLL+RR+L+ LEM EEYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLEVGLSNYAAAYCTGLLLSRRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SA+I GDMILASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM +EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGN VFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SA+I GDMILASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM +EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGN VFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSASIAGD +LA+AYA ELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ AS+AGD+++A+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFW84310.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=233

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
            AF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDII
Sbjct  4    AFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQ++SASIAGD++LA+A  HELPRYGLEVG TNYAAAYC GLLLARR+L+ LEM EEY+G
Sbjct  64   AQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQG  123

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            N+EATG D+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAG
Sbjct  124  NIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAG  183



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSA+I GD +LA+AYAHELP +GL+VG +NYAAAYCTGLLL+RR+L+KLEM EEYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLDVGLSNYAAAYCTGLLLSRRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QK++AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIIA
Sbjct  1    FVKSQKSKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  60

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSA+IAGD +LA+AY+HEL  YGLEVG TNYAAAYCTGLLL RR+L+KL++ +EY+GN
Sbjct  61   QIVSATIAGDRVLAAAYSHELRHYGLEVGLTNYAAAYCTGLLLGRRVLKKLDLDQEYKGN  120

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALD G+DIPHS+KRFAG
Sbjct  121  VEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAG  179



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  59   TMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD  238
            TM F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  30   TMVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKD  89

Query  239  IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEY  418
            I+AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEY
Sbjct  90   IVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEY  149

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            EGN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  150  EGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  209

Query  599  AG  604
            AG
Sbjct  210  AG  211



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  134  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP  313
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI+AQI+SASIAGD++LA+AYAHELP
Sbjct  28   EGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP  87

Query  314  RYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL  493
            RYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYEGNVEATGEDYSVEP E RRPFRAL
Sbjct  88   RYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRAL  147

Query  494  LDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  148  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  184



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSASIAGDM+LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEGN
Sbjct  64   QIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M FIK QK RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNT KYRFVVR TNKDI
Sbjct  1    MVFIKAQKPRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTAKYRFVVRSTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+S++IAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQIISSTIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E R PFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>gb|AFK41626.1| unknown [Lotus japonicus]
Length=207

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVF
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVF  159



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGL VG TNYAAAYCTGLLLARR+L+  E+ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLTVGLTNYAAAYCTGLLLARRILKYRELDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            Q++ ASIAGDM+LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EY+GN
Sbjct  64   QVIYASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGEDY+VEP E RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  VEATGEDYAVEPTESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AY+HELP YGLEVG TNYAAAYC GLLLARR+L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATG+D++VEP E RRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 175/199 (88%), Gaps = 4/199 (2%)
 Frame = +2

Query  8    FYFPPDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKN  187
            F   P  HS+ +     TM F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKN
Sbjct  8    FRLFPSLHSSPQQ----TMVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKN  63

Query  188  KYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTG  367
            KYNTPKYRFVVRFTNKDI+AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTG
Sbjct  64   KYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTG  123

Query  368  lllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgal  547
            LLLARR+L+ LEM +EYEGN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGAL
Sbjct  124  LLLARRVLKMLEMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGAL  183

Query  548  kgaldggldIPHSEKRFAG  604
            KGALDGGLDIPHS+KRFAG
Sbjct  184  KGALDGGLDIPHSDKRFAG  202



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDKEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRF+VRFTNKDIIA
Sbjct  4    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFIVRFTNKDIIA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSASI GD+ILA+AY+ ELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEGN
Sbjct  64   QIVSASITGDIILAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  VEATGEDFSVEPAEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   247 bits (631),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+VSA+IAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEA+GEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPSGERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+VSA+IAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEA+GEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   247 bits (630),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   247 bits (630),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKFRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEA+GED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F++ QK  AY+KRFQV+FKRRR+GKTDYRAR RLINQ+KNKY+TPKYRFVVRFTNKDI
Sbjct  1    MGFVRTQKANAYYKRFQVQFKRRRDGKTDYRARIRLINQEKNKYSTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGDM+LASAY+HELPRYGLEVG  NYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIMSASIAGDMVLASAYSHELPRYGLEVGLANYAAAYCTGLLLARRVLKLRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+ VEP +GRRPFRALLDVGL+RTTTGNRVF ALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFCVEPADGRRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKF+RRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFRRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNY-AAAYCTGlllarrllqklEMAEEY  418
             AQIVSASIAGD +LA+AYA ELP YGLEVG TNY AAAYCTGLLLARR+L+KLEM +EY
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAAYCTGLLLARRVLKKLEMDDEY  120

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            EGNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  121  EGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  180

Query  599  AG  604
            AG
Sbjct  181  AG  182



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  K+ AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKSNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  59   TMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD  238
            +  F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  8    SWVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKD  67

Query  239  IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEY  418
            I+AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEY
Sbjct  68   IVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEY  127

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            EGN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  128  EGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  187

Query  599  AG  604
            AG
Sbjct  188  AG  189



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ ++IAGD++LA+AY+HELP+YGLEVG TNYAAAYCTGLLLARR+L+ L+M  EYE
Sbjct  61   TAQIIHSTIAGDIVLAAAYSHELPKYGLEVGLTNYAAAYCTGLLLARRVLKTLQMDGEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAGERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AY+HELP YGLEVG TNYAAAYC GLLLARR+L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATG+D++VEP E RRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP YGL VG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPHYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  35   VFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  94

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYEG
Sbjct  95   AQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEG  154

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            N+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  155  NLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  214



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            V  AF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK
Sbjct  80   VYQAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNK  139

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
             I+AQI+SASIAGD++LA+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +E
Sbjct  140  FIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQE  199

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKR  595
            YEGNVEATGED+SVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KR
Sbjct  200  YEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKR  259

Query  596  FAG  604
            FAG
Sbjct  260  FAG  262



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  8    FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  67

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  68   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  127

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  128  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  187

Query  602  G  604
            G
Sbjct  188  G  188



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  78   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  137

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  138  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  197

Query  602  G  604
            G
Sbjct  198  G  198



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  26   VFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  85

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYEG
Sbjct  86   AQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEG  145

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            N+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  146  NLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  205



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEY 
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYG  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KDO51035.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=252

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVF
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVF  159



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   244 bits (624),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASI GD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIVGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYC GLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCAGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR VVRF+NKD+
Sbjct  1    MVFVKAQKTRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ A++AGD+++A+AY+ ELPRYGLEVG TNYAAAYCTGLLLARR+L++LEM EEY 
Sbjct  61   VAQIIYATLAGDVVMAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDEEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EA+GEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEASGEDYSVEPNDARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+ ASI+GD++LA+AY HELP YGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  58   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEPGE RRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFA
Sbjct  118  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFA  177

Query  602  G  604
            G
Sbjct  178  G  178



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  13   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  72

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYEGN
Sbjct  73   QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  132

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
             EATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  133  AEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAG  191



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGD++LAS+YAHELPRYGLEVG TNYAAAYCTGLLLARR+L++LEM  EYE
Sbjct  61   IAQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|KJB22673.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=197

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVF
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVF  159



>gb|KJB22670.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=171

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVF
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVF  159



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L    + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 3/184 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldgg---ldIPHSEK  592
            GNV ATGED+S+EP E RRPFRALLDVGL+RTTTGNRVFGALK         LDIPHS+K
Sbjct  121  GNVVATGEDFSIEPTESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDK  180

Query  593  RFAG  604
            RFAG
Sbjct  181  RFAG  184



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDII
Sbjct  94   VFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDII  153

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYEG
Sbjct  154  AQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEG  213

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            N EATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  214  NAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAG  273



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AY+KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   238 bits (607),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  134  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP  313
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+AQIVSA+IAGD +LA+AYAHEL 
Sbjct  1    EGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSATIAGDRVLAAAYAHELR  60

Query  314  RYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL  493
             YGLEVG TNYAAAYCTGLLL RR+L KL++ +EYEGNVEATGEDYSVEP E RRPFRAL
Sbjct  61   HYGLEVGLTNYAAAYCTGLLLGRRVLNKLDLDQEYEGNVEATGEDYSVEPAESRRPFRAL  120

Query  494  LDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            LDVGLLRTTTGNRVFGALKGALD G+DIPHS+KRFAG
Sbjct  121  LDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAG  157



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  58   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  118  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  177

Query  602  G  604
            G
Sbjct  178  G  178



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 170/181 (94%), Gaps = 3/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
             AF+K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV   TNK+I
Sbjct  9    FAFVKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---TNKNI  65

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGD++LA+AY++ELP+YGLEVG TNYAAAYCTGLL+ARR+L++LEM  EYE
Sbjct  66   IAQIVSASIAGDIVLAAAYSYELPQYGLEVGLTNYAAAYCTGLLVARRVLKQLEMDGEYE  125

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  126  GNVEATGEDFSVEPTENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIPHSEKRFA  185

Query  602  G  604
            G
Sbjct  186  G  186



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR-NRLINQDKNKYNTPKYRFVVRFTNKD  238
            M  +K Q +R Y  R+QVK++RRR+GKTDYRAR  RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  1    MVLVKPQNSRPYSMRYQVKYRRRRDGKTDYRARIRRLINQDKNKYNTPKYRFVVRFTNKD  60

Query  239  IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEY  418
            I AQ+VSASIAGD+ILA+AYAHELP+YGL VG TNY+AAYCTGLLLARR+L+  EM  EY
Sbjct  61   ITAQLVSASIAGDVILAAAYAHELPQYGLNVGLTNYSAAYCTGLLLARRVLKMFEMDAEY  120

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            EGN+EA+GED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  121  EGNLEASGEDFSVEPTENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  180

Query  599  AG  604
            AG
Sbjct  181  AG  182



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 167/185 (90%), Gaps = 4/185 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  422  GNVE----ATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            GN E    ATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+
Sbjct  121  GNAEVRLIATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSD  180

Query  590  KRFAG  604
            KRFAG
Sbjct  181  KRFAG  185



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK + YFKR+QVKF+RRREGKTDYRAR RLINQDKNKYN+PK+R+VVRFTNKDI
Sbjct  1    MVFVKPQKKQPYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNSPKFRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSA+I GD +LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IVQIVSATITGDNVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN EATGEDYSVEP E RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNAEATGEDYSVEPTETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
            AF+K+QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    AFVKLQKTHAYHKRFQVKFKRRRQGKTDYRARVRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
             QI  A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEG
Sbjct  63   CQIAYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRDLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            NVEA GEDYSVEP + RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAG
Sbjct  123  NVEAAGEDYSVEPSDERRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAG  182



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLE G TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  66

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLE G TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  67   QIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  126

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  127  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  185



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 179/197 (91%), Gaps = 1/197 (1%)
 Frame = +2

Query  14   FPPDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKY  193
             PP +   A   G+  M ++K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKY
Sbjct  14   LPPKSDLGAPKRGSA-MVYVKTQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKY  72

Query  194  NTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGll  373
            NTPKYRFVVRFTNKDIIAQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLL
Sbjct  73   NTPKYRFVVRFTNKDIIAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLL  132

Query  374  larrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkg  553
            LARR+L+ LEM EEYEGNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKG
Sbjct  133  LARRVLKMLEMDEEYEGNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKG  192

Query  554  aldggldIPHSEKRFAG  604
            ALDGGLDIPHS+KRFAG
Sbjct  193  ALDGGLDIPHSDKRFAG  209



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QKT+AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKTQKTKAYFKRYQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NK I
Sbjct  1    MAFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKHI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGDMILA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIISASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  1    MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + QIVSA+IAGD++LA+AYAHELP++GL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNV ATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ EEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  602  G  604
            G
Sbjct  178  G  178



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  602  G  604
            G
Sbjct  178  G  178



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 164/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M +IK QKTRAY KRFQVKFKRRR GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRRGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ EEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  602  G  604
            G
Sbjct  178  G  178



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  32   MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  91

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + QIVSA+IAGD++LA+AYAHELP++GL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  92   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  151

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GNV ATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  152  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  211

Query  602  G  604
            G
Sbjct  212  G  212



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 165/184 (90%), Gaps = 3/184 (2%)
 Frame = +2

Query  53   AVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  232
            A    +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TN
Sbjct  2    AAAPVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TN  58

Query  233  KDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAE  412
            KD+ AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ E
Sbjct  59   KDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDE  118

Query  413  EYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EYEGNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  119  EYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178

Query  593  RFAG  604
            RFAG
Sbjct  179  RFAG  182



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  E+ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN  ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  ++ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNYDLDDEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN +ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  E+ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN +ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   231 bits (590),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  E+ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            GN  ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  602  G  604
            G
Sbjct  181  G  181



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   229 bits (584),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct  7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L    + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct  4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA  60

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  61   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  120

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  121  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  179



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  164  RLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTN  343
            RLINQDKNKYNTPKYRFVVRF+NKDI+AQI SASI GD +LASAYAHELPRYGLEVG TN
Sbjct  30   RLINQDKNKYNTPKYRFVVRFSNKDIVAQITSASITGDTVLASAYAHELPRYGLEVGLTN  89

Query  344  YAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTT  523
            YAAAYCTGLLLARRLL+ LEM EEYEGNVEATGED+SVEP + RRPFRALLDVGL+RTTT
Sbjct  90   YAAAYCTGLLLARRLLKMLEMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTT  149

Query  524  GNRVFgalkgaldggldIPHSEKRFAG  604
            GNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  150  GNRVFGALKGALDGGLDIPHSEKRFAG  176



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A+IAGD+I+A+AYAHELPRYGL+VG TNYAAAYCTGLLLARRLL K+ MA+ YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            GN +  GEDY+VE   E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRF
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRF  180

Query  599  AG  604
            AG
Sbjct  181  AG  182



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A+IAGD+I+A+AYAHELPRYGL+VG TNYAAAYCTGLLLARRLL K+ MA+ YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            GN +  GEDY+VE   E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRF
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRF  180

Query  599  AG  604
            AG
Sbjct  181  AG  182



>ref|XP_004310188.1| PREDICTED: 60S ribosomal protein L5-2-like [Fragaria vesca subsp. 
vesca]
Length=171

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  176  QDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAA  355
            +DKNKYNTPKYRFVV FTNKDI+AQI+S++I+GD++LASAY+HELPRYGL VG TNYAA+
Sbjct  14   KDKNKYNTPKYRFVVCFTNKDIVAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAAS  73

Query  356  YCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRV  535
            YCTGLLLARR L+KLEM EEYEGN+EATGED+SVEPGE RRPFRALLDVGL+ TTTGNRV
Sbjct  74   YCTGLLLARRTLKKLEMDEEYEGNLEATGEDFSVEPGENRRPFRALLDVGLVLTTTGNRV  133

Query  536  FgalkgaldggldIPHSEKRFAG  604
            FGALKGALDGG+D+PHSEKRFAG
Sbjct  134  FGALKGALDGGIDVPHSEKRFAG  156



>sp|Q4KTI3.1|RL5_SUBDO RecName: Full=60S ribosomal protein L5 [Suberites domuncula]
 gb|AAX48835.1| L5 [Suberites domuncula]
Length=293

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DI
Sbjct  1    MPFVKVIKNKAYFKRYQVKFRRRREGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI+ A I GD +L SAYAHELPRYG++VG TNYAAAYCTGLLLARRLL  L +A++Y 
Sbjct  61   ICQIIYAKIEGDKVLVSAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTNLGLADKYA  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  +  GED++VE  G+G RPFRA LDVGL RTTTGNRVF A+KGA+DGG+DIPHS  RF
Sbjct  121  GQTDIDGEDFNVEHMGDGPRPFRAFLDVGLTRTTTGNRVFAAMKGAVDGGIDIPHSPSRF  180

Query  599  AG  604
             G
Sbjct  181  VG  182



>gb|ERG79917.1| 60s ribosomal protein l5 [Ascaris suum]
Length=258

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK KRRREGKTDY AR RL  QDKNKYNTPKYRF+VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRFIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+I+ +AY+HELPRYG++VG TNYAAAY TGLLLARR L KL MA+ Y+
Sbjct  61   IAQIAYSRIEGDVIVCAAYSHELPRYGIKVGLTNYAAAYATGLLLARRHLTKLNMADAYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G  E  GEDY+VE    R PFRA+LDVGL RTTTG ++F A+KG  DGG+DIPHSE RF 
Sbjct  121  GVEEVDGEDYNVEQEGERAPFRAVLDVGLARTTTGAKIFAAMKGVADGGIDIPHSETRFF  180

Query  602  G  604
            G
Sbjct  181  G  181



>gb|EPZ34992.1| 60S ribosomal protein L5 [Rozella allomycis CSF55]
Length=297

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K +AYFKRFQ K++RRREGKTDY AR RLI QDKNKYN+PKYR VVRFTNKDI
Sbjct  1    MPFVKEIKNKAYFKRFQTKYRRRREGKTDYYARKRLIIQDKNKYNSPKYRMVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+V A I GD+++ASAYAHELPRYG++VG TNYAAAYC GLLLARR+L K  +A +YE
Sbjct  61   ICQMVYARIQGDVVIASAYAHELPRYGVQVGLTNYAAAYCVGLLLARRVLTKFNLASKYE  120

Query  422  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  EA GE ++VE  E G RPF+A LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF
Sbjct  121  GQTEADGEIFNVEAIEDGPRPFKAYLDVGLRRTSTGARVFGAMKGAADGGIFIPHSEKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K  +Y+ R+QVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MPAMKVVKNSSYYSRYQVKYRRRREGKTDYRARLRLVTQDKNKYNTPKYRMVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + Q+  +++AGD+++ASAY+HELP+YGL VG TNYAAAY TGLLLARR+L K  +A+ Y 
Sbjct  61   VCQLAYSTLAGDVVVASAYSHELPKYGLTVGLTNYAAAYATGLLLARRVLSKYNLAKAYA  120

Query  422  GNVEATGEDYSVEPGEG-RRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            GN E  GEDY+VE  EG +RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHSEKRF
Sbjct  121  GNTEDVGEDYNVEEIEGEKRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSEKRF  180

Query  599  AG  604
             G
Sbjct  181  VG  182



>gb|KIY93440.1| 60S ribosomal protein L5 [Monoraphidium neglectum]
Length=199

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++KV KT AYF R+QVK++RRR+GKTDYRAR RL  QDKNKYNT KYR VVRF+NKD+
Sbjct  1    MGYVKVLKTSAYFSRYQVKYRRRRQGKTDYRARLRLCTQDKNKYNTHKYRLVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              Q+V ASIAGD+++A+AYAHELP+YGL VG  NYAAAYC GLLLARR+L K  +AE Y 
Sbjct  61   TCQVVYASIAGDVVVAAAYAHELPKYGLSVGLKNYAAAYCVGLLLARRVLTKFGLAEHYA  120

Query  422  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  GEDY+V+P E G RPF  LLD GL RT+TG++ F ALKGALDGGLDIPH+EKRF
Sbjct  121  GQEEPDGEDYNVDPVEDGPRPFSCLLDAGLKRTSTGSKTFAALKGALDGGLDIPHNEKRF  180

Query  599  AG  604
             G
Sbjct  181  VG  182



>ref|XP_005536050.1| 60S ribosomal protein L5 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM79764.1| 60S ribosomal protein L5 [Cyanidioschyzon merolae strain 10D]
Length=298

 Score =   195 bits (496),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+KV K +AYFKRFQVK +RRREGKTDY AR  LI  DK KYNTPKYR VVR TN D+
Sbjct  1    MAFVKVVKNKAYFKRFQVKPRRRREGKTDYHARRALIIVDKTKYNTPKYRLVVRITNSDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIV+A + GD ++A+AYAHELPRYG++VG TN+AAAY TGLL+ARR L  L +A+ Y+
Sbjct  61   ICQIVTARVEGDKVIAAAYAHELPRYGIKVGLTNFAAAYATGLLVARRTLTILGLADAYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G VEA GE Y VEP    RPFRA+LDVGL+RTTTG+RVF A+KGA+DGG+DIPHSEKRF
Sbjct  121  GKVEADGELYQVEPVGETRPFRAVLDVGLVRTTTGHRVFAAMKGAVDGGIDIPHSEKRF  179



>gb|AGH70151.1| 60S ribosomal protein L5, partial [Placozoa sp. H4]
Length=206

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK+KRRREGKTDY AR RL  QDKNKYNTPKYR VVR TNKD+
Sbjct  1    MTFVKVVKNKAYFKRFQVKYKRRREGKTDYFARKRLCTQDKNKYNTPKYRMVVRLTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI SA + GD I  +AY+HELPRYG+++G TNYAA YCTGLLLARR+L KL +A +Y 
Sbjct  61   ICQIASAKLEGDEIFCAAYSHELPRYGVKIGLTNYAACYCTGLLLARRVLTKLNLANKYV  120

Query  422  GNVEATGEDYSV-EPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  GED+ V EP EG R FR  LDVGL RTTTG R+FGALKGA+DGGL+IPH  KRF
Sbjct  121  GVEEVDGEDFEVEEPDEGARSFRCFLDVGLARTTTGARIFGALKGAVDGGLNIPHQHKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|EJW84695.1| 60S ribosomal protein L5 [Wuchereria bancrofti]
Length=295

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+++ SAY+HELPRYG++VG TNYA+AY TGLLLARR L  + +AE Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLNIGLAETYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHSE RF 
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGVDVPHSETRFF  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_001897856.1| 60S ribosomal protein L5 [Brugia malayi]
 emb|CDP94073.1| Protein BM-RPL-5, isoform b [Brugia malayi]
Length=295

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+++ SAY+HELPRYG++VG TNYA+AY TGLLLARR L  + +AE Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLNIGLAEAYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHSE RF 
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGIDVPHSETRFF  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|NP_001104213.1| uncharacterized protein LOC100126642 [Xenopus laevis]
 gb|AAI53791.1| LOC100126642 protein [Xenopus laevis]
Length=302

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 5/186 (3%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K+ K +AY+KRFQVK++RRREGKTDY AR RL+ Q KNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKLVKNKAYYKRFQVKYRRRREGKTDYYARKRLVAQSKNKYNTPKYRLVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+  A I GD I+A+AY+HELPRYG++VG TNYAA Y TGLL+ARRLL KL +A++YE
Sbjct  61   IAQVAYAKIEGDQIIAAAYSHELPRYGIKVGLTNYAACYATGLLVARRLLTKLGLADQYE  120

Query  422  GNVEAT--GED---YSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHS  586
            GN EA   GED   Y VE     RPFR  LDVGL+RTTTG +VF  +KGA+DGGLDIPH+
Sbjct  121  GNTEAAAPGEDGGLYHVEAEGDSRPFRCFLDVGLVRTTTGAKVFAVMKGAVDGGLDIPHN  180

Query  587  EKRFAG  604
            EKRF G
Sbjct  181  EKRFPG  186



>ref|XP_002736904.1| PREDICTED: 60S ribosomal protein L5-like [Saccoglossus kowalevskii]
Length=294

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+ +AYAHELPRYG++VG TNY+AAYCTGLL+ARRLL K E+A+ Y+
Sbjct  61   ICQVAYARIEGDIIICAAYAHELPRYGVKVGLTNYSAAYCTGLLVARRLLTKFELADLYK  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  G++Y+VE  +G+   FR  LDVGL RTTTG R+FG LKGA DGGLDIPHS KRF
Sbjct  121  GQEEVDGDEYTVESEDGKPGAFRCFLDVGLARTTTGARIFGCLKGAADGGLDIPHSVKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K+  Y  R+QVK++RRREGKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MGHVKVVKSGPYHSRYQVKYRRRREGKTDYRARLRLTTQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A++AGD+I+ASAY+HEL  YGL VG TNYAA Y TGLLLARR+L K  +A+ Y 
Sbjct  61   ICQVAYATVAGDVIVASAYSHELVNYGLSVGLTNYAATYATGLLLARRVLTKFGLADAYV  120

Query  422  GNVEATGEDYSVEPG-EGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  EATGEDY+VE   EG RPF ALLD GL RT+TG++VF ALKGALDGGLDIPHS+KRF
Sbjct  121  GQEEATGEDYNVEAAEEGPRPFTALLDTGLKRTSTGSKVFAALKGALDGGLDIPHSDKRF  180

Query  599  AG  604
             G
Sbjct  181  VG  182



>ref|XP_004337717.1| ribosomal L18p/L5e family [Acanthamoeba castellanii str. Neff]
 gb|ELR15704.1| ribosomal L18p/L5e family [Acanthamoeba castellanii str. Neff]
Length=291

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 148/183 (81%), Gaps = 2/183 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K R+YFKR+QVK++RRREGKTDY+ARN++I Q KNKYNTPKYR VVR TNKDI
Sbjct  1    MGFVKVVKNRSYFKRYQVKYRRRREGKTDYQARNKMIIQAKNKYNTPKYRLVVRVTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AY+HELPRYGL+ G TNYAA Y TGLLLARR L KL +AE+Y+
Sbjct  61   ICQIAYAKIKGDMIMTAAYSHELPRYGLKTGLTNYAACYATGLLLARRHLTKLNLAEKYQ  120

Query  422  GNVEATGEDYS--VEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKR  595
            G  E TGED+S  ++  EG +PF+A LD GL RT+TG ++F +LKGA DGGLDIPHS+ R
Sbjct  121  GKTEVTGEDWSYNLDEIEGPKPFKATLDSGLARTSTGAKLFASLKGACDGGLDIPHSDTR  180

Query  596  FAG  604
            FAG
Sbjct  181  FAG  183



>ref|XP_008049787.1| PREDICTED: 60S ribosomal protein L5, partial [Tarsius syrichta]
Length=199

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL    M + YE
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNSFGMDKTYE  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF
Sbjct  121  GQVEVTGDEYNVESVDGKAGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|ABB29646.1| ribosomal protein 5 large subunit, partial [Suberites ficus]
Length=145

 Score =   186 bits (471),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  134  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP  313
            EGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DII QIV A I GD +L SAYAHELP
Sbjct  2    EGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDIICQIVYAKIEGDKVLVSAYAHELP  61

Query  314  RYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVE-PGEGRRPFRA  490
            RYG++VG TNYAAAYCTGLLLARRLL  L +A +YEG  +  GED++VE  G+G RPFRA
Sbjct  62   RYGVKVGLTNYAAAYCTGLLLARRLLSNLGLAYKYEGQTDIDGEDFNVEHMGDGPRPFRA  121

Query  491  LLDVGLLRTTTGNRVF  538
             LDVGL RTTTGNRVF
Sbjct  122  FLDVGLTRTTTGNRVF  137



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +2

Query  182  KNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYC  361
            ++KYN P      RFTNKDI+AQIVSASIAGD++L +AYAHELP YGLEVG TNYAAAYC
Sbjct  22   QDKYNFPSI-VCCRFTNKDIVAQIVSASIAGDIVLCAAYAHELPHYGLEVGLTNYAAAYC  80

Query  362  TGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFg  541
            TGLLLARR+L+ LEM EEYEGNVEA+GEDYSVEP + RRPFRALLDVGL++TTTGNRVFG
Sbjct  81   TGLLLARRVLKTLEMDEEYEGNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFG  140

Query  542  alkgaldggldIPHSEKRFAG  604
            ALKGALDGGLDIPHS+KRFAG
Sbjct  141  ALKGALDGGLDIPHSDKRFAG  161



>tpg|DAA34076.1| TPA_exp: 60S ribosomal protein L5 [Amblyomma variegatum]
Length=210

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYN+PKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNSPKYRMIVRITNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+ +AYAHELPRYG+ +G TNY AAYCTGLLLARR+LQK ++ E Y+
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPRYGVRLGLTNYPAAYCTGLLLARRMLQKFKLDEVYK  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  EATGEDY VE  +G+   FR  LDVGL RTTTG R+FG LKGA+DGG+DIPHS KRF
Sbjct  121  GCEEATGEDYCVESEDGQPGAFRCFLDVGLARTTTGARIFGCLKGAVDGGMDIPHSNKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_002109848.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV28014.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=297

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK+KRRREGKTDY AR RL  QDKNKYN+PKYR VVR TNKD+
Sbjct  1    MTFVKVVKNKAYFKRFQVKYKRRREGKTDYFARKRLCTQDKNKYNSPKYRMVVRLTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A + GD I  +AY+HELPRYG++VG TNYAA YCTGLLLARR+L KL +A++Y 
Sbjct  61   ICQIACAKLEGDEIFCAAYSHELPRYGIKVGLTNYAACYCTGLLLARRVLTKLNLADKYV  120

Query  422  GNVEATGEDYSV-EPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  GED+ V EP EG R FR  LDVGL RTTTG R+FG LKGA+DGGL+IPH  KRF
Sbjct  121  GVEEPDGEDFEVEEPDEGARAFRCFLDVGLARTTTGARIFGTLKGAVDGGLNIPHQHKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_005717676.1| unnamed protein product [Chondrus crispus]
 emb|CDF37805.1| unnamed protein product [Chondrus crispus]
Length=296

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA +K  K +AY KR+Q K++RRREGKTDY+AR RL+ QDK KYN+P+YR VVRFTNKDI
Sbjct  1    MARVKFAKNKAYSKRYQTKWRRRREGKTDYQARRRLVTQDKRKYNSPRYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+V+A I GD IL SAYAHELPRYG++ G TN+AAAYC GLL ARR L KL + E Y+
Sbjct  61   ICQVVAARIQGDEILTSAYAHELPRYGIKHGLTNFAAAYCVGLLCARRHLSKLGLDELYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E +GE Y +E  + +RPF ALLD+GL RTTTG +VF  +KGA+DGG++IPH+EKRF
Sbjct  121  GVEEVSGEMYEIEEDDEKRPFTALLDIGLTRTTTGKKVFATMKGAVDGGMNIPHNEKRF  179



>gb|ACZ13335.1| 60S ribosomal protein L5 [Bursaphelenchus xylophilus]
Length=297

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K RAYFKRFQ K KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  1    MGLVKVVKNRAYFKRFQTKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD++++SAYAHELPRYG++VG TNYAAAY TGLLLARR L+ +++   Y+
Sbjct  61   IAQIAYSKIGGDVVVSSAYAHELPRYGIKVGLTNYAAAYATGLLLARRHLKSIKLDTLYK  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  GEDY+VE  G+   PF+A+LDVGL RTTTG +VF  +KG  DGG+++PHSE RF
Sbjct  121  GTEEVNGEDYNVEQEGDNPNPFQAVLDVGLARTTTGAKVFAVMKGVADGGINVPHSESRF  180

Query  599  AG  604
             G
Sbjct  181  YG  182



>ref|XP_001421418.1| Ribosomal protein L5A, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001421449.1| Ribosomal protein L5B, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99711.1| Ribosomal protein L5A, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99742.1| Ribosomal protein L5B, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=300

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +2

Query  77   VQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIV  256
            V KT AYF RFQVKF RRR GKTDY AR RLI QDKNKYN+PKYRFVVRFTN+D+I Q+V
Sbjct  13   VAKTNAYFSRFQVKFARRRAGKTDYYARQRLITQDKNKYNSPKYRFVVRFTNRDVICQVV  72

Query  257  SASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEA  436
             A++AGD+ +ASAY+HELP+YG++ G TNYAA Y TGLL ARRLL K  +A+ YEG  E 
Sbjct  73   YATLAGDVCIASAYSHELPKYGMKAGLTNYAATYATGLLCARRLLTKYGLADAYEGKTED  132

Query  437  TGEDYSVEPG-EGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFAG  604
             GEDY VE G E  RPF+  LD GL+RT+TG RVF ALKGA+DGGLDIPH+EKRFAG
Sbjct  133  LGEDYHVEQGDEEARPFKCFLDTGLVRTSTGARVFAALKGAVDGGLDIPHNEKRFAG  189



>ref|XP_002434050.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
 gb|EEC05450.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
Length=297

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNTPKYRMIVRITNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+ +AYAHELPRYG+++G TNYAAAYCTGLLLARR+LQK ++ E Y+
Sbjct  61   ICQVAYARIEGDVIVCAAYAHELPRYGVKLGLTNYAAAYCTGLLLARRMLQKFKLDEIYK  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  EA GEDY VE  +G+   FR  LDVGL RTTTG R+FGALKGA+DGG+DIPHS KRF
Sbjct  121  GQEEANGEDYCVESIDGQPGAFRCFLDVGLARTTTGARIFGALKGAVDGGMDIPHSNKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|ABO26701.1| ribosomal protein l5 [Haliotis discus discus]
Length=251

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKF+RRREG+TDY AR RLI Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGRTDYFARKRLIFQEKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+A+AY+HELPRYG++VG TNYAAAYCTGLLLARRLLQKL++   Y 
Sbjct  61   ICQIAYARIEGDIIIAAAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLQKLKLDSIYT  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  EA GE+Y VE  +G+   FRA LD+GL+RTTTG RVFGALKGA+DGG+DIPHS KRF
Sbjct  121  GVEEANGEEYYVEDEDGKPGAFRAYLDIGLVRTTTGARVFGALKGAVDGGIDIPHSMKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|ACN25149.1| ribosomal-like protein [Pectinaria gouldii]
Length=269

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+KVQKT AYF R+QVKFKRRREGKTDY AR RLI QDKNKYNTPKYR +VRFTNKDII
Sbjct  3    GFVKVQKTTAYFSRYQVKFKRRREGKTDYFARKRLICQDKNKYNTPKYRLIVRFTNKDII  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
             QI  A IAGD I+ SAYAHELPRYGL+VG TNY+AAYCTGLL+ARR+L+KL + + YE 
Sbjct  63   TQIAYARIAGDFIICSAYAHELPRYGLKVGLTNYSAAYCTGLLMARRVLKKLNLDQVYEV  122

Query  425  NVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            N E   E+Y VEP +G   P +  LDVGL RT+TG ++F  LKGA DGGL+IPH  KRF 
Sbjct  123  NTEVQ-EEYHVEPKDGESDPLKVYLDVGLSRTSTGTKLFSVLKGASDGGLNIPHGTKRFI  181

Query  602  G  604
            G
Sbjct  182  G  182



>ref|XP_006197385.1| PREDICTED: 60S ribosomal protein L5 [Vicugna pacos]
Length=297

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR VVR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMVVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL +  M + YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF
Sbjct  121  GQVEVTGDEYNVESIDGQPSAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_001689859.1| ribosomal protein L5, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09597.1| ribosomal protein L5 [Chlamydomonas reinhardtii]
Length=293

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++KV KT  YF RFQVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTN+DI
Sbjct  1    MGYVKVIKTSPYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              QIV ++I GD++ A+AYAHELP YGLE G TNYAA YC GLL+ARR+L K  + + Y 
Sbjct  61   TCQIVRSTIKGDIVEAAAYAHELPDYGLECGLTNYAACYCVGLLVARRILTKFGLDKHYP  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  GEDY++EP  EG RPF  LLD GL RT+TG++VFG LKGALDGGLDIPH+EKR 
Sbjct  121  GQTEPDGEDYNIEPVEEGPRPFFCLLDTGLKRTSTGSKVFGCLKGALDGGLDIPHNEKRL  180

Query  599  AG  604
             G
Sbjct  181  VG  182



>sp|Q627R7.2|RL5_CAEBR RecName: Full=60S ribosomal protein L5 [Caenorhabditis briggsae]
 emb|CAP22065.2| Protein CBR-RPL-5 [Caenorhabditis briggsae]
Length=294

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAYAHELPRYGL+ G TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002949803.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49355.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=293

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++KV KT AYF RFQVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRF+N+D+
Sbjct  1    MGYVKVVKTSAYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFSNRDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              QIV ++I GD++ A+AYAHELP YGL+ G TNY++ YC GLL+ARR+L K  +AE Y 
Sbjct  61   TCQIVRSTIKGDIVEAAAYAHELPDYGLKAGLTNYSSCYCVGLLVARRILTKFNLAEHYP  120

Query  422  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  GED++V+P E G RPF  LLD GL RT+TG++VF  LKGALDGGLDIPH+EKRF
Sbjct  121  GQEEPDGEDFNVDPVEDGPRPFYCLLDTGLKRTSTGSKVFACLKGALDGGLDIPHNEKRF  180

Query  599  AG  604
             G
Sbjct  181  VG  182



>gb|EGT59634.1| hypothetical protein CAEBREN_19650 [Caenorhabditis brenneri]
Length=293

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAYAHELPRYGL+ G TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002630158.1| C. briggsae CBR-RPL-5 protein [Caenorhabditis briggsae]
Length=297

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  4    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  63

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAYAHELPRYGL+ G TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  64   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  123

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  124  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  183

Query  602  G  604
            G
Sbjct  184  G  184



>ref|NP_495811.1| Protein RPL-5 [Caenorhabditis elegans]
 sp|P49405.1|RL5_CAEEL RecName: Full=60S ribosomal protein L5 [Caenorhabditis elegans]
 emb|CAA90251.1| RPL-5 [Caenorhabditis elegans]
Length=293

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAY+HELPRYGL+VG TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYSHELPRYGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRFA  601
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  602  G  604
            G
Sbjct  181  G  181



>ref|XP_002588187.1| hypothetical protein BRAFLDRAFT_113823 [Branchiostoma floridae]
 gb|EEN44198.1| hypothetical protein BRAFLDRAFT_113823 [Branchiostoma floridae]
Length=322

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKF+RRREG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+++AYAHELPRYG++VG TNYAAAYCTGLLLARR+L+K  +   YE
Sbjct  61   ICQVAYARIEGDIIVSAAYAHELPRYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYE  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  +  G++Y+VE  +G+ RPFR  LDVGL+RT+TG RVFGA+KGA+DGGLDIPHS KRF
Sbjct  121  GCTDIDGDEYNVEEVDGQPRPFRCFLDVGLVRTSTGARVFGAMKGAVDGGLDIPHSTKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_001634531.1| predicted protein [Nematostella vectensis]
 gb|EDO42468.1| predicted protein [Nematostella vectensis]
Length=296

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARKRLITQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              QI  A + GD+I+ +AYAHELPRYG++VG TNYAAAYCTGLLLARRLL KL + E Y 
Sbjct  61   TCQIAYAKLEGDVIICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYT  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  E  G++Y+VE  +G    FR  LDVGL RT+TG RVFGALKGA+DGGL+IPHS KRF
Sbjct  121  GTEEVNGDEYNVESIDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPHSMKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|KHJ46023.1| ribosomal L18p/L5e family protein [Trichuris suis]
Length=305

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRR+GKTDY+AR  L+ QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGFLKVVKNKAYFKRYQVKFRRRRQGKTDYQARRFLVVQDKNKYNTPKYRLIVRITNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A I GD++L SAY+HELPRYG++VG TNYAAAYCTGLLLARR L+K  +   Y+
Sbjct  61   VAQIAYAKIGGDVVLTSAYSHELPRYGVKVGLTNYAAAYCTGLLLARRHLKKRNLDSVYK  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G  EATGEDY+VE  EG+   FR  LDVGL RTTTG+RVFG +KGA+DGGLDIPH  +RF
Sbjct  121  GVEEATGEDYNVESEEGQPGAFRCFLDVGLARTTTGSRVFGVMKGAVDGGLDIPHEHRRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_010948703.1| PREDICTED: 60S ribosomal protein L5 [Camelus bactrianus]
Length=329

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +2

Query  35   AAEAIGAV--TMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKY  208
            A+  +G++   M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKY
Sbjct  22   ASRGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKY  81

Query  209  RFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrl  388
            R VVR TN+DII QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRL
Sbjct  82   RMVVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRL  141

Query  389  lqklEMAEEYEGNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldg  565
            L +  M + YEG VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DG
Sbjct  142  LNRFGMDKIYEGQVEVTGDEYNVESIDGQPSAFTCYLDAGLARTTTGNKVFGALKGAVDG  201

Query  566  gldIPHSEKRFAG  604
            GL IPHS KRF G
Sbjct  202  GLSIPHSTKRFPG  214



>ref|XP_007611466.1| PREDICTED: 60S ribosomal protein L5 [Cricetulus griseus]
Length=297

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QV+F+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL +  M + YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF
Sbjct  121  GQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>ref|XP_003505203.1| PREDICTED: 60S ribosomal protein L5 [Cricetulus griseus]
 gb|EGW05788.1| 60S ribosomal protein L5 [Cricetulus griseus]
Length=297

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QV+F+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL +  M + YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF
Sbjct  121  GQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



>gb|ADV40159.1| putative 60S ribosomal protein L5 [Latrodectus hesperus]
Length=281

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K ++YFKRFQVKF+RRREGKTDY AR +L+ QDKNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVIKNKSYFKRFQVKFRRRREGKTDYYARVKLVVQDKNKYNTPKYRMIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+ +AYAHELPRYG++VG TNYAAAYC GLLLARRLL K +M E Y+
Sbjct  61   ITQIAYARIEGDVIVCAAYAHELPRYGIKVGLTNYAAAYCVGLLLARRLLHKFKMGEIYQ  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKRF  598
            G VEA GED+ VE  +G+   FR  LDVGL +TTTG ++FGA+KGA+DGGLDIPHS KRF
Sbjct  121  GLVEANGEDFCVEDVDGQPGAFRCYLDVGLAKTTTGAKIFGAMKGAVDGGLDIPHSNKRF  180

Query  599  AG  604
             G
Sbjct  181  PG  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370