BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014M05

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    204   1e-60   Nicotiana tomentosiformis
emb|CDP04798.1|  unnamed protein product                                204   1e-60   Coffea canephora [robusta coffee]
ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    201   1e-59   Nicotiana sylvestris
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    201   2e-59   Solanum lycopersicum
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    199   6e-59   Solanum tuberosum [potatoes]
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    193   1e-56   Sesamum indicum [beniseed]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    193   3e-56   Sesamum indicum [beniseed]
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         186   5e-54   Jatropha curcas
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    183   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    182   3e-52   Eucalyptus grandis [rose gum]
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    182   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73289.1|  hypothetical protein M569_01466                         179   2e-51   Genlisea aurea
ref|XP_002515557.1|  conserved hypothetical protein                     179   2e-51   
ref|XP_010110340.1|  GTP-binding nuclear protein                        184   2e-51   
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    179   5e-51   Nelumbo nucifera [Indian lotus]
emb|CBI20999.3|  unnamed protein product                                175   6e-51   Vitis vinifera
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    178   7e-51   Nelumbo nucifera [Indian lotus]
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    178   8e-51   Arabis alpina [alpine rockcress]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    177   2e-50   Elaeis guineensis
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    177   2e-50   Fragaria vesca subsp. vesca
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               177   3e-50   Gossypium arboreum [tree cotton]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             176   4e-50   Capsella rubella
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    176   6e-50   Pyrus x bretschneideri [bai li]
gb|KJB80693.1|  hypothetical protein B456_013G110800                    176   6e-50   Gossypium raimondii
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    176   7e-50   
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    176   7e-50   Pyrus x bretschneideri [bai li]
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    176   7e-50   Phoenix dactylifera
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    176   7e-50   Vitis vinifera
emb|CDX85713.1|  BnaA02g01000D                                          176   7e-50   
gb|ABK94923.1|  unknown                                                 175   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             175   8e-50   Prunus persica
gb|KJB07802.1|  hypothetical protein B456_001G045200                    176   8e-50   Gossypium raimondii
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    175   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    175   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             176   2e-49   
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               173   2e-49   Erythranthe guttata [common monkey flower]
emb|CDX91217.1|  BnaC02g03800D                                          174   2e-49   
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    174   3e-49   Brassica rapa
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    174   3e-49   Populus euphratica
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             174   3e-49   
gb|KHG29602.1|  Allergen Act d 3                                        174   4e-49   Gossypium arboreum [tree cotton]
ref|NP_196703.1|  uncharacterized protein                               174   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63507.1|  unknown                                                 174   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31807.1|  unknown protein                                         174   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    173   6e-49   Camelina sativa [gold-of-pleasure]
gb|AFK49528.1|  unknown                                                 168   6e-49   Medicago truncatula
gb|KJB07801.1|  hypothetical protein B456_001G045200                    173   6e-49   Gossypium raimondii
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    173   7e-49   Prunus mume [ume]
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    173   8e-49   Citrus sinensis [apfelsine]
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             172   9e-49   Citrus clementina [clementine]
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    172   1e-48   Brassica rapa
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    172   1e-48   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX97108.1|  BnaC09g45170D                                          172   1e-48   
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    172   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             172   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    172   2e-48   Populus euphratica
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    171   3e-48   Brassica rapa
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    171   3e-48   Glycine max [soybeans]
gb|ACU22840.1|  unknown                                                 166   4e-48   Glycine max [soybeans]
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    171   4e-48   Elaeis guineensis
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             171   6e-48   
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    171   8e-48   
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             170   1e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  170   1e-47   Theobroma cacao [chocolate]
gb|AAM61720.1|  unknown                                                 170   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     170   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06839.1|  AT5g25460/F18G18_200                                    169   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAB41813.1|  unknown protein                                         170   2e-47   Medicago sativa [alfalfa]
gb|ACU17881.1|  unknown                                                 167   2e-47   Glycine max [soybeans]
gb|AES58962.2|  plant/F18G18-200 protein                                169   2e-47   Medicago truncatula
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  170   2e-47   
gb|KHN06654.1|  hypothetical protein glysoja_037506                     169   2e-47   Glycine soja [wild soybean]
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    168   2e-47   Populus euphratica
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    169   3e-47   
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    169   3e-47   Cucumis sativus [cucumbers]
gb|ACJ84308.1|  unknown                                                 169   3e-47   Medicago truncatula
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             168   4e-47   Phaseolus vulgaris [French bean]
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    168   4e-47   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       168   5e-47   Triticum urartu
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    168   6e-47   Tarenaya hassleriana [spider flower]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             167   6e-47   
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    167   8e-47   Cicer arietinum [garbanzo]
ref|NP_001053188.1|  Os04g0494600                                       167   1e-46   
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    167   1e-46   Brassica rapa
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             167   1e-46   Eutrema salsugineum [saltwater cress]
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         167   2e-46   Jatropha curcas
gb|KHN44154.1|  hypothetical protein glysoja_031815                     166   2e-46   Glycine soja [wild soybean]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    166   2e-46   Arabis alpina [alpine rockcress]
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             166   3e-46   Capsella rubella
emb|CDY54909.1|  BnaC02g48660D                                          165   3e-46   Brassica napus [oilseed rape]
gb|KHG10708.1|  Allergen Act d 3                                        166   4e-46   Gossypium arboreum [tree cotton]
gb|KJB68131.1|  hypothetical protein B456_010G227400                    166   6e-46   Gossypium raimondii
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    165   6e-46   Phoenix dactylifera
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    165   6e-46   Vitis vinifera
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    165   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    165   7e-46   Camelina sativa [gold-of-pleasure]
gb|EMT04285.1|  hypothetical protein F775_14657                         165   7e-46   
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             165   8e-46   Prunus persica
ref|XP_002517567.1|  conserved hypothetical protein                     165   1e-45   Ricinus communis
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    165   1e-45   Oryza brachyantha
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    165   1e-45   Setaria italica
emb|CDX69757.1|  BnaA10g21060D                                          172   1e-45   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    165   1e-45   Zea mays [maize]
emb|CBI36253.3|  unnamed protein product                                165   1e-45   Vitis vinifera
emb|CDY19801.1|  BnaA09g04540D                                          164   2e-45   Brassica napus [oilseed rape]
ref|NP_001173996.1|  Os04g0494950                                       159   3e-45   
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             164   3e-45   
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    163   3e-45   Brassica rapa
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    163   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    163   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    163   4e-45   Citrus sinensis [apfelsine]
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    163   6e-45   Populus euphratica
emb|CAH67378.1|  OSIGBa0159F11.2                                        163   6e-45   Oryza sativa [red rice]
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    163   6e-45   Cicer arietinum [garbanzo]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    162   7e-45   Tarenaya hassleriana [spider flower]
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          163   7e-45   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              163   7e-45   
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    163   8e-45   
ref|NP_001053189.1|  Os04g0494800                                       162   8e-45   
emb|CAE01676.2|  OSJNBb0091E11.17                                       162   8e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    162   9e-45   Setaria italica
gb|EAY94676.1|  hypothetical protein OsI_16455                          162   9e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    162   1e-44   Brachypodium distachyon [annual false brome]
emb|CAH67292.1|  OSIGBa0103O01.10                                       162   1e-44   Oryza sativa [red rice]
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          162   1e-44   
gb|KHG21630.1|  Adenosylhomocysteinase                                  162   1e-44   Gossypium arboreum [tree cotton]
gb|EAZ31211.1|  hypothetical protein OsJ_15311                          159   2e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KHG06895.1|  Agmatine deiminase                                      161   2e-44   Gossypium arboreum [tree cotton]
emb|CDX68849.1|  BnaC01g06040D                                          161   2e-44   
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             161   2e-44   Citrus clementina [clementine]
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             161   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             160   3e-44   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          161   3e-44   Sorghum bicolor [broomcorn]
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              161   3e-44   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    161   3e-44   Zea mays [maize]
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    160   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          161   3e-44   
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    160   4e-44   Oryza brachyantha
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    161   4e-44   
gb|KJB70568.1|  hypothetical protein B456_011G080100                    160   4e-44   Gossypium raimondii
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    160   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    160   4e-44   Eucalyptus grandis [rose gum]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    160   4e-44   Glycine max [soybeans]
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    160   5e-44   Tarenaya hassleriana [spider flower]
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    160   5e-44   Tarenaya hassleriana [spider flower]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     160   5e-44   Glycine soja [wild soybean]
gb|AGV54541.1|  hypothetical protein                                    160   6e-44   Phaseolus vulgaris [French bean]
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    159   8e-44   
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    159   9e-44   
ref|XP_010088264.1|  hypothetical protein L484_005140                   160   1e-43   Morus notabilis
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    159   1e-43   Prunus mume [ume]
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    159   1e-43   Malus domestica [apple tree]
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             159   1e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    159   1e-43   Setaria italica
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  159   1e-43   Medicago truncatula
ref|NP_001053190.1|  Os04g0494900                                       159   2e-43   
gb|EAY74932.1|  hypothetical protein OsI_02826                          159   2e-43   Oryza sativa Indica Group [Indian rice]
emb|CAD41548.2|  OSJNBb0091E11.18                                       159   2e-43   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67377.1|  OSIGBa0159F11.1                                        159   2e-43   Oryza sativa [red rice]
emb|CAE01677.2|  OSJNBb0091E11.19                                       158   3e-43   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB21293.1|  unknown protein                                        158   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043549.2|  Os01g0611000                                       159   3e-43   
gb|KJB80694.1|  hypothetical protein B456_013G110800                    157   3e-43   Gossypium raimondii
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    158   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    158   3e-43   Populus euphratica
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             158   4e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    158   4e-43   Fragaria vesca subsp. vesca
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 158   5e-43   Theobroma cacao [chocolate]
dbj|BAE98407.1|  hypothetical protein                                   157   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567894.1|  uncharacterized protein                               157   6e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABK26874.1|  unknown                                                 152   7e-43   Picea sitchensis
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    157   7e-43   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             157   8e-43   Eutrema salsugineum [saltwater cress]
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    157   8e-43   Arabis alpina [alpine rockcress]
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          157   1e-42   
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    156   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010092662.1|  hypothetical protein L484_019736                   152   2e-42   Morus notabilis
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             156   2e-42   Capsella rubella
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    156   2e-42   Camelina sativa [gold-of-pleasure]
emb|CDY39990.1|  BnaC06g40680D                                          155   2e-42   Brassica napus [oilseed rape]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    157   2e-42   Brassica rapa
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    156   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    154   3e-42   Eucalyptus grandis [rose gum]
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    155   4e-42   
gb|EEE61252.1|  hypothetical protein OsJ_15312                          159   4e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06486.1|  hypothetical protein F775_26416                         155   4e-42   
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    154   9e-42   Malus domestica [apple tree]
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    154   1e-41   Brachypodium distachyon [annual false brome]
ref|XP_006646088.1|  PREDICTED: uncharacterized protein LOC102706903    152   1e-41   
dbj|BAK03627.1|  predicted protein                                      154   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    154   2e-41   Pyrus x bretschneideri [bai li]
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  152   2e-41   Citrus sinensis [apfelsine]
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    153   2e-41   Sesamum indicum [beniseed]
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    152   5e-41   Solanum lycopersicum
emb|CDX87297.1|  BnaA07g35760D                                          152   5e-41   
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    152   6e-41   
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    152   6e-41   Setaria italica
gb|ACG40327.1|  hypothetical protein                                    152   7e-41   Zea mays [maize]
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         152   7e-41   Zea mays [maize]
emb|CDY57694.1|  BnaA07g38340D                                          152   9e-41   Brassica napus [oilseed rape]
emb|CDY54317.1|  BnaC06g43150D                                          152   9e-41   Brassica napus [oilseed rape]
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          152   9e-41   Sorghum bicolor [broomcorn]
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    152   9e-41   Solanum tuberosum [potatoes]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               151   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    150   6e-40   Nicotiana tomentosiformis
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                149   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    148   2e-39   Nicotiana tomentosiformis
dbj|BAJ97095.1|  predicted protein                                      148   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    148   3e-39   Nicotiana sylvestris
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     148   3e-39   Glycine max [soybeans]
gb|EMS58461.1|  hypothetical protein TRIUR3_29087                       147   3e-39   Triticum urartu
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    148   3e-39   Nicotiana sylvestris
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    147   4e-39   Solanum lycopersicum
ref|NP_001145978.1|  hypothetical protein                               148   4e-39   Zea mays [maize]
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  146   5e-39   
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                147   5e-39   Erythranthe guttata [common monkey flower]
emb|CDO98108.1|  unnamed protein product                                147   5e-39   Coffea canephora [robusta coffee]
gb|EMT04284.1|  hypothetical protein F775_14656                         146   8e-39   
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          146   1e-38   
dbj|BAJ96954.1|  predicted protein                                      146   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    145   2e-38   Setaria italica
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             144   2e-38   
dbj|BAK03126.1|  predicted protein                                      145   4e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          144   5e-38   
ref|NP_001141282.1|  hypothetical protein precursor                     144   6e-38   Zea mays [maize]
ref|NP_001140426.1|  hypothetical protein precursor                     144   7e-38   Zea mays [maize]
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    143   1e-37   
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    144   1e-37   
gb|KHN07098.1|  hypothetical protein glysoja_023281                     142   2e-37   Glycine soja [wild soybean]
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    142   3e-37   Nicotiana sylvestris
emb|CAA22573.1|  putative protein                                       140   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    141   9e-37   Nicotiana tomentosiformis
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    140   2e-36   Solanum lycopersicum
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    140   4e-36   Setaria italica
gb|EEE56530.1|  hypothetical protein OsJ_05823                          139   5e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    137   1e-35   Fragaria vesca subsp. vesca
gb|EEC72709.1|  hypothetical protein OsI_06304                          137   2e-35   Oryza sativa Indica Group [Indian rice]
gb|ABR13280.1|  unknown protein                                         132   3e-35   Prunus dulcis [sweet almond]
gb|KHN07099.1|  hypothetical protein glysoja_023282                     136   4e-35   Glycine soja [wild soybean]
gb|EMT19274.1|  hypothetical protein F775_14136                         135   1e-34   
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       134   4e-34   Triticum urartu
emb|CDO98109.1|  unnamed protein product                                133   5e-34   Coffea canephora [robusta coffee]
ref|XP_003581384.1|  PREDICTED: uncharacterized protein LOC100823957    133   9e-34   Brachypodium distachyon [annual false brome]
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    132   1e-33   Cucumis sativus [cucumbers]
ref|NP_001046247.2|  Os02g0205200                                       132   3e-33   
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    131   5e-33   Fragaria vesca subsp. vesca
ref|XP_003581666.1|  PREDICTED: uncharacterized protein LOC100833858    131   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          131   6e-33   
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          130   8e-33   
emb|CDY28002.1|  BnaC05g44040D                                          130   8e-33   Brassica napus [oilseed rape]
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    130   9e-33   Brassica rapa
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             130   1e-32   Prunus persica
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    130   1e-32   Zea mays [maize]
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    129   2e-32   
gb|KJB70569.1|  hypothetical protein B456_011G080100                    129   2e-32   Gossypium raimondii
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    130   2e-32   Prunus mume [ume]
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    129   2e-32   Cucumis melo [Oriental melon]
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             129   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    128   5e-32   Malus domestica [apple tree]
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    128   5e-32   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    128   6e-32   Brassica rapa
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    127   8e-32   Tarenaya hassleriana [spider flower]
gb|EMS51275.1|  hypothetical protein TRIUR3_06876                       128   8e-32   Triticum urartu
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    127   9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    127   1e-31   Camelina sativa [gold-of-pleasure]
emb|CDY22149.1|  BnaC01g39520D                                          127   1e-31   Brassica napus [oilseed rape]
gb|ABK24630.1|  unknown                                                 127   2e-31   Picea sitchensis
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             126   2e-31   Capsella rubella
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    126   3e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001053191.2|  Os04g0495000                                       126   4e-31   
gb|EAY94679.1|  hypothetical protein OsI_16458                          126   4e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_566328.1|  germination-related protein                           125   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    125   5e-31   Eucalyptus grandis [rose gum]
dbj|BAJ94417.1|  predicted protein                                      125   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    125   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    125   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    125   7e-31   Elaeis guineensis
gb|ACN40837.1|  unknown                                                 125   8e-31   Picea sitchensis
ref|XP_002517797.1|  conserved hypothetical protein                     124   1e-30   Ricinus communis
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    124   1e-30   
gb|EMT25742.1|  hypothetical protein F775_05959                         124   1e-30   
ref|XP_003581665.1|  PREDICTED: uncharacterized protein LOC100833550    124   2e-30   
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         123   4e-30   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    122   9e-30   
ref|XP_003580050.1|  PREDICTED: uncharacterized protein LOC100841598    122   1e-29   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             122   2e-29   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    121   2e-29   
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    120   3e-29   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    120   4e-29   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    120   4e-29   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    120   5e-29   
gb|AGV54847.1|  hypothetical protein                                    120   5e-29   
gb|AGV54803.1|  hypothetical protein                                    120   5e-29   
ref|XP_007052493.1|  F17A17.37 protein                                  120   7e-29   
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          120   7e-29   
emb|CDP07813.1|  unnamed protein product                                120   7e-29   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    119   7e-29   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                119   1e-28   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    119   1e-28   
emb|CDX84311.1|  BnaC04g10730D                                          119   2e-28   
emb|CDY17255.1|  BnaA05g09330D                                          119   2e-28   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    119   2e-28   
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    118   2e-28   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             118   2e-28   
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    118   2e-28   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    118   3e-28   
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    118   3e-28   
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    118   3e-28   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    118   4e-28   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             117   4e-28   
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    118   4e-28   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    118   4e-28   
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             117   4e-28   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             117   5e-28   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    117   6e-28   
ref|XP_004134601.1|  PREDICTED: uncharacterized protein LOC101220961    117   6e-28   
gb|AFK48735.1|  unknown                                                 117   7e-28   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             117   8e-28   
ref|XP_007028767.1|  F17A17.37 protein                                  117   9e-28   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                117   9e-28   
ref|XP_002532070.1|  conserved hypothetical protein                     117   1e-27   
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    116   1e-27   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    116   1e-27   
ref|XP_006368102.1|  PREDICTED: uncharacterized protein LOC102603851    113   2e-27   
gb|KJB36028.1|  hypothetical protein B456_006G137000                    116   2e-27   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    116   2e-27   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    115   2e-27   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    115   2e-27   
ref|XP_010097437.1|  hypothetical protein L484_003208                   115   2e-27   
gb|KHG07966.1|  Imidazolonepropionase                                   115   2e-27   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             115   2e-27   
ref|XP_008439641.1|  PREDICTED: uncharacterized protein LOC103484373    115   3e-27   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    115   3e-27   
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    115   3e-27   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    115   3e-27   
gb|AFK49395.1|  unknown                                                 115   3e-27   
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             115   3e-27   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    115   3e-27   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    115   3e-27   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    115   3e-27   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  115   3e-27   
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   115   4e-27   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     115   4e-27   
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    115   4e-27   
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    115   4e-27   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    114   5e-27   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             114   6e-27   
ref|NP_180998.1|  uncharacterized protein                               114   7e-27   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    114   8e-27   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             114   8e-27   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         114   1e-26   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    114   1e-26   
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              114   1e-26   
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    114   1e-26   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                113   1e-26   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    113   1e-26   
ref|NP_001044289.1|  Os01g0756600                                       113   2e-26   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    113   2e-26   
gb|KJB24990.1|  hypothetical protein B456_004G171200                    113   2e-26   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    113   2e-26   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    115   2e-26   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    113   2e-26   
gb|EPS66311.1|  hypothetical protein M569_08463                         112   2e-26   
gb|KJB24991.1|  hypothetical protein B456_004G171200                    112   3e-26   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    112   3e-26   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             112   3e-26   
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    112   3e-26   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    112   3e-26   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    112   3e-26   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             112   4e-26   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    112   4e-26   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    112   4e-26   
emb|CBI30867.3|  unnamed protein product                                112   4e-26   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     114   4e-26   
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             112   4e-26   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             112   5e-26   
gb|KDO42201.1|  hypothetical protein CISIN_1g045875mg                   109   5e-26   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    112   6e-26   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    111   7e-26   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    111   7e-26   
emb|CDM84231.1|  unnamed protein product                                111   8e-26   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    111   9e-26   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                111   9e-26   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    111   1e-25   
gb|EEC73302.1|  hypothetical protein OsI_07475                          109   1e-25   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          110   1e-25   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          110   1e-25   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    110   1e-25   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    110   2e-25   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    110   2e-25   
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    110   2e-25   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    110   2e-25   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    110   2e-25   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    110   2e-25   
ref|NP_001143645.1|  hypothetical protein precursor                     110   3e-25   
gb|ACF86181.1|  unknown                                                 110   3e-25   
gb|ACG32132.1|  hypothetical protein                                    110   3e-25   
gb|EMT29323.1|  hypothetical protein F775_30539                         109   3e-25   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    109   4e-25   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    109   5e-25   
ref|XP_010665821.1|  PREDICTED: uncharacterized protein LOC104883071    109   5e-25   
ref|XP_002519690.1|  conserved hypothetical protein                     109   5e-25   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    108   6e-25   
emb|CDP19178.1|  unnamed protein product                                108   6e-25   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    108   7e-25   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    108   7e-25   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    108   7e-25   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    108   8e-25   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             108   8e-25   
ref|NP_001172996.1|  Os02g0527500                                       108   1e-24   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    108   1e-24   
gb|AAK74007.1|  At1g29980/T1P2_9                                        105   1e-24   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             107   1e-24   
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    109   1e-24   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    108   1e-24   
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    107   2e-24   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    107   2e-24   
ref|NP_974254.1|  germination-related protein                           107   2e-24   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    107   3e-24   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    107   3e-24   
gb|EEC71507.1|  hypothetical protein OsI_03789                          108   3e-24   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         107   3e-24   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    107   4e-24   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  106   4e-24   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    106   4e-24   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    106   4e-24   
gb|EMS50963.1|  hypothetical protein TRIUR3_30516                       108   4e-24   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              107   4e-24   
gb|EPS66859.1|  hypothetical protein M569_07917                         106   5e-24   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    106   5e-24   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    106   5e-24   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             106   6e-24   
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             106   6e-24   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    105   7e-24   
ref|NP_564344.1|  uncharacterized protein                               106   7e-24   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    105   8e-24   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            105   8e-24   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    105   8e-24   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    105   1e-23   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             105   1e-23   
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    104   2e-23   
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    105   2e-23   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    105   2e-23   
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    104   2e-23   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    104   2e-23   
emb|CDY06908.1|  BnaA04g24070D                                          104   2e-23   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             104   3e-23   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    104   3e-23   
gb|KHN11697.1|  hypothetical protein glysoja_006150                     104   3e-23   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             104   3e-23   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          104   3e-23   
ref|XP_010110985.1|  hypothetical protein L484_021680                   104   3e-23   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    104   3e-23   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    103   3e-23   
ref|NP_001051644.1|  Os03g0807700                                       103   3e-23   
gb|EMT25156.1|  hypothetical protein F775_26385                         103   4e-23   
emb|CDY26302.1|  BnaA09g26530D                                          103   4e-23   
ref|XP_010508665.1|  PREDICTED: uncharacterized protein LOC104785...    103   4e-23   
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              103   5e-23   
dbj|BAD52536.1|  unknown protein                                        102   5e-23   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    103   6e-23   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    103   6e-23   
dbj|BAJ89665.1|  predicted protein                                      103   6e-23   
emb|CDP21696.1|  unnamed protein product                                103   7e-23   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    103   7e-23   
emb|CDY14785.1|  BnaC04g47820D                                          102   8e-23   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    102   9e-23   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  102   1e-22   
gb|KEH17090.1|  DUF642 family protein                                   102   1e-22   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    102   1e-22   
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     102   2e-22   
gb|ACN30906.1|  unknown                                                 102   2e-22   
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             102   2e-22   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    101   2e-22   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    101   2e-22   
gb|KHN45084.1|  hypothetical protein glysoja_040000                     101   2e-22   
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    101   3e-22   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    101   3e-22   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    101   3e-22   
gb|AGV54565.1|  hypothetical protein                                    100   3e-22   
ref|NP_181711.1|  uncharacterized protein                               101   3e-22   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             101   3e-22   
gb|AGV54808.1|  hypothetical protein                                    101   3e-22   
gb|AFK39561.1|  unknown                                                 101   4e-22   
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             100   4e-22   
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     100   4e-22   
ref|NP_973938.1|  uncharacterized protein                               100   4e-22   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   4e-22   
gb|KHG28355.1|  putative metabolite transport                           100   4e-22   
gb|EMS62745.1|  hypothetical protein TRIUR3_16982                       100   4e-22   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  100   5e-22   
gb|AES87990.2|  DUF642 family protein                                   100   5e-22   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    100   6e-22   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    100   6e-22   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    100   9e-22   
gb|KHG06200.1|  Periplasmic nitrate reductase                           100   1e-21   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    100   1e-21   
ref|XP_006648442.1|  PREDICTED: uncharacterized protein LOC102701241  99.0    1e-21   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 100   1e-21   
ref|NP_181712.1|  uncharacterized protein                             99.8    1e-21   



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            IS+A+TDGL+ NGNFE P+ K +LNGTVVLK +A+P W I+GFVEYI AGQ QGDMLLVV
Sbjct  22   ISLALTDGLLKNGNFEMPLAKADLNGTVVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVV  81

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEGYAAVRLGNEASIKQ LNVTK MYYS+TF AARTCAQEE++NVSV PD GVLPIQTLY
Sbjct  82   PEGYAAVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQTLY  141

Query  514  SS  519
            SS
Sbjct  142  SS  143



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I++AI DGL+ NGNFE   K ++LNGTVVL+Q+AVPGWI +GFVEYI AGQ QGDM+LV
Sbjct  19   HIAIAIKDGLMENGNFEIAPKDSDLNGTVVLRQNAVPGWITSGFVEYIKAGQKQGDMILV  78

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG+AA+RLGNEASIKQK+NVTK MYYSITF AARTCAQEE+LNVSVAPD GVLP+QTL
Sbjct  79   VPEGHAAIRLGNEASIKQKINVTKGMYYSITFSAARTCAQEEQLNVSVAPDFGVLPMQTL  138

Query  511  YSS  519
            YSS
Sbjct  139  YSS  141



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            IS+++TDGL+ NGNFE P+ K  LNGTVVLK +A+P W I+GFVEYI AGQ QGDMLLVV
Sbjct  22   ISLSLTDGLLKNGNFEMPLAKGNLNGTVVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVV  81

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEGYAAVRLGNEASIKQ LNVTK MYYS+TF AARTCAQEE++NVSV PD GVLPIQTLY
Sbjct  82   PEGYAAVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQTLY  141

Query  514  SS  519
            SS
Sbjct  142  SS  143



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S IS+A+ DGL+ NGNFE P  K +LNGT VLK +A+P W I+GFVEYI AGQ QGDMLL
Sbjct  18   SSISIAVIDGLLKNGNFEMPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLL  77

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEGYAAVRLGNEASIKQ LNVTK MYYS+TF AARTCAQEE++NVSV PD GVLPIQT
Sbjct  78   VVPEGYAAVRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQT  137

Query  508  LYSS  519
            LYSS
Sbjct  138  LYSS  141



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S IS A+ DGL+ NGNFE P  K +LNGT VLK +A+P W I+GFVEYI AGQ QGDMLL
Sbjct  18   SNISFAVIDGLLKNGNFEIPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLL  77

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEGYAAVRLGNEASIKQ LNVTK MYYS+TF AARTCAQEE++NVSV PD GVLPIQT
Sbjct  78   VVPEGYAAVRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQT  137

Query  508  LYSS  519
            LYSS
Sbjct  138  LYSS  141



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             +  A+ DGL+ NGNFE   K +ELNGT+VLK +A+P W ++GFVEYI AGQ QGDMLLV
Sbjct  17   HLVFALRDGLLDNGNFEQAPKASELNGTIVLKPNAIPKWRVSGFVEYIKAGQKQGDMLLV  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEGYAAVRLGNEASIKQ LNV+K MYYS+TF AARTCAQEE+LNVSVAP  GVLPIQTL
Sbjct  77   VPEGYAAVRLGNEASIKQSLNVSKGMYYSLTFSAARTCAQEERLNVSVAPGFGVLPIQTL  136

Query  511  YSS  519
            YSS
Sbjct  137  YSS  139



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            + A  DGL+ NGNFE   K +ELNGT+VLK  AVP W I+GFVEYI AGQ QGDMLLVVP
Sbjct  55   AFAFRDGLLDNGNFEQAPKSSELNGTIVLKPHAVPKWQISGFVEYIKAGQKQGDMLLVVP  114

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EGYAAVRLGNEASIKQ +NVTK M+YS+TF AARTCAQEE++NVSVAPD GVLPIQTLYS
Sbjct  115  EGYAAVRLGNEASIKQLINVTKGMFYSLTFSAARTCAQEERVNVSVAPDYGVLPIQTLYS  174

Query  517  S  519
            S
Sbjct  175  S  175



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q SV+I DGLI NGNFE   K+++LNGT VL + A+P W I+GFVEYI +GQ QGDMLLV
Sbjct  16   QFSVSIRDGLIENGNFELGPKQSDLNGTKVLGRYAIPRWEISGFVEYIKSGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQKL V K MYYSITF AARTCAQEE LNVSV+PDSGVLP+QT+
Sbjct  76   VPEGAYAVRLGNEASIKQKLKVIKGMYYSITFSAARTCAQEEALNVSVSPDSGVLPMQTM  135

Query  511  YSS  519
            YSS
Sbjct  136  YSS  138



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+ A+TDGL+ NGNFEA  K +E+NGT VL + A+P W I+GFVEYI +G  QGDMLLV
Sbjct  17   HIAFAMTDGLLPNGNFEATPKASEMNGTQVLGRYAIPQWEISGFVEYIESGHKQGDMLLV  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQKL V K MYYSITF AARTCAQ+E+LNVSV PDSG+LPIQT+
Sbjct  77   VPEGAYAVRLGNEASIKQKLTVVKGMYYSITFSAARTCAQDERLNVSVTPDSGMLPIQTM  136

Query  511  YSS  519
            Y S
Sbjct  137  YGS  139



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            ++  A  DGL+ NGNFE   K +++ GTVV+ + A+P W I+GFVEYI +GQ QGDMLLV
Sbjct  18   RLGCAFIDGLVPNGNFELAPKPSDMKGTVVIGKYAIPKWEISGFVEYIKSGQKQGDMLLV  77

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ+L V K MYYSITF AARTCAQEEKLN+SVAPDSGVLP+QTL
Sbjct  78   VPEGAFAVRLGNEASIKQRLRVQKGMYYSITFSAARTCAQEEKLNISVAPDSGVLPMQTL  137

Query  511  YSS  519
            YSS
Sbjct  138  YSS  140



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            I++AITDGL+ NGNFEA  K ++LNGT V+ + A+P W I+GFVEYI +G  QGDMLLVV
Sbjct  20   IALAITDGLLPNGNFEAKPKASDLNGTQVMSRYAIPQWEISGFVEYIESGHKQGDMLLVV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEG  AVRLGNEASIKQKL V K MYYSITF AARTCAQ+E+LNVSV PDSG+LPIQT Y
Sbjct  80   PEGAYAVRLGNEASIKQKLKVVKGMYYSITFSAARTCAQDERLNVSVTPDSGLLPIQTTY  139

Query  514  SS  519
             S
Sbjct  140  GS  141



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +  G + NGNFE P    +LNG+V+  + A+P W I+GFVEYI AGQ QGDMLLVVPEGY
Sbjct  2    VAAGPLDNGNFEQPPDPKDLNGSVIKTRYAIPKWEISGFVEYIKAGQKQGDMLLVVPEGY  61

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            AA+RLGNEASIKQ LNVT  +YYS+TF AARTCAQEEKLN+SVAPD+GVLP+QTLYSS
Sbjct  62   AAIRLGNEASIKQSLNVTPGLYYSLTFSAARTCAQEEKLNISVAPDNGVLPVQTLYSS  119



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q S++I DGL+ NGNFE   K +++ GT V+ ++A+P W I+GFVEYI +GQ QGDMLLV
Sbjct  16   QFSLSIRDGLVKNGNFELAPKPSDMKGTQVIGKNAIPEWEISGFVEYIKSGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ++ V K MYYSITF AARTCAQEEKLNVSV+PD GVLP+QT+
Sbjct  76   VPEGAYAVRLGNEASIKQRMRVIKGMYYSITFSAARTCAQEEKLNVSVSPDWGVLPMQTM  135

Query  511  YSS  519
            YSS
Sbjct  136  YSS  138



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              S  + DGL+ NGNFE   K ++LNGT V  + A+P W I+GFVEYI AGQ QGDMLLV
Sbjct  16   HFSFCVKDGLLENGNFELAPKASDLNGTEVKGRYAIPEWEISGFVEYIKAGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ+LNVTK M+Y++TFCAARTCAQEE+LNVSV PDSG+LPIQTL
Sbjct  76   VPEGACAVRLGNEASIKQRLNVTKGMFYALTFCAARTCAQEERLNVSVPPDSGLLPIQTL  135

Query  511  YSS  519
            Y S
Sbjct  136  YGS  138



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             +S+A+ DGL+ NGNFE   K +++ GT+V    A+P W +TG+VEYI +GQ QGDMLLV
Sbjct  18   HVSLALIDGLLPNGNFEYGPKPSQMKGTLVTDAHAIPEWELTGYVEYIKSGQKQGDMLLV  77

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE+LNVSVAPDSG+LP+QT+
Sbjct  78   VPEGAYAVRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVAPDSGILPMQTM  137

Query  511  YSS  519
            YSS
Sbjct  138  YSS  140



>emb|CBI20999.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+++ TDGL+ NGNFE   K +++ GT V+   A+P W  +GF+EYI AGQ QGDMLLV
Sbjct  16   HIALSFTDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIKAGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ++ V K MYYSITF AARTCAQEE+LN+SVAPD GVLP+QTL
Sbjct  76   VPEGAFAVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVAPDWGVLPMQTL  135

Query  511  YSS  519
            YSS
Sbjct  136  YSS  138



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             ++VA+ DGL+ NG+FE   K +++ GTVV+ + A+P W ++GFVEYI AGQ QGDMLLV
Sbjct  19   HLAVALIDGLLPNGDFEYGPKPSDMKGTVVINRHAIPEWELSGFVEYIKAGQKQGDMLLV  78

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VP G  AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE+LNVSVAPDSG+LPIQT 
Sbjct  79   VPAGEFAVRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVAPDSGILPIQTT  138

Query  511  YSS  519
            YSS
Sbjct  139  YSS  141



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  TDG++ NG+FE   K +++ GT VLK++A+P W +TGFVEYI +GQ QGDMLLVVP 
Sbjct  22   LCFTDGMLPNGDFELGPKPSDIKGTKVLKKNAIPSWEVTGFVEYIKSGQKQGDMLLVVPA  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  82   GKFAVRLGNEASIKQTLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  141



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q   AITDGL+ NGNFE    +++LNGT V  + A+P W I+G VEYI +G  QGDMLL 
Sbjct  17   QSVAAITDGLLPNGNFEKGPSRSQLNGTQVTSRYAIPEWEISGVVEYIESGHKQGDMLLP  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEAS+KQ L VTK MYYSITFCAARTCAQEE+LNVSV PDSGVLP+QT+
Sbjct  77   VPEGVYAVRLGNEASVKQNLKVTKGMYYSITFCAARTCAQEERLNVSVTPDSGVLPMQTM  136

Query  511  YSS  519
            YSS
Sbjct  137  YSS  139



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            ++ DG + NGNFE   K ++L GT V+ + A+P W I+GFVEYI +GQ QGDMLLVVPEG
Sbjct  22   SVLDGYLENGNFELAPKPSDLKGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEG  81

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASIKQ++NVTK +YYSITF AARTCAQEE+LN+SVAPDSGVLPIQT+YSS
Sbjct  82   AYAVRLGNEASIKQRINVTKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYSS  140



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            + DGL+ NGNFE     T + GTVV+ + A+PGW+  GFVEYI +GQ QGDMLLVVPEG 
Sbjct  31   VADGLLENGNFENAPNATNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGA  90

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE+LNV+VAPDSGVLPIQT+YSS
Sbjct  91   YAVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSS  148



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  TDG++ NG+FE   K ++L GT V+ ++A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  22   LCFTDGMLPNGDFELGPKPSDLKGTQVISKNAIPSWELSGFVEYIKSGQKQGDMLLVVPA  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  82   GKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  141



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            + ++ DG + NGNFE P K +++ G+ V+ + A+P W I+GFVEYI +GQ QGDMLLVVP
Sbjct  19   AFSLIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EG  AVRLGNEASIKQ + VTK +YYSITF AARTCAQEE+LNVSVAPDSGVLPIQT+YS
Sbjct  79   EGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAPDSGVLPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S  +V + DGL+ NGNFE     + + GTVV+ + A+PGW+  GFVEYI +GQ QGDMLL
Sbjct  20   SATNVTVADGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLL  79

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF AARTCAQEE+LNV+VAPDSGV+PIQT
Sbjct  80   VVPEGAYAVRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEERLNVTVAPDSGVMPIQT  139

Query  508  LYSS  519
            +YSS
Sbjct  140  VYSS  143



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            + ++ DG + NGNFE P K +++ G+ V+ + A+P W I+GFVEYI +GQ QGDMLLVVP
Sbjct  19   AFSLIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            +G  AVRLGNEASIKQ + VTK +YYSITF AARTCAQEE+LNVSVAPDSGVLPIQT+YS
Sbjct  79   ZGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAPDSGVLPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            + ++ DG + NGNFE P K +++ G+ V+ + A+P W I+GFVEYI +GQ QGDMLLVVP
Sbjct  23   AFSLIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVP  82

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EG  AVRLGNEASIKQ + VTK +YYSITF AARTCAQEE+LNVSVAPDSGVLPIQT+YS
Sbjct  83   EGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAPDSGVLPIQTVYS  142

Query  517  S  519
            S
Sbjct  143  S  143



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  178  LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVR  357
            L+ NGNFE    +++LNGT V+ + A+P W ITGFVEYI +G  QGDMLL VPEG  AVR
Sbjct  32   LLPNGNFEKGPSRSQLNGTQVIGRYAIPEWEITGFVEYIESGHKQGDMLLPVPEGVHAVR  91

Query  358  LGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            LGNEASIKQKL VTK MYYSITFCAARTCAQEE+LNVSV PDSGVLP+QT+YSS
Sbjct  92   LGNEASIKQKLKVTKGMYYSITFCAARTCAQEERLNVSVTPDSGVLPMQTMYSS  145



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+++ TDGL+ NGNFE   K +++ GT V+   A+P W  +GF+EYI AGQ QGDMLLV
Sbjct  16   HIALSFTDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIKAGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ++ V K MYYSITF AARTCAQEE+LN+SVAPD GVLP+QTL
Sbjct  76   VPEGAFAVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVAPDWGVLPMQTL  135

Query  511  YSS  519
            YSS
Sbjct  136  YSS  138



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG+FE   K  ++ GT V+K++A+P W +TGFVEYI +GQ QGDMLLVVP G  A
Sbjct  25   DGMLPNGDFELGPKPADMKGTQVIKKNAIPSWELTGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              + +I DGL+ NGNFE   K +EL GT ++ + A+P W I+GFVEYI AGQ QGDMLLV
Sbjct  17   HFAFSIRDGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLV  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ LNVTK MYYSITF AARTCAQEE+LN+S++P+ GVLP+QT+
Sbjct  77   VPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTM  136

Query  511  YSS  519
            YSS
Sbjct  137  YSS  139



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +++I DG + NGNFE   K +++ GT V+ + A+P W I+GFVEYI +GQ QGDMLLVVP
Sbjct  19   ALSIIDGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EG  AVRLGNEASIKQ++ VTK +YYSITF AARTCAQEE+LN+SVAPDSGVLPIQT+YS
Sbjct  79   EGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            + DGL+ NGNFE     T + GTVV+ + ++PGW+  GFVEYI +GQ QGDMLLVVPEG 
Sbjct  31   VADGLLENGNFENAPNATNMKGTVVVGRYSIPGWVNEGFVEYIKSGQKQGDMLLVVPEGA  90

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE+LNV+VAPDSGVLPIQT+YSS
Sbjct  91   YAVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSS  148



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  TDG++ NG+FE   K +++ GT V+ ++A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  22   LCFTDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPA  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  82   GKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  141



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
             TDG++ NG+FE   K +++ GT V+ ++A+P W ++GFVEYI +GQ QGDMLLVVP G 
Sbjct  24   FTDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGK  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  84   FAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  141



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              + +I DGL+ NGNFE   K +EL GT ++ + A+P W I+GFVEYI AGQ QGDMLLV
Sbjct  67   HFAFSIRDGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLV  126

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ LNVTK MYYSITF AARTCAQEE+LN+S++P+ GVLP+QT+
Sbjct  127  VPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTM  186

Query  511  YSS  519
            YSS
Sbjct  187  YSS  189



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  214  KTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLN  393
            K++LNGT+VLK  A+P W I+GFVEYI AGQ QGDMLLVVPEGYAAVRLGNEAS+KQ +N
Sbjct  5    KSDLNGTIVLKPHAIPKWQISGFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASVKQYVN  64

Query  394  VTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VTK MYYSITF AARTCAQEE +NVSVAPD GVLPIQTLYSS
Sbjct  65   VTKGMYYSITFSAARTCAQEEMVNVSVAPDFGVLPIQTLYSS  106



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG+FE   K +++ GT V+ ++A+P W +TGFVEYI +GQ QGDMLLVVP G  A
Sbjct  25   DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIQSGQKQGDMLLVVPAGKFA  84

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG+FE   K +++ GT V+ ++A+P W +TGFVEYI +GQ QGDMLLVVP G  A
Sbjct  25   DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              + +I DGL+ NGNFE   K ++L GT ++ + A+P W I+GFVEYI AGQ QGDMLLV
Sbjct  17   HFAFSIKDGLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLV  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ LNVTK MYYSITF AARTCAQEE+LN+S++P+ GVLP+QT+
Sbjct  77   VPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTM  136

Query  511  YSS  519
            YSS
Sbjct  137  YSS  139



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  +DG++ NG+FE   K +++ GT V+ ++A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  21   LCFSDGMVPNGDFELGPKPSDMKGTQVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPA  80

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  A+RLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  81   GKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S  +V + +GL+ NGNFE     + + GTVV+ + A+PGW+  GFVEYI +GQ QGDMLL
Sbjct  20   SATNVTVAEGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLL  79

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF AARTCAQEE+LNV+VAPDSGV+PIQT
Sbjct  80   VVPEGAYAVRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEERLNVTVAPDSGVMPIQT  139

Query  508  LYSS  519
            +YSS
Sbjct  140  VYSS  143



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  +DG++ NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  21   ICFSDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPA  80

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  A+RLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  81   GKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  +DG++ NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  21   ICFSDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPA  80

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  A+RLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  81   GKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  +DG++ NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  21   ICFSDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPA  80

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  A+RLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  81   GKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +  TD ++ NG+FE   K +++ GT V+ ++A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  22   LCFTDAMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPA  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  82   GKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  141



>gb|AFK49528.1| unknown [Medicago truncatula]
Length=204

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S ++ DGL+ NGNFE   K TEL GTVV   ++++P W I+G VEY+ +GQ QGDMLL
Sbjct  27   HVSQSLIDGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGDMLL  86

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE++N+SVAPD GV+PIQT
Sbjct  87   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQT  146

Query  508  LYSS  519
            LY+S
Sbjct  147  LYTS  150



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDG-----LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQG  315
             IS+++T+G     L+ NGNFE     T + GTVV+ + ++PGW+  GFVEYI +GQ QG
Sbjct  16   HISLSLTNGTASNGLLENGNFENAPNATNMKGTVVVGRYSIPGWVNEGFVEYIKSGQKQG  75

Query  316  DMLLVVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVL  495
            DMLLVVPEG  AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE+LNV+VAPDSGVL
Sbjct  76   DMLLVVPEGAYAVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDSGVL  135

Query  496  PIQTLYSS  519
            PIQT+YSS
Sbjct  136  PIQTVYSS  143



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            ++++ DG + NGNFE   K +++ GT V+ + A+P W I+GFVEYI +G  QGDMLLVVP
Sbjct  19   ALSLIDGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVEYIKSGHKQGDMLLVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EG  AVRLGNEASIKQ++ VTK +YYSITF AARTCAQEE+LN+SVAPDSGVLPIQT+YS
Sbjct  79   EGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+ +ITDGL+ NGNFE   + +++NGTVVL + A+P W I+GFVEYI +GQ QGDMLLV
Sbjct  17   HIAFSITDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYIRSGQKQGDMLLV  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEAS+KQ++ V K  YYSI+F  ARTCAQEE LN+SVAP+ GVLP+QTL
Sbjct  77   VPEGAFAVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISVAPEWGVLPLQTL  136

Query  511  YSS  519
            YSS
Sbjct  137  YSS  139



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+ +ITDGL+ NGNFE   + +++NGTVVL + A+P W I+GFVEYI +GQ QGDMLLV
Sbjct  17   HIAFSITDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYIRSGQKQGDMLLV  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEAS+KQ++ V K  YYSI+F  ARTCAQEE LN+SVAP+ GVLP+QTL
Sbjct  77   VPEGAFAVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISVAPEWGVLPLQTL  136

Query  511  YSS  519
            YSS
Sbjct  137  YSS  139



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG FE   K ++L GT V+ ++A+P W ++GF+EYI +GQ QGDMLLVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASIKQ++NVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQTLYSS
Sbjct  85   VRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTLYSS  140



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A TDGL+ NG+FE   K +++ G+ VL + A+P W ++GFVEYI +GQ QGDMLLVVPEG
Sbjct  23   AFTDGLLPNGDFEKGPKPSDMKGSEVLNRHAIPNWELSGFVEYIKSGQKQGDMLLVVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASIKQ+++VTK M Y+ITFCAARTCAQEE+LNVSV P+ GVLP+QTLYSS
Sbjct  83   AFAVRLGNEASIKQRVSVTKGMNYAITFCAARTCAQEEQLNVSVTPEWGVLPMQTLYSS  141



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG FE   K +++ GT V+ ++A+P W ++GF+EYI +GQ QGDMLLVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDMKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASIKQ++NVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQTLYSS
Sbjct  85   VRLGNEASIKQRINVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTLYSS  140



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q++ A TDGL+ NGNFE   K  +L GT V  +DA+P W ITGFVEYI  GQ QGDMLLV
Sbjct  16   QLAAAFTDGLLPNGNFEQGPKPWQLKGTKVAGRDAIPRWQITGFVEYIQWGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGN+ASIKQ + VTK + YS+TF AARTCAQEE+LNVS +P+SGVLP+QT+
Sbjct  76   VPEGSYAVRLGNDASIKQSVKVTKGVRYSLTFSAARTCAQEERLNVSASPESGVLPMQTM  135

Query  511  YSS  519
            YSS
Sbjct  136  YSS  138



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +   DG++ NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP 
Sbjct  21   LCFRDGMLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPA  80

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  81   GKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  140



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              + +  +GL+ NGNFE   +++++ GT ++ + A+P W I+GFVEYI AGQ QGDMLLV
Sbjct  18   HFAFSFIEGLVENGNFENSPRQSDMKGTQMIGRYALPNWEISGFVEYIKAGQKQGDMLLV  77

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  AVRLGNEASIKQ+LN+TK MYYSITF AARTCAQEE LN+SV+P+ GVLP+QTL
Sbjct  78   VPEGAYAVRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVSPEWGVLPMQTL  137

Query  511  YSS  519
            YSS
Sbjct  138  YSS  140



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            V+  DG++ NG+FE   K +++ GT VL + A+P W +TGFVEYI +G TQGDMLLVVP 
Sbjct  22   VSFRDGMLPNGDFELGPKPSDMKGTEVLNKMAIPNWEVTGFVEYISSGHTQGDMLLVVPA  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+P+QT+YSS
Sbjct  82   GKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSS  141



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S +ITDGL+ NGNFE   K + L GTVV+    ++P W I+GFVEYI +GQ QGDMLL
Sbjct  17   HVSFSITDGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEYIKSGQKQGDMLL  76

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE+LN+SV PD GV+PIQT
Sbjct  77   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTPDWGVIPIQT  136

Query  508  LYSS  519
            LY+S
Sbjct  137  LYTS  140



>gb|ACU22840.1| unknown [Glycine max]
Length=199

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (77%), Gaps = 5/124 (4%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            + TDGL+ NGNFE   K ++L G+VV   DA+P W I+GFVEYI +GQ QGDMLLVVPEG
Sbjct  22   SFTDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEG  81

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQT  507
              AVRLGNEASIKQKL + K  +YSITF AARTCAQEEKLNVSV P     D G++PIQT
Sbjct  82   DYAVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDWGIIPIQT  141

Query  508  LYSS  519
            +Y S
Sbjct  142  MYGS  145



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S ++VA TDGL+ NGNFE     ++L GT V+ ++A+P W I+G VEYI  G  QGDMLL
Sbjct  15   SPMAVAFTDGLLPNGNFELGPASSQLRGTEVIGRNAIPRWEISGTVEYIPWGHKQGDMLL  74

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ VT+ M YS+TF AARTCAQEE+LNVSVAP+SGVLP+QT
Sbjct  75   VVPEGSYAVRLGNEASIKQRIKVTRGMRYSLTFSAARTCAQEERLNVSVAPESGVLPMQT  134

Query  508  LYSS  519
            +YSS
Sbjct  135  MYSS  138



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              + +  +GL+ NGNFE   K++++ GT ++ + A+P W I+GFVEYI AGQ QGDMLLV
Sbjct  50   HFAFSFIEGLVENGNFELSPKQSDMKGTQMIGRYALPKWEISGFVEYIKAGQKQGDMLLV  109

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG  A+RLGNEASIKQ+LN+TK MYYSITF AARTCAQEE LN+SV+P+ GVLP+QT+
Sbjct  110  VPEGAYAIRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVSPEWGVLPMQTM  169

Query  511  YSS  519
            YSS
Sbjct  170  YSS  172



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            ++++ DG + NG+FE   K +++NGTVV    A+P W I+GFVEYI +GQ QGDMLLVVP
Sbjct  74   ALSLVDGYLPNGDFERGPKASDMNGTVVKGPYAIPEWEISGFVEYIKSGQKQGDMLLVVP  133

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EG  AVRLGNEASIKQK+ V K +YYSITF AARTCAQEE+LN+SVAPD GVLP+QTLY+
Sbjct  134  EGAFAVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISVAPDWGVLPMQTLYN  193

Query  517  S  519
            S
Sbjct  194  S  194



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S+ +V+  DG++ NG+FE   K +++ GT +L + A+P W +TGFVEYI +G  QGDMLL
Sbjct  20   SKSTVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLL  79

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVP G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+P+QT
Sbjct  80   VVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQT  139

Query  508  LYSS  519
            +YSS
Sbjct  140  VYSS  143



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            + DGL+ NGNFE     T + GTVV+ + A+PGWI  GFVEYI +GQ QGDMLLVVPEG 
Sbjct  32   VADGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEGFVEYIKSGQKQGDMLLVVPEGA  91

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+ASIKQ + V   +YYSITF AARTCAQEE+LNV+VAPDSGVLPIQT+YSS
Sbjct  92   YAVRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSS  149



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +V+  DG++ NG+FE   K +++ GT +L + A+P W +TGFVEYI +G  QGDMLLVVP
Sbjct  23   TVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVP  82

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
             G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YS
Sbjct  83   AGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYS  142

Query  517  S  519
            S
Sbjct  143  S  143



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +V+  DG++ NG+FE   K +++ GT +L + A+P W +TGFVEYI +G  QGDMLLVVP
Sbjct  23   TVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVP  82

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
             G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YS
Sbjct  83   AGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYS  142

Query  517  S  519
            S
Sbjct  143  S  143



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +V+  DG++ NG+FE   K +++ GT +L + A+P W +TGFVEYI +G  QGDMLLVVP
Sbjct  23   TVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVP  82

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
             G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YS
Sbjct  83   AGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYS  142

Query  517  S  519
            S
Sbjct  143  S  143



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S+++ DGL+ NGNFE   K +EL GTVV   ++++P W I+G VEYI +GQ QGDMLL
Sbjct  26   HVSLSLIDGLVANGNFELGPKPSELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLL  85

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE++N+SVAPD GV+PIQT
Sbjct  86   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQT  145

Query  508  LYSS  519
            LY+S
Sbjct  146  LYTS  149



>gb|ACU17881.1| unknown [Glycine max]
Length=282

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 96/129 (74%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S    + TDGL+ NGNFE   K ++L G+VV   DA+P W I+GFVEYI +GQ QGDMLL
Sbjct  17   SHAVFSFTDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLL  76

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            VVPEG  AVRLGNEASIKQKL + K  +YSITF AARTCAQEEKLNVSV P     D G+
Sbjct  77   VVPEGDYAVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDWGI  136

Query  493  LPIQTLYSS  519
            +PIQT+Y S
Sbjct  137  IPIQTMYGS  145



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S ++ DGL+ NGNFE   K TEL GTVV   ++++P W I+G VEYI +GQ QGDMLL
Sbjct  27   HVSQSLIDGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLL  86

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE++N+SVAPD GV+PIQT
Sbjct  87   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQT  146

Query  508  LYSS  519
            LY+S
Sbjct  147  LYTS  150



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            + DGL+ NGNFE     T + GTVV+ + A+PGWI  GFVEYI +GQ QGDMLLVVPEG 
Sbjct  69   VADGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEGFVEYIKSGQKQGDMLLVVPEGA  128

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+ASIKQ + V   +YYSITF AARTCAQEE+LNV+VAPDSGVLPIQT+YSS
Sbjct  129  YAVRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSS  186



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S +I DGL+ NGNFE   K + L GTVV+    ++P W I+GFVEYI +GQ QGDMLL
Sbjct  17   HVSFSIIDGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEYIKSGQKQGDMLL  76

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE+LN+SV PD GV+PIQT
Sbjct  77   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTPDWGVIPIQT  136

Query  508  LYSS  519
            LY+S
Sbjct  137  LYTS  140



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  175  GLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAV  354
            GL+ NGNFE   K ++L GT ++ + A+P W I+GFVEYI AGQ QGDMLLVVPEG  AV
Sbjct  3    GLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYAV  62

Query  355  RLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            RLGNEASIKQ LNVTK MYYSITF AARTCAQEE+LN+S++P+ GVLP+QT+YSS
Sbjct  63   RLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTMYSS  117



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S +I DGL+ NGNFE   K + L GTVV+    ++P W I+GFVEYI +GQ QGDMLL
Sbjct  17   HVSFSIIDGLVANGNFELGPKPSALKGTVVVGGSHSIPEWEISGFVEYIKSGQKQGDMLL  76

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE+LN+SV PD GV+PIQT
Sbjct  77   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTPDWGVIPIQT  136

Query  508  LYSS  519
            LY+S
Sbjct  137  LYTS  140



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            ++++ DG + NG+FE     +++NGTVV    A+P W I+GFVEYI +GQ QGDMLLVVP
Sbjct  20   ALSLVDGYLPNGDFERGPNASDMNGTVVKGPYAIPEWEISGFVEYIKSGQKQGDMLLVVP  79

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            EG  AVRLGNEASIKQK+ V K +YYSITF AARTCAQEE+LN+SVAPD GVLP+QTLY+
Sbjct  80   EGAFAVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISVAPDWGVLPMQTLYN  139

Query  517  S  519
            S
Sbjct  140  S  140



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S ++ DGL+ NGNFE   K TEL GTVV   ++++P W I+G VEY+ +GQ QGDMLL
Sbjct  27   HVSQSLIDGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGDMLL  86

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE++N+SVAPD GV+PIQT
Sbjct  87   VVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQT  146

Query  508  LYSS  519
            LY+S
Sbjct  147  LYTS  150



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S +I DGL+ NGNFE   K ++L GTVV+    ++P W I+GFVEYI +GQ QGDMLL
Sbjct  17   HVSFSIIDGLVANGNFELGPKASDLKGTVVVGGSKSIPEWEISGFVEYIKSGQKQGDMLL  76

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ L V K MYYSITF  ARTCAQEE++N+SV PD GV+PIQT
Sbjct  77   VVPEGAYAVRLGNEASIKQTLKVMKGMYYSITFMVARTCAQEERINISVTPDWGVIPIQT  136

Query  508  LYSS  519
            LY+S
Sbjct  137  LYTS  140



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +1

Query  175  GLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAV  354
            G + NGNFE P K ++L G+ V+ + A+P W I+GFVEYI +GQ QGDMLLVVPEG  AV
Sbjct  5    GYLENGNFELPPKPSDLKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYAV  64

Query  355  RLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            RLGNEA IKQ + V K +YYSITF AARTCAQEE+LN+SVAPDSGVLPIQT+YSS
Sbjct  65   RLGNEALIKQSIKVIKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYSS  119



>gb|EMS63052.1| hypothetical protein TRIUR3_01733 [Triticum urartu]
Length=375

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 111/148 (75%), Gaps = 7/148 (5%)
 Frame = +1

Query  76   QNMRRISITVPavallaallfaaaSQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDA  255
            + MRR  IT+        +L   A++ + A+TDGL+ NGNF+    K++LNGTVV+ + +
Sbjct  3    EGMRRRCITL-------LVLVGVAARAASAVTDGLLPNGNFKDGPAKSQLNGTVVMGRHS  55

Query  256  VPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAA  435
            +P W I+GFVEYI +G TQ DM++ VPEG +AVRLGN+ASI+Q + VT+  YYSITF AA
Sbjct  56   IPNWEISGFVEYIQSGHTQDDMIVAVPEGASAVRLGNDASIRQNIRVTRRAYYSITFSAA  115

Query  436  RTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            RTCAQ EKLNVSVA DSGVLP+QT+YSS
Sbjct  116  RTCAQAEKLNVSVAADSGVLPVQTVYSS  143



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +SV I DGL+ NGNFE   K ++L G +V  + A+P W I+G+VEYI AGQTQGDMLLVV
Sbjct  16   VSVPIRDGLLPNGNFELGPKSSQLKGVLVTDRAAIPKWEISGYVEYIKAGQTQGDMLLVV  75

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEG +AVRLGNEASI+QK++V    +YSITF AARTCAQEE+LN+SV  +SG++PIQT+Y
Sbjct  76   PEGSSAVRLGNEASIRQKISVRTGQFYSITFSAARTCAQEERLNISVTHESGIIPIQTMY  135

Query  514  SS  519
            SS
Sbjct  136  SS  137



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +1

Query  178  LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVR  357
            ++ NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP G  AVR
Sbjct  1    MLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPAGKFAVR  60

Query  358  LGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            LGNEASIKQ+LNVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQT+YSS
Sbjct  61   LGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSS  114



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             +S++  DGL+ NGNFE   K ++L GTV+   + A+P W I+GFVEYI +GQ QGDMLL
Sbjct  17   HVSLSFNDGLVANGNFELGPKASDLKGTVITGGKTAIPEWEISGFVEYIKSGQKQGDMLL  76

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ V K M+YSITF  ARTCAQEE++N+SVAPD G++PIQT
Sbjct  77   VVPEGAYAVRLGNEASIKQRIKVIKGMHYSITFMVARTCAQEERINISVAPDFGIIPIQT  136

Query  508  LYSS  519
            LY+S
Sbjct  137  LYTS  140



>ref|NP_001053188.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAD41544.2| OSJNBb0091E11.14 [Oryza sativa Japonica Group]
 dbj|BAF15102.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAH67289.1| OSIGBa0103O01.7 [Oryza sativa Indica Group]
 gb|EAY94693.1| hypothetical protein OsI_16470 [Oryza sativa Indica Group]
 gb|EAZ31209.1| hypothetical protein OsJ_15309 [Oryza sativa Japonica Group]
 dbj|BAG99074.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A  DGL++NGNFE    K+++NGT V+ + A+P W ITGFVEYI +GQ QGDMLL VPEG
Sbjct  22   AAGDGLLLNGNFEYQPSKSQMNGTRVMAEYAIPYWKITGFVEYISSGQKQGDMLLTVPEG  81

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVA--PDSGVLPIQTLYS  516
              AVRLGNEASI+Q+++VT+ MYYSITF AARTCAQ EKLNVSVA  P+SG LPIQT+Y+
Sbjct  82   AHAVRLGNEASIEQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPESGELPIQTVYT  141

Query  517  S  519
            S
Sbjct  142  S  142



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            V   DG++ NG+FE   K +++ GT V+ + A+P W +TGFVEYI +G  QGDMLLVVP 
Sbjct  22   VPFRDGILPNGDFELGPKPSDMKGTEVINKMAIPNWEVTGFVEYISSGHKQGDMLLVVPA  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+P+QT+YSS
Sbjct  82   GKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSS  141



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +V   DG++ NG+FE   K +++ GT VL + A+P W +TGFVEYI +G  QGDMLLVVP
Sbjct  21   AVYFRDGMLPNGDFELGPKPSDMKGTEVLNKMAIPKWEVTGFVEYISSGHKQGDMLLVVP  80

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
             G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SV+PDSGV+P+QT+YS
Sbjct  81   AGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPVQTVYS  140

Query  517  S  519
            S
Sbjct  141  S  141



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             +++++TDGL+ NG+FE   K  ++ GTVV  ++A+P W I+G+VEYI +GQ QGDMLLV
Sbjct  18   HVALSVTDGLLPNGDFEHGPKPWQMKGTVVTAKNAIPNWEISGYVEYIKSGQKQGDMLLV  77

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VP G  AVRLGNEASIKQK++VTKD YYSITF  ARTCAQEEKLNVSV+P     D G+L
Sbjct  78   VPGGAFAVRLGNEASIKQKISVTKDSYYSITFNVARTCAQEEKLNVSVSPNLEPKDWGIL  137

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  138  PMQTVYSS  145



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (77%), Gaps = 5/124 (4%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            + TDGL+ NGNFE   K ++L G+VV   DA+P W I+GFVEYI +GQ QGDMLLVVPEG
Sbjct  22   SFTDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEG  81

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQT  507
              AVRLGNEASIKQKL + K  +YSITF AARTCAQEEKLNVSV P     D G++PIQT
Sbjct  82   DYAVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDWGIIPIQT  141

Query  508  LYSS  519
            +Y S
Sbjct  142  MYGS  145



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            V+  DG++ NG+FE   K++++ GT VL + A+P W ++GFVEYI +G  QGDM+LVVP 
Sbjct  25   VSFRDGMLPNGDFELGPKQSDMKGTEVLNKLAIPNWEVSGFVEYISSGHKQGDMILVVPA  84

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SV+PDSGV+P+QT+YSS
Sbjct  85   GKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPVQTVYSS  144



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            +  DG++ NG+FE   K +++ GT VL + A+P W ++GFVEYI +G  QGDMLLVVP G
Sbjct  26   SFRDGMLPNGDFELGPKPSDMKGTEVLNKLAIPNWEVSGFVEYIKSGHKQGDMLLVVPAG  85

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+P+QT+YSS
Sbjct  86   KFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSS  144



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  178  LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVR  357
            ++ NG+FE   K +++ GT VL + A+P W ITGFVEYI +G TQGDMLLVVP G  AVR
Sbjct  1    MLPNGDFELGPKPSDMKGTEVLNRMAIPNWEITGFVEYISSGHTQGDMLLVVPAGKFAVR  60

Query  358  LGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            LGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+P+QT+YSS
Sbjct  61   LGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSS  114



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQ++ ++ DGL+ NGNFE   K +EL GT V+   A+P W I+G+VEYI +GQ QGDMLL
Sbjct  16   SQLASSLNDGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIKSGQKQGDMLL  75

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            +VPEG  AVRLGNEA IKQK+ V K M+YS+TF AARTCAQEEKLNVSV+P     D G+
Sbjct  76   IVPEGGFAVRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSVSPNYEKNDFGL  135

Query  493  LPIQTLYSS  519
             PIQT+YSS
Sbjct  136  FPIQTMYSS  144



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQ++ ++ DGL+ NGNFE   K +EL GT V+   A+P W I+G+VEYI +GQ QGDMLL
Sbjct  16   SQLASSLNDGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIKSGQKQGDMLL  75

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            +VPEG  AVRLGNEA IKQK+ V K M+YS+TF AARTCAQEEKLNVS++P     D G+
Sbjct  76   IVPEGGFAVRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSISPNYEKNDFGL  135

Query  493  LPIQTLYSS  519
             PIQT+YSS
Sbjct  136  FPIQTMYSS  144



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S ++VA TDGL+ NGNFE     ++L GT V+ ++A+P W I+G VEYI  G  QGDMLL
Sbjct  16   SPMAVAFTDGLLPNGNFELGPASSKLRGTEVIGRNAIPRWEISGTVEYIPWGHKQGDMLL  75

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVPEG  AVRLGNEASIKQ++ VT+ + YS+TF AARTCAQ+E+LNVSVAP+SGV+P+QT
Sbjct  76   VVPEGSYAVRLGNEASIKQRIKVTRGVRYSLTFSAARTCAQDERLNVSVAPESGVVPMQT  135

Query  508  LYSS  519
            +YSS
Sbjct  136  MYSS  139



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              +V+ T+GL+ NGNFE   K  E+ GT V+   A+P W I+G+VEYI +GQ QGDMLL+
Sbjct  17   HTAVSFTNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQGDMLLI  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            VPEG  AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE LNVSVAP+S     G+L
Sbjct  77   VPEGAYAVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSEANDWGML  136

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  137  PMQTMYSS  144



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            +  DG++ NG+FE   K +++ GT V+ + A+P W +TGFVEYI +G  QGDMLLVVP G
Sbjct  25   SFRDGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SV+PDSGV+PIQT+YSS
Sbjct  85   KFAVRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPIQTVYSS  143



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            +  DG++ NG+FE   K +++ GT V+ + A+P W +TGFVEYI +G  QGDMLLVVP G
Sbjct  25   SFRDGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SV+PDSGV+PIQT+YSS
Sbjct  85   KFAVRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPIQTVYSS  143



>gb|EMT04285.1| hypothetical protein F775_14657 [Aegilops tauschii]
Length=375

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+TDGL+ NGNF+    K++LNGTVV+ + ++P W I+GFVEYI +G  QG M++ VPEG
Sbjct  25   AVTDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQSGHQQGGMVVAVPEG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             +AVRLGN+ASI+Q + VT+  YYSITF AARTCAQ EKLNVSVA DSGVLP+QT+YSS
Sbjct  85   ASAVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVAADSGVLPVQTVYSS  143



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 5/123 (4%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE   KK++L GTVV + +A+P W ++G+VEYI +GQ QGDMLLVVPEG 
Sbjct  25   VTDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGDMLLVVPEGG  84

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTL  510
             AVRLGNEASIKQK+ VTK  +YS+TF AARTC QEE LNVS++P     D G+ PIQT+
Sbjct  85   FAVRLGNEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNVSISPNLEKNDWGIFPIQTM  144

Query  511  YSS  519
            YSS
Sbjct  145  YSS  147



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             ++ ++TDGL+ NGNFE   K  +L GTVV  ++A+P W I+G+VEYI +GQ QGDMLLV
Sbjct  21   HVAFSVTDGLLPNGNFEYGPKPWQLKGTVVTAKNAIPNWEISGYVEYIKSGQKQGDMLLV  80

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VP G  AVRLGNEASIKQK++V K  YYSITF  ARTCAQEEKLNVSV+P     D G+L
Sbjct  81   VPSGAFAVRLGNEASIKQKISVAKGSYYSITFNVARTCAQEEKLNVSVSPNIEQNDWGIL  140

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  141  PMQTMYSS  148



>ref|XP_006652463.1| PREDICTED: uncharacterized protein LOC102714172 [Oryza brachyantha]
Length=378

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DGL+ NGNFE    K+++NGT V+ + A+P W +TGFVEYI +GQ QGDMLL VPEG  A
Sbjct  26   DGLLQNGNFEYSPNKSQMNGTRVMGEYAIPYWKVTGFVEYIASGQKQGDMLLTVPEGAHA  85

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVA--PDSGVLPIQTLYSS  519
            VRLGNEASI+Q+++VT+ MYYSITF AARTCAQ EKLNVSVA  P+SG LPIQT+Y+S
Sbjct  86   VRLGNEASIQQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPESGELPIQTVYTS  143



>ref|XP_004976082.1| PREDICTED: uncharacterized protein LOC101765204 [Setaria italica]
Length=375

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+TDG++ NG+FE    K+++NGT V+  DA+P W I GFVEYI +GQ Q DM+L VPEG
Sbjct  23   AVTDGILPNGHFEQGPDKSQMNGTRVMDPDAIPYWKIYGFVEYIGSGQQQDDMILPVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGN+A+I+Q+L+VT+  YYSITF AARTCAQ EKLNVSV P+SGVLPIQT+Y+S
Sbjct  83   EQAVRLGNDATIRQQLDVTRHTYYSITFGAARTCAQAEKLNVSVTPESGVLPIQTVYTS  141



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   172 bits (435),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG FE   K ++L GT V+ ++A+P W ++GF+EYI +GQ QGDMLLVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASIKQ++NVTK MYYS+TF AARTCAQ+E+LN+SVAPDSGV+PIQTLYSS
Sbjct  85   VRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTLYSS  140



>ref|XP_008669227.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 ref|XP_008669228.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 tpg|DAA37148.1| TPA: hypothetical protein ZEAMMB73_528816 [Zea mays]
Length=380

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE    K++LNGT V+ Q++VP W I GFVEYI +GQ Q DM+L VPEG 
Sbjct  40   VTDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIFGFVEYIGSGQKQDDMILAVPEGA  99

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+A+I+QKL V +   YSITFCAARTCAQ E+LNVSVA +SGVLPIQT+Y+S
Sbjct  100  CAVRLGNDATIRQKLEVIRKTTYSITFCAARTCAQAERLNVSVAAESGVLPIQTVYTS  157



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              +V+ T+GL+ NGNFE   K  E+ GT V+   A+P W I+G+VEYI +GQ QGDMLL+
Sbjct  17   HTAVSFTNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQGDMLLI  76

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            VPEG  AVRLGNEASIKQK+ V K MYYSITF AARTCAQEE LNVSVAP+S     G+L
Sbjct  77   VPEGAYAVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSEANDWGML  136

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  137  PMQTMYSS  144



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYI--LAGQTQGDMLLVV  333
            V+  DG++ NG+FE   K +++ GT VL + A+P W +TGFVEYI   +G  QGDMLLVV
Sbjct  23   VSFRDGILPNGDFELGPKPSDIKGTEVLNKMAIPNWEVTGFVEYISSASGHKQGDMLLVV  82

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P G  AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E+LN+SVAPDSGV+P+QT+Y
Sbjct  83   PAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVY  142

Query  514  SS  519
            SS
Sbjct  143  SS  144



>ref|NP_001173996.1| Os04g0494950 [Oryza sativa Japonica Group]
 dbj|BAH92724.1| Os04g0494950 [Oryza sativa Japonica Group]
Length=209

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+TDGL+ NGNFE    K++LNGTVV  + A+  W I+GFVEYI +G  + DM+L VPEG
Sbjct  25   AVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGN+A+I+Q+L+VT+  YYSITF AARTCAQ+EKLN+SV P+ GVLPIQT+Y+S
Sbjct  85   ARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTPEFGVLPIQTVYTS  143



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 103/129 (80%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQI+ ++TDGL+ NG+FE   + +E+ GTVV  ++A+P W I+GF+EYI +G  QGDM+L
Sbjct  15   SQIASSVTDGLLPNGDFEQGPRPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMVL  74

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GV  492
            VVP G  AVRLGNEASIKQ++ VT+ ++YS+TF  ARTCAQEEKLNVSV+P+S     G+
Sbjct  75   VVPAGAYAVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVSPNSEPRDWGI  134

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  135  LPMQTMYSS  143



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +    DGL+ NG+FE     T++ GT V+ + A+P W ++GFVEYI +G  QGDM+LVVP
Sbjct  19   AFCFKDGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEYIPSGHKQGDMILVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            +G  AVRLGNEASIKQK+NV K  YYSITF AARTCAQ+E+LNVSVAP  GV+PIQT+YS
Sbjct  79   KGAFAVRLGNEASIKQKINVKKGSYYSITFSAARTCAQDERLNVSVAPHHGVMPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            +  DG++ NG+FE   K +++ GT V+ + A+P W +TGFVEYI +G  QGDMLLVVP G
Sbjct  26   SFRDGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAG  85

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASIKQ+L V K MYYS+TF AARTCAQ+E LN+SV+PDSGV+PIQT+YSS
Sbjct  86   KFAVRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDEMLNISVSPDSGVIPIQTVYSS  144



>ref|XP_003581385.1| PREDICTED: uncharacterized protein LOC100824265 [Brachypodium 
distachyon]
Length=373

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+ DGL+ NGNF+    K++LNGT+V+   ++P W ++GFVEYI +GQ QG+M+L VPEG
Sbjct  23   AVPDGLLPNGNFKDGPGKSQLNGTIVMGSHSIPFWEVSGFVEYIGSGQKQGEMILPVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGN+ASI+QKL+VT+  +YSITF AARTCAQ EKLNVSVA DSG+LPIQT+Y+S
Sbjct  83   ACAVRLGNDASIRQKLSVTRRTFYSITFSAARTCAQAEKLNVSVASDSGLLPIQTVYAS  141



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             + +++TDGL+ NGNFE   K++++ GTVV   +A+P W I+G+VEYI +G  QGDMLL+
Sbjct  16   HVVLSVTDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLI  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VPEG  AVRLGNEASIKQK+ VTK  +YS+TF AARTCAQEEKLNVSV+P     D  +L
Sbjct  76   VPEGAFAVRLGNEASIKQKIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAIL  135

Query  496  PIQTLYSS  519
            P+QT+YS+
Sbjct  136  PMQTMYSN  143



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 102/129 (79%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQ++ ++TDGL+ NG+FE   K +E+ GTVV  + A+P W I+GF+EYI +G  QGDM+L
Sbjct  37   SQVASSVTDGLLPNGDFEQGPKPSEMKGTVVTAKSAIPNWEISGFIEYIKSGHKQGDMVL  96

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GV  492
            VVP G  AVRLGNEASIKQ++ VT+ ++YS+TF  ARTCAQEEKLNVSV+P+S     G+
Sbjct  97   VVPAGAYAVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVSPNSEPRDWGI  156

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  157  LPMQTMYSS  165



>emb|CAH67378.1| OSIGBa0159F11.2 [Oryza sativa Indica Group]
 emb|CAH67294.1| OSIGBa0103O01.12 [Oryza sativa Indica Group]
 gb|EAY94678.1| hypothetical protein OsI_16457 [Oryza sativa Indica Group]
Length=372

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE    K++LNGTVV  + A+P W I+GFVEYI +G  + DM+L VPEG 
Sbjct  26   VTDGLLPNGNFEDGPDKSQLNGTVVTGRYAIPNWEISGFVEYIESGHREQDMILAVPEGA  85

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+A+I+Q+L+VT+  YYSITF AARTCAQ+EKLNVSV P+ GVLPIQT+Y+S
Sbjct  86   RAVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNVSVTPEFGVLPIQTVYTS  143



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 95/128 (74%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
              +++ TDGL+ NG+FE   K +EL G+VV   D +P W I+GFVEYI +GQ QGDMLL+
Sbjct  16   HAALSYTDGLLPNGDFEVGPKASELKGSVVTSHDGIPNWTISGFVEYIKSGQKQGDMLLI  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VPEG  AVRLGNEA IKQK+ + K  +YSITF AARTCAQEEKLNVSV P     D G++
Sbjct  76   VPEGAYAVRLGNEAYIKQKVKLNKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDYGII  135

Query  496  PIQTLYSS  519
            PIQT+Y S
Sbjct  136  PIQTMYGS  143



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP G  A
Sbjct  23   DGMLPNGDFELGPKPSDMKGTQVINRSAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  82

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            +RLGNEASIKQ+L + K MYYS+TF AARTCAQ+E+LN+S APD GV+PIQT+YSS
Sbjct  83   IRLGNEASIKQRLRLIKGMYYSLTFSAARTCAQDERLNISAAPDWGVIPIQTVYSS  138



>ref|XP_002446727.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
 gb|EES11055.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
Length=380

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE    K++LNGT V+ Q+++P W I+GFVEYI +GQ Q DM+L VPEG 
Sbjct  28   VTDGLLPNGNFEFGPAKSDLNGTRVMGQNSIPNWEISGFVEYIGSGQQQDDMILPVPEGA  87

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+A+I+QKL+V +   YSITFCAARTCAQ E+LNVSVA +SGVLP+QT+Y+S
Sbjct  88   YAVRLGNDATIRQKLSVNRKTTYSITFCAARTCAQAEQLNVSVAAESGVLPVQTVYTS  145



>tpg|DAA37152.1| TPA: hypothetical protein ZEAMMB73_071426 [Zea mays]
Length=379

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            ++ + AI DGL+ NGNFE    K++LNGT V+ ++A+P W I+G+VEYI +GQ QGDMLL
Sbjct  24   ARAASAIQDGLLPNGNFEEAPPKSQLNGTRVMGRNAIPHWEISGYVEYIGSGQKQGDMLL  83

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
             VPEG  AVRLGNEASI+Q+L VT    YSITF AARTCAQ E+LNV+VAP+S VLPIQT
Sbjct  84   PVPEGAYAVRLGNEASIQQRLAVTPGARYSITFSAARTCAQAEQLNVTVAPESDVLPIQT  143

Query  508  LYSS  519
            +Y+S
Sbjct  144  VYTS  147



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            I++ +TDGL+ NGNFE   K +++ GT V+   A+P W I+GFVEYI +G  QGDMLLVV
Sbjct  46   IALCLTDGLLPNGNFEYGPKPSQMKGTKVIDPHAIPSWEISGFVEYITSGHKQGDMLLVV  105

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLP  498
            PEG +AVRLG+EASIK K+ VT  M+YS++F AARTCAQEEKLNVSV P     D G+LP
Sbjct  106  PEGASAVRLGDEASIKTKVKVTNGMFYSLSFSAARTCAQEEKLNVSVLPNKESKDWGILP  165

Query  499  IQTLYSS  519
            IQT+YSS
Sbjct  166  IQTVYSS  172



>ref|NP_001053189.1| Os04g0494800 [Oryza sativa Japonica Group]
 dbj|BAF15103.1| Os04g0494800 [Oryza sativa Japonica Group]
Length=379

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AITDGL+ NGNFE    K+++NGT V  + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  31   AITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEG  90

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YSITF AARTCAQ E LN+++ P+SG +PIQT+Y+S
Sbjct  91   AYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTS  149



>emb|CAE01676.2| OSJNBb0091E11.17 [Oryza sativa Japonica Group]
 gb|EAZ31210.1| hypothetical protein OsJ_15310 [Oryza sativa Japonica Group]
Length=373

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AITDGL+ NGNFE    K+++NGT V  + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  25   AITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YSITF AARTCAQ E LN+++ P+SG +PIQT+Y+S
Sbjct  85   AYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTS  143



>ref|XP_004978106.1| PREDICTED: uncharacterized protein LOC101761311 [Setaria italica]
Length=381

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            ++ + AI DGL+ NGNFE     ++LNGT V+ + A+P W I+GFVEYI   Q QGDM+L
Sbjct  26   ARAAAAIPDGLLPNGNFEEAPATSQLNGTRVMGRYAIPHWEISGFVEYIGPAQKQGDMIL  85

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
             VPEG  AVRLGNEASI+Q LNVT+  YYSITF AARTCAQ E+LNV+VAP+S VLPIQT
Sbjct  86   PVPEGAYAVRLGNEASIRQLLNVTRKAYYSITFSAARTCAQAERLNVTVAPESDVLPIQT  145

Query  508  LYSS  519
            +Y++
Sbjct  146  VYTA  149



>gb|EAY94676.1| hypothetical protein OsI_16455 [Oryza sativa Indica Group]
Length=379

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AITDGL+ NGNFE    K+++NGT V  + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  31   AITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEG  90

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YSITF AARTCAQ E LN+++ P+SG +PIQT+Y+S
Sbjct  91   AYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTS  149



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTEL-NGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            +TDGL+ NGNFEA   KT+L NGTVV   +A+P W  +GFVEYI +G  QGDMLLVVP+G
Sbjct  20   VTDGLLPNGNFEAGPPKTDLVNGTVVKGGNAIPNWETSGFVEYIESGHKQGDMLLVVPQG  79

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+QKL V +  YY+ITF AARTCAQ E++N+SV+P+SGVLP+QT+Y S
Sbjct  80   AHAVRLGNEASIRQKLAVARGSYYAITFSAARTCAQAERINISVSPESGVLPMQTIYGS  138



>emb|CAH67292.1| OSIGBa0103O01.10 [Oryza sativa Indica Group]
Length=373

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AITDGL+ NGNFE    K+++NGT V  + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  25   AITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YSITF AARTCAQ E LN+++ P+SG +PIQT+Y+S
Sbjct  85   AYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTS  143



>ref|XP_002446728.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
 gb|EES11056.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
Length=371

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AIT+GL+ NG+FE    K+E+NGT VL + ++P W I+GF+EYI +GQ Q DMLL VPEG
Sbjct  23   AITEGLLPNGHFEQGPAKSEMNGTRVLGRYSIPHWEISGFLEYIESGQKQDDMLLQVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGN+A+I+Q+L VT+  YYSITF A+RTCAQ EKLNVSV P+SGVLPIQT+Y+S
Sbjct  83   ERAVRLGNDATIQQQLAVTRHTYYSITFSASRTCAQAEKLNVSVTPESGVLPIQTVYTS  141



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQI+ ++ DGL+ NGNFE   K +EL GT V+   ++P W I G+VEYI +GQ Q DMLL
Sbjct  16   SQIASSVKDGLLPNGNFEQGPKASELKGTKVMSGKSIPNWEICGYVEYIKSGQKQDDMLL  75

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            +VP+G  AVRLGN A IKQK+ V KDM+YS+TF A+RTCAQEE+LNVSV+P     DSG+
Sbjct  76   IVPQGAFAVRLGNGALIKQKIRVIKDMFYSLTFSASRTCAQEERLNVSVSPNNEQNDSGL  135

Query  493  LPIQTLYSS  519
             PIQT+YSS
Sbjct  136  FPIQTMYSS  144



>gb|EAZ31211.1| hypothetical protein OsJ_15311 [Oryza sativa Japonica Group]
Length=294

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AI DGL+ NGNFE    K++LNGT V+ + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  23   AIMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YS+TF AARTCAQ E LN++V P+ G +PIQT+Y+S
Sbjct  83   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTS  141



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQI++++ DGL+ NGNFE   K +EL GT V+   A+P W I+G+VEYI +G  QGDMLL
Sbjct  16   SQIALSVKDGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYIKSGHKQGDMLL  75

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            +VPEG  AVRLGNEA IKQK+ V K  +YS+TF  ARTCAQEE+LNVSV+P     D G+
Sbjct  76   IVPEGAFAVRLGNEALIKQKVEVVKGDFYSLTFSTARTCAQEERLNVSVSPNNEKNDFGL  135

Query  493  LPIQTLYSS  519
             PIQT+YSS
Sbjct  136  FPIQTMYSS  144



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            +    DGL+ NG+FE     T++ GT V+ + A+P W ++GFVEYI +G  QGDM+LVVP
Sbjct  19   AFCFKDGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEYIPSGHKQGDMILVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            +G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP  GV+PIQT+YS
Sbjct  79   KGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHGVMPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             + +++TDGL+ NGNFE   K++++ GTVV   +A+P W I+G+VEYI +G  QGDMLL+
Sbjct  16   HVVLSVTDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLI  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VPEG  AVRLGNEASIKQ + VTK  +YS+TF AARTCAQEEKLNVSV+P     D  +L
Sbjct  76   VPEGVFAVRLGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAIL  135

Query  496  PIQTLYSS  519
            P+QT+YS+
Sbjct  136  PMQTMYSN  143



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q+++++TDGL+ NG+FE   K +E+ GTVV  ++A+P W I+GF+EYI +G  QGDMLLV
Sbjct  32   QVALSVTDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMLLV  91

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            VP G  AVRLGNEASIKQK+ VT+  +YS+TF  ARTCAQEEKLN+SV+P+S     G+L
Sbjct  92   VPVGAYAVRLGNEASIKQKVKVTQGEFYSLTFNVARTCAQEEKLNLSVSPNSEPRDWGIL  151

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  152  PMQTMYSS  159



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++    DGL+ NG+FE   + +++ GT V+ + A+P W ++GFVEYI +GQ QGDM+LVV
Sbjct  18   VAFCFKDGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>ref|XP_002446724.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
 gb|EES11052.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
Length=379

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            ++ + AI DGL+ NGNFE    K++L G+ V+ ++A+P W I+GFVEYI +GQ QGDMLL
Sbjct  24   ARAASAIQDGLLPNGNFEEAPPKSQLKGSRVMGRNAIPHWEISGFVEYIGSGQKQGDMLL  83

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
             VPEG  AVRLGNEASI+Q+L +T+  +YSITF AARTCAQ E+LNV+VAP+S +LPIQT
Sbjct  84   PVPEGAYAVRLGNEASIQQRLALTQGAHYSITFSAARTCAQAEQLNVTVAPESDILPIQT  143

Query  508  LYSS  519
            +Y+S
Sbjct  144  VYTS  147



>tpg|DAA37149.1| TPA: hypothetical protein ZEAMMB73_398073 [Zea mays]
Length=382

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            ++DGL+ NGNFE    K++LNGT V+ Q++VP W I GFVEYI +GQ Q DM+L VPEG 
Sbjct  28   VSDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDMILPVPEGA  87

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+A+I+Q LN+ ++  YSITFCAARTCAQ E+L VSVA +SGVLPIQT+Y+S
Sbjct  88   CAVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAESGVLPIQTVYTS  145



>ref|XP_008669229.1| PREDICTED: uncharacterized protein LOC103646276 [Zea mays]
Length=379

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            ++DGL+ NGNFE    K++LNGT V+ Q++VP W I GFVEYI +GQ Q DM+L VPEG 
Sbjct  39   VSDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDMILPVPEGA  98

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+A+I+Q LN+ ++  YSITFCAARTCAQ E+L VSVA +SGVLPIQT+Y+S
Sbjct  99   CAVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAESGVLPIQTVYTS  156



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++    DGL+ NG+FE   + +++ GT V+ + A+P W ++GFVEYI +GQ QGDM+LVV
Sbjct  18   VAFCFKDGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>ref|XP_002446725.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
 gb|EES11053.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
Length=374

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            I DGL+ NGNFE    K+ELNGT V  +DA+P W I+GFVEYI  GQ QGDM+L VPEG 
Sbjct  24   IPDGLLPNGNFEEAPAKSELNGTRVKGRDAIPHWEISGFVEYIGPGQKQGDMILPVPEGA  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L VT+   YS+TF AARTCAQ E+LNV+VA DS VLPIQT+Y+S
Sbjct  84   YAVRLGNEASIQQRLAVTQGARYSVTFSAARTCAQAEQLNVTVATDSDVLPIQTVYTS  141



>ref|XP_006653558.1| PREDICTED: uncharacterized protein LOC102719203 [Oryza brachyantha]
Length=374

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            +Q   A+ DGL+ NGNFE    K++LNGTVV  + ++P W I+GFVEYI +G  + DM++
Sbjct  22   AQADSAVNDGLLPNGNFEDGPDKSQLNGTVVTGRYSIPNWEISGFVEYIESGHNEKDMIV  81

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
             VPEG  AVRLGN+A+I+QKL+VT+  YYSITF AARTCAQ+E+LNVSV P+ GVLPIQT
Sbjct  82   AVPEGARAVRLGNDATIRQKLSVTRRAYYSITFSAARTCAQKERLNVSVTPEFGVLPIQT  141

Query  508  LYSS  519
            +Y+S
Sbjct  142  VYTS  145



>ref|XP_006653557.1| PREDICTED: uncharacterized protein LOC102718925 [Oryza brachyantha]
Length=384

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            +Q + AI+ GL+ NGNFE    ++++NGT V  + A+P W I+GFVEYI +GQ QGDMLL
Sbjct  18   AQSASAISYGLLPNGNFEEAPDESQMNGTRVTGRYAIPKWEISGFVEYIGSGQKQGDMLL  77

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
             VPEG  AVRLGNEASI+QKL +T+ M+YSITF AARTCAQ E LNV+V+P+SG LPIQT
Sbjct  78   PVPEGAYAVRLGNEASIQQKLGLTRGMHYSITFSAARTCAQSEVLNVTVSPESGDLPIQT  137

Query  508  LYSS  519
            +Y+S
Sbjct  138  VYTS  141



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            SQI+ ++ DGL+ NGNFE   K +EL GT V+   A+P W I+G+VEYI +G  QGDMLL
Sbjct  16   SQIASSVKDGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYIKSGHKQGDMLL  75

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            +VPEG  AVRLGNEA IKQK+ V K  +YS+TF  ARTCAQEE+LNVSV+P     D G+
Sbjct  76   IVPEGAFAVRLGNEALIKQKIEVVKGDFYSLTFSTARTCAQEERLNVSVSPNNEKNDFGL  135

Query  493  LPIQTLYSS  519
             PIQT+YSS
Sbjct  136  FPIQTMYSS  144



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE   K++EL GTVV    A+P W I+GFVEYI +GQ QGDMLLVVPEG 
Sbjct  24   VTDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGG  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPD-----SGVLPIQTL  510
             AVRLGNEA IKQKL V K  +YS+TF AARTCAQEE LNVS+ P+      G++PIQT+
Sbjct  84   FAVRLGNEALIKQKLKVKKGGFYSVTFSAARTCAQEETLNVSITPNLEKRHWGIMPIQTM  143

Query  511  YSS  519
            YSS
Sbjct  144  YSS  146



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            + ++ DGL+ NG+FE   ++++L GTVV  + A+P W I+G+VEYI +GQ QGDMLLVVP
Sbjct  18   ATSLIDGLLPNGDFEKGPEQSQLKGTVVTSKTAIPKWGISGYVEYIKSGQKQGDMLLVVP  77

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPI  501
            EG  AVRLGNEASIKQK+ V K  +YS+TF AARTCAQEEKLNVSV P     D G+LP+
Sbjct  78   EGEFAVRLGNEASIKQKVKVEKGTFYSVTFSAARTCAQEEKLNVSVTPNHEAHDWGILPM  137

Query  502  QTLYSS  519
            QT+YSS
Sbjct  138  QTMYSS  143



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            S++ITDGL+ NG+FE   K +EL G++V   + +P W I+G VEYI +GQ QGDM+LVVP
Sbjct  20   SLSITDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIKSGQKQGDMVLVVP  79

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPI  501
             G  AVRLGNEASIKQK+ V K M+YS+TF A+RTCAQEEKLNVSV P     D GV PI
Sbjct  80   HGTYAVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVVPSNEKSDWGVFPI  139

Query  502  QTLYSS  519
            QT+Y S
Sbjct  140  QTMYGS  145



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             ++    DGL+ NG+FE    ++++ GT V+   A+P W I+GFVEYI +G  QGDMLLV
Sbjct  15   HVTFCFEDGLLPNGDFEHGPSRSDMKGTQVMNSKAIPNWEISGFVEYIPSGHKQGDMLLV  74

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VP+G  AVRLGNEASIKQ + V K  YY+ITF AARTCAQ+E+LNVS AP  GVLPIQT+
Sbjct  75   VPKGSFAVRLGNEASIKQSVKVAKGSYYAITFSAARTCAQDERLNVSAAPHHGVLPIQTV  134

Query  511  YSS  519
            YSS
Sbjct  135  YSS  137



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            ++ + DG + NG+FE   K +++ GT V+ + A+P W ++GFVEYI +GQ QGDMLLVVP
Sbjct  19   ALCLRDGQLPNGDFELGPKPSDMKGTQVVNKTAIPNWELSGFVEYIKSGQKQGDMLLVVP  78

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
             G  AVRLGNEASIKQ+L + K MYYS+TF AARTCAQ+E+LN+S +PD GV+PIQT+YS
Sbjct  79   AGKFAVRLGNEASIKQRLRLVKGMYYSLTFSAARTCAQDERLNISASPDWGVIPIQTVYS  138

Query  517  S  519
            S
Sbjct  139  S  139



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = +1

Query  157  SVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVP  336
            S++ITDGL+ NG+FE   K +EL G++V   + +P W I+G VEYI +GQ QGDM+LVVP
Sbjct  18   SLSITDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIKSGQKQGDMVLVVP  77

Query  337  EGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPI  501
             G  AVRLGNEASIKQK+ V K M+YS+TF A+RTCAQEEKLNVSV P     D GV PI
Sbjct  78   HGTYAVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVVPSNEKSDWGVFPI  137

Query  502  QTLYSS  519
            QT+Y S
Sbjct  138  QTMYGS  143



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q   + T+GL+ NGNFE   K +E+ G+VV+ Q+A+P W ITG VEYI +GQ QGDMLLV
Sbjct  20   QAVFSFTNGLLPNGNFERGPKASEMKGSVVIGQNAIPNWTITGLVEYIKSGQKQGDMLLV  79

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VPEG  AVRLG+EASIKQK+ + +  +Y+ITF AARTCAQEEKLNVSV P     D G++
Sbjct  80   VPEGDYAVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVPTTEKRDWGII  139

Query  496  PIQTLYSS  519
            PIQT+Y S
Sbjct  140  PIQTMYGS  147



>ref|XP_010445004.1| PREDICTED: uncharacterized protein LOC104727612, partial [Camelina 
sativa]
Length=325

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++    DGL+ NG+FE   + +++ GT V+ + A+P W ++GFVEYI +GQ QGDM+LVV
Sbjct  18   VAFCFKDGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK+ V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKIIVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +1

Query  175  GLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAV  354
            GL+ NGNFE   K++EL GTVV    A+P W I+GFVEYI +GQ QGDMLLVVPEG  AV
Sbjct  19   GLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGGFAV  78

Query  355  RLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPD-----SGVLPIQTLYSS  519
            RLGNEASIKQKL V K  +YSITF AARTCAQEE LNVS+ P+      G++PIQT+YSS
Sbjct  79   RLGNEASIKQKLKVKKGEFYSITFSAARTCAQEETLNVSITPNLEKRHRGIMPIQTMYSS  138



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 97/124 (78%), Gaps = 5/124 (4%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+ +GL+ NGNFE   K +E+ GT+VL + A+P W I+G VEYI +G TQGDMLLVVPEG
Sbjct  23   AVRNGLLPNGNFEYGPKPSEMKGTLVLNRKAIPNWEISGEVEYIKSGHTQGDMLLVVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQT  507
              AVRLGNEASIKQK+ + KD +YS+TF AARTCAQEEKLNVSV+      D G+LP+QT
Sbjct  83   AFAVRLGNEASIKQKVRMIKDGFYSLTFSAARTCAQEEKLNVSVSRSLEPNDWGILPMQT  142

Query  508  LYSS  519
            +YSS
Sbjct  143  MYSS  146



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 94/122 (77%), Gaps = 5/122 (4%)
 Frame = +1

Query  169  TDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYA  348
            TDGL+ NGNFE   KK++L GTVV + +A+P W ++G+VEYI +GQ QGDMLLVVPEG  
Sbjct  26   TDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGDMLLVVPEGGF  85

Query  349  AVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTLY  513
            AVRLG EASIKQK+ VTK  +YS+TF AARTC QEE LN+S+ P     D G+ PIQT+Y
Sbjct  86   AVRLGKEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNLSINPNLEKNDWGIFPIQTMY  145

Query  514  SS  519
            SS
Sbjct  146  SS  147



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE   K +EL GTVV   +A+P W I+GFVEYI +GQ QGDMLL+VPEG 
Sbjct  24   VTDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYIKSGQKQGDMLLLVPEGG  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTL  510
             AVRLG EA IKQKL +TK  +YS+TF A RTC QEEKLNVSV P     D G++PIQT+
Sbjct  84   FAVRLGKEALIKQKLKLTKGGFYSVTFTAGRTCGQEEKLNVSVNPNVEEKDWGIMPIQTM  143

Query  511  YSS  519
            YSS
Sbjct  144  YSS  146



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S+   DGL+ NG+FE   + +++ GT V+   A+P W ++GFVEYI +G  QGDM+LVV
Sbjct  18   VSLCFNDGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV   +A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  22   TDGLLPNGNFEEGPPKSALVNGTVVRGANAIPLWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L VT+  YY+ITF AARTCAQ E+LNVSV+P+ GVLP+QT+Y S
Sbjct  82   HAVRLGNEASIRQRLAVTRGAYYAITFSAARTCAQAERLNVSVSPEWGVLPMQTIYGS  139



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q +++ TDGL+ NG+FE   K + L GTVV   DA+P W ++G+VEYI +GQ QGDMLLV
Sbjct  16   QGALSYTDGLLPNGDFEVGPKASNLKGTVVTTHDAIPNWTVSGYVEYIKSGQKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VPEG  AVRLGNEA IKQK+ + K   YSITF AARTCAQEEKLNVSV P     D G++
Sbjct  76   VPEGAYAVRLGNEAYIKQKVKLNKGSSYSITFSAARTCAQEEKLNVSVVPTSEKRDYGII  135

Query  496  PIQTLYSS  519
            PIQT+Y S
Sbjct  136  PIQTMYGS  143



>ref|NP_001053190.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAF15104.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAG93696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AI DGL+ NGNFE    K++LNGT V+ + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  29   AIMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEG  88

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YS+TF AARTCAQ E LN++V P+ G +PIQT+Y+S
Sbjct  89   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTS  147



>gb|EAY74932.1| hypothetical protein OsI_02826 [Oryza sativa Indica Group]
Length=361

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV   +A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L VT+  YY++TF AARTCAQ E+LNVSV P+ GVLP+QT+Y S
Sbjct  84   HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVTPEWGVLPMQTIYGS  141



>emb|CAD41548.2| OSJNBb0091E11.18 [Oryza sativa Japonica Group]
Length=371

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AI DGL+ NGNFE    K++LNGT V+ + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  23   AIMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YS+TF AARTCAQ E LN++V P+ G +PIQT+Y+S
Sbjct  83   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTS  141



>emb|CAH67377.1| OSIGBa0159F11.1 [Oryza sativa Indica Group]
 emb|CAH67293.1| OSIGBa0103O01.11 [Oryza sativa Indica Group]
 gb|EAY94677.1| hypothetical protein OsI_16456 [Oryza sativa Indica Group]
Length=371

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AI DGL+ NGNFE    K++LNGT V+ + A+P W I+GFVEYI +GQ QGDMLL VPEG
Sbjct  23   AIMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L +T+ M+YS+TF AARTCAQ E LN++V P+ G +PIQT+Y+S
Sbjct  83   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTS  141



>emb|CAE01677.2| OSJNBb0091E11.19 [Oryza sativa Japonica Group]
Length=372

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+TDGL+ NGNFE    K++LNGTVV  + A+  W I+GFVEYI +G  + DM+L VPEG
Sbjct  25   AVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGN+A+I+Q+L+VT+  YYSITF AARTCAQ+EKLN+SV P+ GVLPIQT+Y+S
Sbjct  85   ARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTPEFGVLPIQTVYTS  143



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV   +A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L VT+  YY++TF AARTCAQ E+LNVSV+P+ GVLP+QT+Y S
Sbjct  84   HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSPEWGVLPMQTIYGS  141



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV   +A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  50   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  109

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L VT+  YY++TF AARTCAQ E+LNVSV+P+ GVLP+QT+Y S
Sbjct  110  HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSPEWGVLPMQTIYGS  167



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            + GTVV+ + A+PGW+  GFVEYI +GQ QGDMLLVVPEG  AVRLGNEASIKQ++ V K
Sbjct  1    MKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQEIKVVK  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             MYYSITF AARTCAQEE+LNV+VAPDSGV+PIQT+YSS
Sbjct  61   GMYYSITFSAARTCAQEERLNVTVAPDSGVMPIQTVYSS  99



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++    DGL+ NG+FE   + +++ GT V+ + ++P W ++GFVEYI +G+ QGDM+LVV
Sbjct  18   VAFCFKDGLLPNGDFELGPRHSDMKGTQVINKTSIPNWELSGFVEYIPSGKKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q+++++TDGL+ NG+FE   K +E+ GTVV  ++A+P W I+GF+EYI +G  QGDMLLV
Sbjct  16   QLALSVTDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMLLV  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            VP G  AVRLGNEASIKQK+ VT+  +YS+TF  ARTCAQEEKLN+SV+ +S     G+L
Sbjct  76   VPVGAYAVRLGNEASIKQKVKVTQGKFYSLTFNVARTCAQEEKLNLSVSSNSEPRDWGIL  135

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  136  PMQTMYSS  143



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S  I DGL+ NGNFE   K ++L G+VV ++ AVP W ITGFVEYI +GQ Q DM+LVV
Sbjct  22   VSAPIRDGLLPNGNFELGPKPSQLKGSVVKERTAVPNWDITGFVEYIKSGQKQDDMVLVV  81

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G +AVRLGNEASI QK++V     YSITF AARTCAQ+EKLN+SV  +SGV+PIQT+Y
Sbjct  82   PQGSSAVRLGNEASISQKISVLPGRLYSITFSAARTCAQDEKLNISVTHESGVIPIQTMY  141

Query  514  SS  519
             S
Sbjct  142  GS  143



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A TDGL+ NGNFE   K +++ GTVV   +A+P W  +G+VEYI +G  QGDMLLVVPEG
Sbjct  21   APTDGLLPNGNFEYGPKPSQMKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLLVVPEG  80

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQT  507
              A+RLGNEASIKQK+ VTK  +Y+ITF AARTCAQEE LN+SV P     D G+LPIQT
Sbjct  81   GFAIRLGNEASIKQKIKVTKGGFYAITFSAARTCAQEEILNISVNPNVEKQDFGILPIQT  140

Query  508  LYSS  519
            +YSS
Sbjct  141  MYSS  144



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            +I+ +I DGL+ NGNFE   K +E+ GT V+   A+P W I+G VEYI +GQ QGDMLL+
Sbjct  16   RIASSIKDGLLPNGNFEYGPKPSEMKGTKVVSPKAIPNWEISGVVEYIKSGQKQGDMLLI  75

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            VPEG  AVRLGN+A IKQ + V K M+YS+TF AARTCAQEE+LNVSV+P     D G+ 
Sbjct  76   VPEGAFAVRLGNDALIKQTMKVIKGMFYSLTFSAARTCAQEERLNVSVSPNYEKNDYGLF  135

Query  496  PIQTLYSS  519
            PIQT+YSS
Sbjct  136  PIQTMYSS  143



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++    DGL+ NG+FE   + +++ GT V+   A+P W ++GFVEYI +G  QGDM+LVV
Sbjct  18   VAFCFNDGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++    DGL+ NG+FE   + +++ GT V+   A+P W ++GFVEYI +G  QGDM+LVV
Sbjct  18   VAFCFNDGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVV  77

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASIKQK++V K  YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+Y
Sbjct  78   PKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVY  137

Query  514  SS  519
            SS
Sbjct  138  SS  139



>gb|ABK26874.1| unknown [Picea sitchensis]
Length=182

 Score =   152 bits (384),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +SV  +DGL+ NG+FE   K  +L GTV+L ++++P W   GFVEYI +G  Q DML+VV
Sbjct  23   VSVTASDGLLPNGDFELAPKPKDLKGTVLLGRNSLPQWRTKGFVEYITSGHHQRDMLVVV  82

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEG  AVRLGNEASI Q + VT+  YYS+TF AARTCAQ E+LNVSV P SG + IQTLY
Sbjct  83   PEGAHAVRLGNEASISQSIKVTRGSYYSLTFSAARTCAQSERLNVSVPPFSGDISIQTLY  142

Query  514  SS  519
            SS
Sbjct  143  SS  144



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             ++ + TDG I N  FE   K  ++ GTVV     A+PGW I+GF+EY+ +GQ QGDMLL
Sbjct  14   HVTFSFTDGSIANAEFEFGPKPQDMKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLL  73

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVP G  AVRLGN ASIKQK+ V K MYYSITF  ARTCAQEEKLNVSVAPD  VLP+QT
Sbjct  74   VVPNGAYAVRLGNGASIKQKIKVVKGMYYSITFMVARTCAQEEKLNVSVAPDWVVLPMQT  133

Query  508  LYS  516
            LYS
Sbjct  134  LYS  136



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++  I DGL+ NGNFE   K ++L G+VV ++ AVP W +TG VEYI AGQ Q DM+LVV
Sbjct  23   VAAPIRDGLLPNGNFEKGPKPSQLKGSVVKERSAVPNWDMTGLVEYIKAGQKQDDMVLVV  82

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEG +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQTLY
Sbjct  83   PEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTLY  142

Query  514  SS  519
             S
Sbjct  143  GS  144



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S  I DGL+ NGNFE   K ++L G+++  + AVP W ITGFVEYI AGQ Q DM+LVV
Sbjct  20   VSAPIRDGLLPNGNFEMGPKPSQLKGSIIKGRTAVPNWDITGFVEYIKAGQRQEDMVLVV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEG +AVRLGNEASI QK+ V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+Y
Sbjct  80   PEGASAVRLGNEASISQKITVQSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMY  139

Query  514  SS  519
             S
Sbjct  140  GS  141



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV   +A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  22   TDGLLPNGNFEDGPPKSALVNGTVVSGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L V +  YY+ITF AARTCAQ E LNVSV+P+ GVLP+QT+Y S
Sbjct  82   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAEALNVSVSPEWGVLPMQTIYGS  139



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +SV I DGL+ NGNFE   K ++L G+++ ++ AVP W ITGFVEYI +GQ Q DM+LVV
Sbjct  20   LSVPIRDGLLPNGNFELGPKLSQLKGSMIKERTAVPNWDITGFVEYIKSGQKQDDMVLVV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+Y
Sbjct  80   PQGSSAVRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMY  139

Query  514  SS  519
             S
Sbjct  140  GS  141



>ref|XP_010092662.1| hypothetical protein L484_019736 [Morus notabilis]
 gb|EXB51959.1| hypothetical protein L484_019736 [Morus notabilis]
Length=209

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+ +G + NGNFE   K +E+ GT+VL   A+P W I+G V+YI +G TQGDMLLVVPEG
Sbjct  23   AVRNGHLPNGNFEYGPKPSEMKGTLVLNHKAIPNWEISGVVDYIKSGHTQGDMLLVVPEG  82

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQT  507
              A RLGNEASIKQK+ V  + +YS+TF AARTCAQEEKLN+SV+P     D G+LP+QT
Sbjct  83   AFAGRLGNEASIKQKVKVITEGFYSLTFSAARTCAQEEKLNMSVSPSSEPNDWGILPMQT  142

Query  508  LYS  516
            +YS
Sbjct  143  MYS  145



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            I DGL+ NGNFE   K ++L G+VV ++ AVP W ITGFVEYI +GQ Q DM+LVVP+G 
Sbjct  33   IHDGLLPNGNFEMGPKPSQLKGSVVKERSAVPNWDITGFVEYIKSGQKQDDMVLVVPQGS  92

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            +AVRLGNEAS+ QK++V     YSITF AARTCAQEE+LN+SV  +SGV+PIQT+Y S
Sbjct  93   SAVRLGNEASVSQKISVIPGRLYSITFSAARTCAQEERLNISVTHESGVIPIQTMYGS  150



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +SV I DGL+ NGNFE   + ++L G++V ++ AVP W ITGFVEYI +GQ Q DM+LVV
Sbjct  20   LSVPIRDGLLPNGNFELGPRPSQLKGSLVKERTAVPDWDITGFVEYIKSGQKQDDMVLVV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+Y
Sbjct  80   PQGSSAVRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMY  139

Query  514  SS  519
             S
Sbjct  140  GS  141



>emb|CDY39990.1| BnaC06g40680D [Brassica napus]
Length=341

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +1

Query  154  ISVAITDG-LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            IS  I+DG L+ NGNFE   K ++L G+V+  + AVP W ITGFVEYI AGQ Q DM+LV
Sbjct  20   ISGPISDGSLLANGNFEKGPKPSQLKGSVIKGRTAVPNWEITGFVEYIKAGQKQDDMVLV  79

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+
Sbjct  80   VPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTM  139

Query  511  YSS  519
            Y S
Sbjct  140  YGS  142



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S  I DGL+ NGNFE   K ++L G+VV +++AV  W +TGFVEYI AGQ Q DM+LVV
Sbjct  20   VSAPIRDGLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            PEG +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+Y
Sbjct  80   PEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMY  139

Query  514  SS  519
             S
Sbjct  140  GS  141



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S+ I DGL+ NGNFE   + ++L G++V ++ AVP W ITGFVEYI +GQ Q DM+LVV
Sbjct  20   LSIPIRDGLLPNGNFELGPRPSQLKGSLVKERTAVPNWDITGFVEYIKSGQKQDDMVLVV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+Y
Sbjct  80   PQGSSAVRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMY  139

Query  514  SS  519
             S
Sbjct  140  GS  141



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            + GTVV+ + AVP W I+GFVEYI +GQ QGDMLLVVP G  AVRLGNEASIKQ+L V +
Sbjct  1    MRGTVVVGRYAVPKWEISGFVEYIKSGQKQGDMLLVVPAGAFAVRLGNEASIKQRLPVAR  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             MYYS+TF AARTCAQEEKLNVSVAPD GVLP+QTLYSS
Sbjct  61   GMYYSLTFSAARTCAQEEKLNVSVAPDWGVLPMQTLYSS  99



>ref|XP_004978108.1| PREDICTED: uncharacterized protein LOC101762525 [Setaria italica]
Length=381

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DGL+ NGNFE    K+E+NGT V  +DA+  W I GFVEYI +G TQ DM+L VPEG  A
Sbjct  34   DGLLPNGNFEQGPNKSEMNGTRVKDRDAILHWEIYGFVEYIESGHTQEDMILPVPEGDRA  93

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGN+A+I+QKL VT+  YYSITF AAR+CAQ E LNVSV PD GVLPIQT+Y+S
Sbjct  94   VRLGNDATIRQKLCVTRQAYYSITFTAARSCAQAEALNVSVTPDFGVLPIQTVYTS  149



>gb|EEE61252.1| hypothetical protein OsJ_15312 [Oryza sativa Japonica Group]
Length=626

 Score =   159 bits (401),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+TDGL+ NGNFE    K++LNGTVV  + A+  W I+GFVEYI +G  + DM+L VPEG
Sbjct  25   AVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEG  84

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGN+A+I+Q+L+VT+  YYSITF AARTCAQ+EKLN+SV P+ GVLPIQT+Y+S
Sbjct  85   ARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTPEFGVLPIQTVYTS  143


 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  253  AVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCA  432
            A P W I+GFVEYI +G  + DM+L VPEG  AVRLGN+A+I+Q+++VT+ MYYS+TF A
Sbjct  305  AEPNWEISGFVEYIGSGHKEQDMILAVPEGAYAVRLGNDATIRQRISVTRHMYYSVTFSA  364

Query  433  ARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            ARTCAQ EKLNVSV  + GVLPIQT+Y+S
Sbjct  365  ARTCAQAEKLNVSVTLEFGVLPIQTVYTS  393



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFEAPVKKTEL-NGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE+   K+EL NGTVV    A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  21   TDGLLPNGNFESGPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGA  80

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+ASI Q++ V +  YY+ITF AARTCAQ E+LNVSV+P+SGVLP+QT+Y S
Sbjct  81   YAVRLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPESGVLPMQTIYGS  138



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 92/122 (75%), Gaps = 5/122 (4%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE   K++EL GTVV    A+P W I+GFVEYI +GQ QGDM+LVVPEG 
Sbjct  24   VTDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMVLVVPEGG  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTL  510
             AV+LGNEA IKQKL +TK  +YS TF A+RTC QE KLNVSV P     D G++PIQT+
Sbjct  84   FAVKLGNEALIKQKLKLTKGSFYSTTFTASRTCGQEAKLNVSVNPNLEENDWGIMPIQTI  143

Query  511  YS  516
            YS
Sbjct  144  YS  145



>ref|XP_003580051.1| PREDICTED: uncharacterized protein LOC100841904 [Brachypodium 
distachyon]
Length=373

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  VAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPE  339
            +A+TDGL+ NG F     K+++NGTVV  + A+P W ++GFVEYI +G  + DMLL VP 
Sbjct  22   LAVTDGLLPNGRFSQGPDKSQMNGTVVTGKHAMPNWELSGFVEYIESGHKEADMLLAVPV  81

Query  340  GYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            G  AVRLGN+A+I+Q+L+VT+  YYSITF AAR+CAQ EKLNVSV P+ GVLPIQT+Y+S
Sbjct  82   GANAVRLGNDATIRQQLSVTRKAYYSITFVAARSCAQAEKLNVSVDPEFGVLPIQTVYTS  141



>ref|XP_006646088.1| PREDICTED: uncharacterized protein LOC102706903 [Oryza brachyantha]
Length=276

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 5/122 (4%)
 Frame = +1

Query  169  TDGLIV----NGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            TDG+I     NGNFE  P K   +NGTVV   +A+P W  +GFVEYI +G  QGDMLLVV
Sbjct  29   TDGIISWLLPNGNFEDGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVV  88

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G  AVRLGNEASI+Q+L V +  YY++TF AARTCAQ E+LNVSV+P+ GVLP+QT+Y
Sbjct  89   PQGAHAVRLGNEASIRQRLAVARGAYYAVTFSAARTCAQAERLNVSVSPEWGVLPMQTIY  148

Query  514  SS  519
             S
Sbjct  149  GS  150



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  TDGLIVNGNFEAPVKKTEL-NGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE    K+EL NGTVV    A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  22   TDGLLPNGNFELDPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+ASI Q++ V +  YY++TF AARTCAQ E+LNVSV+P+SGVLP+QT+Y S
Sbjct  82   YAVRLGNDASILQRIPVARGSYYAVTFSAARTCAQAERLNVSVSPESGVLPMQTIYGS  139



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            +TDGL+ NGNFE   K +EL GTVV   +A+P W I+GFVEYI +G+ QGDMLLVVP G 
Sbjct  24   VTDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYIKSGKKQGDMLLVVPAGG  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTL  510
             AVRLG EA IKQKL +TK  +YSITF   RTC QEEKLNVSV P     D G++PIQT+
Sbjct  84   FAVRLGKEALIKQKLKLTKGGFYSITFTGGRTCGQEEKLNVSVNPNVEKNDWGIIPIQTM  143

Query  511  YS  516
            YS
Sbjct  144  YS  145



>gb|KDO52908.1| hypothetical protein CISIN_1g0399092mg, partial [Citrus sinensis]
Length=315

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 5/119 (4%)
 Frame = +1

Query  178  LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVR  357
            L+ NGNFE   K++++ GTVV   +A+P W I+G+VEYI +G  QGDMLL+VPEG  AVR
Sbjct  1    LLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGVFAVR  60

Query  358  LGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTLYSS  519
            LGNEASIKQ + VTK  +YS+TF AARTCAQEEKLNVSV+P     D  +LP+QT+YS+
Sbjct  61   LGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAILPMQTMYSN  119



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 97/128 (76%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+ ++ DG + NGNFE   K +++ GT V+   ++P W  +GFVEYI +GQ QGDMLLV
Sbjct  14   HIAFSLIDGQLPNGNFEFGPKPSQMKGTKVMDPHSIPHWETSGFVEYIKSGQKQGDMLLV  73

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            VPEG +AVRLG+EASIK K+ V   ++YS++F AARTCAQEEKLNVSV+P+S     G+L
Sbjct  74   VPEGASAVRLGDEASIKTKVKVKNGLFYSVSFSAARTCAQEEKLNVSVSPNSESMDWGIL  133

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  134  PMQTVYSS  141



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DGL+ NGNFE   K +++ GT V+ + A+P W I+G+VEYI +GQTQGDMLL VP+G  A
Sbjct  23   DGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIKSGQTQGDMLLPVPQGDYA  82

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVLPIQTLYS  516
            VRLG +ASIK K+ VTK ++YSI+F  ARTCAQEEKLNVSV+P+S     G+LP+QT+YS
Sbjct  83   VRLGEDASIKTKVKVTKGIFYSISFVFARTCAQEEKLNVSVSPNSEPNDWGMLPLQTMYS  142

Query  517  S  519
            S
Sbjct  143  S  143



>emb|CDX87297.1| BnaA07g35760D [Brassica napus]
Length=342

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  154  ISVAITDG-LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            IS  I+DG L+ NGNFE   K ++L G+VV  + AVP W ITG VEYI AGQ Q DM+LV
Sbjct  20   ISGPISDGSLLPNGNFEMGPKPSQLKGSVVKGRTAVPNWEITGLVEYIKAGQKQDDMVLV  79

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG +AVRLGNEASI QK++V     YS+TF AARTCAQ+E+LN+SV  +SGV+PIQT+
Sbjct  80   VPEGSSAVRLGNEASISQKISVRSGRLYSVTFSAARTCAQDERLNISVTHESGVIPIQTM  139

Query  511  YSS  519
            Y S
Sbjct  140  YGS  142



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLL  327
             ++ + T G ++NG FE   K  ++ GTVV     ++PGW I+GF+EYI +GQ Q DMLL
Sbjct  15   HVAFSFTHGAVINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLL  74

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VVP G  AVRLGNEASIKQ L V K MYYSITF  ARTCAQEEKLNVS APD  VLP+QT
Sbjct  75   VVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSAAPDWVVLPMQT  134

Query  508  LY  513
            +Y
Sbjct  135  VY  136



>ref|XP_004978107.1| PREDICTED: uncharacterized protein LOC101761699 [Setaria italica]
Length=377

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGD-MLLV  330
            ++  I DG + NG FE     ++LNGT V +QDA+P W I+GFVEYI +GQ Q D M+L 
Sbjct  22   VASGIADGPLPNGIFEQGPDASQLNGTRVTRQDAIPCWEISGFVEYIQSGQNQQDGMVLA  81

Query  331  VPEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VPEG  AVRLGN ASI+Q+L N+ +  YYSITF AARTCAQ E+LNVSVAP+SGVLPIQT
Sbjct  82   VPEGAHAVRLGNGASIRQQLTNLARRSYYSITFSAARTCAQAEQLNVSVAPESGVLPIQT  141

Query  508  LYSS  519
            +Y+S
Sbjct  142  VYTS  145



>gb|ACG40327.1| hypothetical protein [Zea mays]
Length=381

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV    A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEE--KLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L V +  YY+ITF AARTCAQ E  +LNVSV+P+ GVLP+QT+Y S
Sbjct  84   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERXRLNVSVSPEWGVLPMQTIYGS  143



>ref|XP_008672703.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF84649.1| unknown [Zea mays]
 gb|ACF87605.1| unknown [Zea mays]
 gb|ACF87824.1| unknown [Zea mays]
 tpg|DAA58942.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=381

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = +1

Query  169  TDGLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            TDGL+ NGNFE  P K   +NGTVV    A+P W  +GFVEYI +G  QGDMLLVVP+G 
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  346  AAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEE--KLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L V +  YY+ITF AARTCAQ E  +LNVSV+P+ GVLP+QT+Y S
Sbjct  84   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSPEWGVLPMQTIYGS  143



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +1

Query  154  ISVAITDG-LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            +S  I DG L+ NGNFE   K ++L G+VV +++AV  W +TGFVEYI AGQ Q DM+LV
Sbjct  20   VSAPIRDGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLV  79

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+
Sbjct  80   VPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTM  139

Query  511  YSS  519
            Y S
Sbjct  140  YGS  142



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +1

Query  154  ISVAITDG-LIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            +S  I DG L+ NGNFE   K ++L G+VV +++AV  W +TGFVEYI AGQ Q DM+LV
Sbjct  20   VSAPIRDGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLV  79

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VPEG +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+
Sbjct  80   VPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTM  139

Query  511  YSS  519
            Y S
Sbjct  140  YGS  142



>ref|XP_002446726.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
 gb|EES11054.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
Length=378

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            I DGL+ NGNFE    K+++NG+ V+ Q+++P W  +GFVEYI  GQ Q DM+LVVPEG 
Sbjct  28   IPDGLLPNGNFEQGPDKSQMNGSRVIGQNSIPCWETSGFVEYIEPGQQQNDMVLVVPEGA  87

Query  346  AAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGN+A+I+Q+L  +T+ M YSITF AARTCAQ E+LNVSVA +SGVLP+QT+Y+S
Sbjct  88   RAVRLGNDATIRQQLPGLTRSMSYSITFSAARTCAQAEQLNVSVAAESGVLPVQTVYTS  146



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DGL+ NGNFE   K +++ GT V+ + A+P W I+G+VEYI +GQTQGDMLL VP+G  A
Sbjct  22   DGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIKSGQTQGDMLLPVPQGDYA  81

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVLPIQTLYS  516
            VRLG +ASIK K+ +TK ++YSI+F  ARTCAQEEKLNVSV+P+S     G+LP+QT+YS
Sbjct  82   VRLGEDASIKTKVKLTKGVFYSISFVFARTCAQEEKLNVSVSPNSEPNDWGILPLQTMYS  141

Query  517  S  519
            S
Sbjct  142  S  142



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S  + DGL+ NGNFE   K +++ G+VV ++ AVP W I GFVE+I +GQ Q DM+LVV
Sbjct  21   LSAPVRDGLLPNGNFELGPKPSQMKGSVVKERTAVPNWNIIGFVEFIKSGQKQDDMVLVV  80

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P+G +AVRLGNEASI QK++V     YSITF AARTCAQ+E+LN+SV  +SGV+PIQT+Y
Sbjct  81   PQGSSAVRLGNEASISQKISVLPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMY  140

Query  514  SS  519
             S
Sbjct  141  GS  142



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            + +++ DGL+ NGNFE   K ++L GT V +  A+P W I+G+VEYI +GQTQGDMLL V
Sbjct  19   VVLSVDDGLLPNGNFEQGPKPSQLKGTKVTEPHAIPHWEISGYVEYIKSGQTQGDMLLPV  78

Query  334  PEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            PEG  AVRLG +ASIK ++ NVTK  +YS++F  ARTCAQEEKLNVSV+P     D G+L
Sbjct  79   PEGAFAVRLGEDASIKTRITNVTKGTFYSLSFNFARTCAQEEKLNVSVSPNNEPNDWGML  138

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  139  PMQTMYSS  146



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 6/123 (5%)
 Frame = +1

Query  169  TDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYA  348
            TDGL+ NGNFE   K ++L GT V    ++P W ++G+VEYI +GQ QGDM+LVVP+G A
Sbjct  23   TDGLLPNGNFEFGPKPSQLKGTKVTDPHSIPDWEVSGYVEYIKSGQKQGDMILVVPQGAA  82

Query  349  AVRLGNEASIK-QKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTL  510
            AVRLG+EASIK +++ V   M+YS++F AARTCAQEEKLNVS AP     D GVLPIQT+
Sbjct  83   AVRLGDEASIKTKRVKVINGMFYSVSFGAARTCAQEEKLNVSFAPNKEEKDWGVLPIQTV  142

Query  511  YSS  519
            YSS
Sbjct  143  YSS  145



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            + I  +  DG++ NGNFE   K +++ GT V+ + A+P W I+G+VEYI +GQTQGDMLL
Sbjct  15   THIGSSQKDGILPNGNFELGPKASQMKGTKVVDRHAIPDWEISGYVEYIKSGQTQGDMLL  74

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GV  492
             VP G  AVRLG +ASIK K+ VTK ++YS++F  ARTCAQEEKLNVSV+P+S     G+
Sbjct  75   PVPVGDYAVRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEEKLNVSVSPNSEPNDWGM  134

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  135  LPMQTMYSS  143



>dbj|BAJ97095.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +S  I DGL+ NG+F     K+++NG VV  + A+P W ++GFVEYI +G TQ DM+L V
Sbjct  21   VSAVIDDGLLPNGDFRNGPDKSQMNGPVVTGKHAIPNWELSGFVEYIESGHTQEDMILPV  80

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
            P G  AVRLGN+A+I+Q+L V++  YYSI+F AAR+CAQ EKLNVSV P+ GVLPIQT+Y
Sbjct  81   PVGANAVRLGNDATIRQQLKVSRHTYYSISFIAARSCAQAEKLNVSVDPEFGVLPIQTVY  140

Query  514  SS  519
            ++
Sbjct  141  TN  142



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 6/128 (5%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            + +++ DGL+ NGNFE   K ++L GT V    A+P W I+G+VEYI +GQTQGDMLL V
Sbjct  19   VVLSVNDGLLPNGNFEQGPKPSQLKGTRVTNPHAIPHWEISGYVEYIKSGQTQGDMLLPV  78

Query  334  PEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            PEG  AVRLG +ASIK ++ N TK  +YS++F  ARTCAQEEKLNVSV+P+S     G+L
Sbjct  79   PEGAFAVRLGEDASIKTRITNFTKGTFYSLSFNFARTCAQEEKLNVSVSPNSEPNDWGML  138

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  139  PMQTMYSS  146



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLLV  330
              VA +   ++NG FE   K  ++ GTVV     ++PGW I+GF+EYI +GQ Q DMLLV
Sbjct  14   FHVAFSFTHVINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLV  73

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTL  510
            VP G  AVRLGNEASIKQ L V K MYYSITF  ARTCAQEEKLNVS APD  VLP+QT+
Sbjct  74   VPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSAAPDWVVLPMQTV  133

Query  511  Y  513
            Y
Sbjct  134  Y  134



>gb|EMS58461.1| hypothetical protein TRIUR3_29087 [Triticum urartu]
Length=336

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +1

Query  178  LIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAV  354
            L+ NGNFE  P K   +NGTVV    A+P W  +GFVEYI +G  QGDMLLVVP+G  AV
Sbjct  20   LLPNGNFELGPAKSELVNGTVVKGGKAIPRWETSGFVEYIESGHKQGDMLLVVPQGAYAV  79

Query  355  RLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            RLGN+ASI Q++ V +  YY+ITF AARTCAQ E+LNVSV+P+SGVLP+QT+Y S
Sbjct  80   RLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPESGVLPMQTIYGS  134



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 94/121 (78%), Gaps = 5/121 (4%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG++ NGNFE   K +++ GT V+ + A+P W I+G+VEYI +GQTQGDMLL VP G  A
Sbjct  23   DGILPNGNFELGPKPSQMKGTKVVNRHAIPNWEISGYVEYIKSGQTQGDMLLPVPVGDYA  82

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVLPIQTLYS  516
            VRLG +ASIK K+ VTK ++YS++F  ARTCAQEEKLNVSV+P+S     G+LP+QT+YS
Sbjct  83   VRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEEKLNVSVSPNSEPNDWGMLPMQTMYS  142

Query  517  S  519
            S
Sbjct  143  S  143



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 6/128 (5%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +++++ DGL+ NGNFE   K +++ GT V    A+P W I+G+VEYI +GQTQGDMLL V
Sbjct  20   VALSVQDGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEYIRSGQTQGDMLLPV  79

Query  334  PEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            PEG  AVRLG +ASIK ++ NVT   +YS++F  ARTCAQEEKLNVSV+P     D G+L
Sbjct  80   PEGAFAVRLGEDASIKTRVTNVTSGSFYSLSFNFARTCAQEEKLNVSVSPNTEPNDWGML  139

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  140  PMQTMYSS  147



>ref|NP_001145978.1| hypothetical protein [Zea mays]
 gb|ACL52972.1| unknown [Zea mays]
 tpg|DAA58943.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=428

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +1

Query  175  GLIVNGNFE-APVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            GL+ NGNFE  P K   +NGTVV    A+P W  +GFVEYI +G  QGDMLLVVP+G  A
Sbjct  73   GLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGAHA  132

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEE--KLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASI+Q+L V +  YY+ITF AARTCAQ E  +LNVSV+P+ GVLP+QT+Y S
Sbjct  133  VRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSPEWGVLPMQTIYGS  190



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            I  GL+ NGNFE   K TEL GTVV   ++++P W I+G VEYI +GQ QGDMLLVVPEG
Sbjct  4    IYTGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEG  63

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPD  483
              AVRLGNEASIKQ++ V K MYYSITF  ARTCAQEE++N+SVAPD
Sbjct  64   AYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPD  110



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 5/128 (4%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
             I+ + TDGL+ NGNFE   K++E+ GT V+   ++P W  TGFVEYI + Q QGDM LV
Sbjct  14   HIASSWTDGLLPNGNFENGPKRSEMKGTRVINSRSIPFWETTGFVEYIKSTQKQGDMQLV  73

Query  331  VPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVL  495
            VPEG +AVRLG+ A++K K+ VT   +YS++F A+RTCAQEEKLN+S +P+S     G+L
Sbjct  74   VPEGNSAVRLGDGAAVKTKVKVTNGKFYSVSFSASRTCAQEEKLNISASPNSEPKDWGML  133

Query  496  PIQTLYSS  519
            PIQT+YSS
Sbjct  134  PIQTVYSS  141



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 99/127 (78%), Gaps = 5/127 (4%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++++  DGL+ NG+FE   K  +++GT V+   +VP W ++GFVEYI +GQ QGDM+L V
Sbjct  17   VALSFIDGLVPNGDFEEGPKPWQMHGTEVVDPHSVPHWELSGFVEYIKSGQKQGDMILPV  76

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVLP  498
            P+G+ A+RLGNEASIK K+ V K ++YS++F AARTCAQ+E+LN+SV+P+S     G+LP
Sbjct  77   PKGHFALRLGNEASIKTKVQVAKGLFYSLSFGAARTCAQQEQLNLSVSPNSEPKDWGMLP  136

Query  499  IQTLYSS  519
            +QT+YS+
Sbjct  137  MQTMYST  143



>gb|EMT04284.1| hypothetical protein F775_14656 [Aegilops tauschii]
Length=353

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  169  TDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYA  348
            TDGL+ NGNFE    +++++GT V  + A+P W   G VEYI +GQ QGDM+L VPEG  
Sbjct  25   TDGLLPNGNFEEAPDRSQMDGTRVTGRYAIPRWESCGCVEYICSGQKQGDMVLPVPEGAH  84

Query  349  AVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            AVRLGNEAS++Q+L+VT   +Y+ITF AARTCAQ EKLNV+V   SG LPIQT+Y+S
Sbjct  85   AVRLGNEASVQQQLSVTPGTHYAITFSAARTCAQAEKLNVTVGAQSGELPIQTVYTS  141



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            ++++ ITDGL+ NGNFE     ++L GT V+   A+P W  +GFVEYI +G+ QGDM+LV
Sbjct  15   RLALGITDGLLPNGNFERGPAPSQLRGTRVMGSSAIPAWQTSGFVEYIPSGRKQGDMVLV  74

Query  331  VPEGYAAVRLGNEASIKQKLN-VTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VPEG  AVRLGNEASI+Q+L+   +   YS+TF AARTCAQ E+LNVS +  SG+L +QT
Sbjct  75   VPEGAYAVRLGNEASIRQRLHGAARGARYSLTFSAARTCAQAEQLNVSASGQSGLLAMQT  134

Query  508  LYSS  519
            +YSS
Sbjct  135  MYSS  138



>dbj|BAJ96954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  169  TDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYA  348
            TDG++ NGNFE    +++++GT V  + A+P W + G VEYI +GQ QGDM+L VPEG  
Sbjct  31   TDGILPNGNFEEAPDRSQMDGTRVTGRYAIPRWEVCGCVEYICSGQKQGDMVLPVPEGAY  90

Query  349  AVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            A+RLGN+AS++Q+L+VT   +YSITF AARTCAQ E+LNV+VA +SG LPIQT+Y+S
Sbjct  91   AMRLGNDASVQQQLSVTPGTHYSITFSAARTCAQAERLNVTVAAESGQLPIQTVYTS  147



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            ++++ ITDGL+ NGNFE     ++L GT VL   ++P W  +GFVEYI +GQ QGDMLLV
Sbjct  20   RLALGITDGLLPNGNFERGPLPSQLRGTRVLGSSSIPSWQTSGFVEYIPSGQKQGDMLLV  79

Query  331  VPEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VPEG  AVRLGNEASI+Q+L        YS+TF AARTCAQ E+LN+S +  SG+L IQT
Sbjct  80   VPEGAYAVRLGNEASIRQRLRGAAPGARYSLTFSAARTCAQAERLNISASGQSGLLAIQT  139

Query  508  LYSS  519
             YSS
Sbjct  140  TYSS  143



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            + GT V+ + A+P W ++GFVEYI +G  QGDM+LVVP+G  AVRLGNEASIKQK+NV K
Sbjct  1    MKGTQVMNKTAIPKWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKINVKK  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              YY+ITF AARTCAQ+E+LNVSVAP  GV+PIQT+YSS
Sbjct  61   GSYYAITFSAARTCAQDEQLNVSVAPRHGVMPIQTVYSS  99



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            ++++ ITDGL+ NGNFE   + ++L GT V+   ++P W  +GFVEYI +GQ QGDM+LV
Sbjct  19   RLALGITDGLLANGNFERGPQPSQLRGTQVVGASSIPSWRTSGFVEYIPSGQKQGDMVLV  78

Query  331  VPEGYAAVRLGNEASIKQKLN-VTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VPEG  AVRLGNEASI Q+L        YS+TF AARTCAQ E+LNVS +  SGVL +QT
Sbjct  79   VPEGAYAVRLGNEASIAQRLRGAVPGARYSLTFSAARTCAQAERLNVSASGQSGVLVMQT  138

Query  508  LYSS  519
            +YSS
Sbjct  139  MYSS  142



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            +NGTVV    A+PGW I GFVEYI AG  QGDMLLVVPEG  AVRLGNEA I+Q + V  
Sbjct  1    MNGTVVRDHYAIPGWEIGGFVEYITAGHKQGDMLLVVPEGACAVRLGNEAYIRQSVAVAT  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             MYY+ITF AARTCAQEE++N++V P++ V P+QTLYSS
Sbjct  61   GMYYAITFSAARTCAQEERINITVPPETDVFPVQTLYSS  99



>ref|NP_001141282.1| hypothetical protein precursor [Zea mays]
 gb|ACF85954.1| unknown [Zea mays]
 tpg|DAA37150.1| TPA: hypothetical protein ZEAMMB73_862661 [Zea mays]
Length=375

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGD-MLLV  330
            ++ A  DGL+ NGNFE    K ++NGT V+ + ++P W I+GFVEYI++GQ Q + M++ 
Sbjct  19   VASANPDGLLPNGNFEQGPDKYQMNGTWVIGRKSIPCWEISGFVEYIVSGQQQDNGMVVA  78

Query  331  VPEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
            VPEG  AVRLGN+ASI+Q+L  +T+   YS+TF A+RTCAQ E+LNVSVAP+SGVLPIQT
Sbjct  79   VPEGARAVRLGNDASIRQRLTGMTRGTSYSVTFSASRTCAQAEQLNVSVAPESGVLPIQT  138

Query  508  LYSS  519
            +Y+S
Sbjct  139  VYTS  142



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
             ITDGL+ NGNFE     ++L GT V+   A+P W  +GFVEYI +GQ QGDM+LVVPEG
Sbjct  24   GITDGLLPNGNFERSPLPSQLRGTRVVGASAIPSWQTSGFVEYISSGQKQGDMVLVVPEG  83

Query  343  YAAVRLGNEASIKQKLN-VTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L    +   YS+TF AARTCAQ E+LNVS +  SG+L +QT+YSS
Sbjct  84   AYAVRLGNEASIRQRLRGAARGARYSLTFSAARTCAQAEQLNVSASGQSGLLAMQTMYSS  143



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            +++++ DGL+ NGNFE   K +++ GT V    A+P W I+G+VEYI AGQTQGDMLL V
Sbjct  15   VALSVQDGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEYIKAGQTQGDMLLPV  74

Query  334  PEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGVL  495
            PEG  AVRLG +A IK ++ NVT   +YS++F  ARTCAQEEKLNVSV+P     D  +L
Sbjct  75   PEGAFAVRLGEDAYIKTRVTNVTNGTFYSLSFNFARTCAQEEKLNVSVSPNNEPNDWAML  134

Query  496  PIQTLYSS  519
            P+QT+YSS
Sbjct  135  PMQTMYSS  142



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 6/129 (5%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            QI  ++ DGL+ NGNFE   K +++  T V+    +P W ++G+VEYI +GQ QGDMLL 
Sbjct  22   QIGSSLIDGLLPNGNFEQGPKPSQMKKTRVIDPHGIPHWELSGYVEYIKSGQMQGDMLLP  81

Query  331  VPEGYAAVRLGNEASIKQK-LNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GV  492
            VP+G  AVRLG +AS+K K +NVTK+ +YS++F  ARTCAQEE+LNVSV+P+S     G+
Sbjct  82   VPQGDYAVRLGEDASLKTKVINVTKETFYSLSFVFARTCAQEERLNVSVSPNSEPKDWGM  141

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  142  LPLQTMYSS  150



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  223  LNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVT  399
            + GTVV     A+PGW I+GF+EY+ +GQ QGDMLLVVP G  AVRLGN ASIKQK+ V 
Sbjct  1    MKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKVV  60

Query  400  KDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYS  516
            K MYYSITF  ARTCAQEEKLNVSVAPD  VLP+QTLYS
Sbjct  61   KGMYYSITFMVARTCAQEEKLNVSVAPDWVVLPMQTLYS  99



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 6/129 (5%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q+  ++ DGL+ NGNFE   K +++  T+V+   A+P W ++G+VEYI +GQ QGDMLL 
Sbjct  22   QVGSSLIDGLLPNGNFEQGPKPSQMKHTIVINPHAIPHWELSGYVEYIKSGQMQGDMLLP  81

Query  331  VPEGYAAVRLGNEASIKQK-LNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            VP+G  AVRLG +AS+K K +NVTK  +Y+++F  ARTCAQEE+LNVSV P     D G+
Sbjct  82   VPQGDFAVRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVTPSKEPKDWGM  141

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  142  LPLQTMYSS  150



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            + GT V+   A+P W ++GFVEYI +G  QGDM+LVVP+G  AVRLGNEASIKQK++V K
Sbjct  1    MKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKK  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              YYSITF AARTCAQ+E+LNVSVAP   V+PIQT+YSS
Sbjct  61   GSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSS  99



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 94/129 (73%), Gaps = 6/129 (5%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            Q+  ++ DGL+ NGNFE   K +++  T V+   A+P W ++G+VEYI +GQ QGDMLL 
Sbjct  22   QVCSSLIDGLLPNGNFEQGPKPSQMKHTRVMDPHAIPHWELSGYVEYIKSGQMQGDMLLP  81

Query  331  VPEGYAAVRLGNEASIKQK-LNVTKDMYYSITFCAARTCAQEEKLNVSVAP-----DSGV  492
            VP+G  AVRLG +AS+K K +NVTK  +Y+++F  ARTCAQEE+LNVSV P     D G+
Sbjct  82   VPQGDFAVRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVTPSKEPKDWGM  141

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  142  LPLQTMYSS  150



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 6/129 (5%)
 Frame = +1

Query  151  QISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLV  330
            QI  ++ DGL+ NGNFE   K +++  T V+   A+P W ++G+VEYI +GQ QGDMLL 
Sbjct  22   QIGSSLIDGLLPNGNFEQGPKSSQMKNTRVIDPHAIPHWELSGYVEYIKSGQMQGDMLLP  81

Query  331  VPEGYAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GV  492
            VP+G  AVRLG  AS+K K+ +VTK  +YS++F  ARTCAQEE+LNVSV+P+S     G+
Sbjct  82   VPQGDYAVRLGEGASLKTKVTSVTKGTFYSLSFVFARTCAQEERLNVSVSPNSEPKDWGM  141

Query  493  LPIQTLYSS  519
            LP+QT+YSS
Sbjct  142  LPLQTMYSS  150



>ref|XP_004976081.1| PREDICTED: uncharacterized protein LOC101764801 [Setaria italica]
Length=392

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 99/129 (77%), Gaps = 7/129 (5%)
 Frame = +1

Query  154  ISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVV  333
            ++ A+ DG ++NGNFE P  +++++G+ V  ++A+P W  TG VEYI +GQ QGDM+L V
Sbjct  20   VASAVGDGPLLNGNFEYPPNQSQMSGSKVTGENAIPYWKTTGTVEYIGSGQQQGDMILTV  79

Query  334  PEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGV-------  492
            PEG  A+RLG++ASI+Q+++VT+ +YYS+TF A+RTCAQ+EKL++++ P +G        
Sbjct  80   PEGAHALRLGSDASIQQQISVTRGLYYSVTFRASRTCAQDEKLSLTIVPVTGYPVQSGEP  139

Query  493  LPIQTLYSS  519
            LPIQT+YSS
Sbjct  140  LPIQTVYSS  148



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            AITDGL+ NGNFE     ++L GT V+   A+P W  +GFVEYI +G+ QGDM+LVVPEG
Sbjct  26   AITDGLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEYIPSGRKQGDMVLVVPEG  85

Query  343  YAAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
              AVRLGNEASI+Q+L    +   Y++TF AARTCAQ E+LNVS +    VLP+QT+YSS
Sbjct  86   SHAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNVSASGQWAVLPMQTMYSS  145



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 5/104 (5%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            + GTVV   +A+P W  +G+VEYI +G  QGDMLLVVPEG  A+RLGNEASIKQK+ VTK
Sbjct  1    MKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLLVVPEGGFAIRLGNEASIKQKIKVTK  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTLYSS  519
              +Y+ITF AARTCAQEE LN+SV P     D G+LPIQT+YSS
Sbjct  61   GGFYAITFSAARTCAQEEILNISVNPNVEKQDFGILPIQTMYSS  104



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = +1

Query  166  ITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGY  345
            ITDGL+ NGNFE     ++L GT V+   A+P W  +GFVEYI +G+ QGDM+LVVPEG 
Sbjct  27   ITDGLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEYIPSGRKQGDMVLVVPEGS  86

Query  346  AAVRLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
             AVRLGNEASI+Q+L    +   Y++TF AARTCAQ E+LNVS +    VLP+QT+YSS
Sbjct  87   HAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNVSASGQWAVLPMQTMYSS  145



>gb|ABR13280.1| unknown protein [Prunus dulcis]
Length=175

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  289  YILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNV  468
            YI +GQ QGDMLLVVPEG  AVRLGNEASIKQ++ VTK +YYSITF AARTCAQEE+LN+
Sbjct  2    YIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNI  61

Query  469  SVAPDSGVLPIQTLYSS  519
            SVAPDSGVLPIQT+YSS
Sbjct  62   SVAPDSGVLPIQTVYSS  78



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = +1

Query  220  ELNGTVVLK-QDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNV  396
            E  GTVV     ++PGW I+GF+EYI +GQ Q DMLLVVP G  AVRLGNEASIKQ L V
Sbjct  25   ERQGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKV  84

Query  397  TKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLY  513
             K MYYSITF  ARTCAQEEKLNVS APD  VLP+QT+Y
Sbjct  85   VKGMYYSITFVVARTCAQEEKLNVSAAPDWVVLPMQTVY  123



>gb|EMT19274.1| hypothetical protein F775_14136 [Aegilops tauschii]
Length=393

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG ++NGNFE    ++++NG+ V  + A+P W  TGFVEYI  G  Q  M+LVVPEG  A
Sbjct  23   DGPLLNGNFEQAPNRSQMNGSRVTGKYAIPHWKATGFVEYIECGAKQDHMVLVVPEGRHA  82

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP---DSGVLPIQTLYSS  519
            VRLG E+SI+ +L+VT+  YYS+TF AARTCAQ EKL VS+ P     G LP+QT+Y+S
Sbjct  83   VRLGTESSIEHQLSVTRGKYYSVTFSAARTCAQSEKLRVSIVPGDVSGGELPVQTVYTS  141



>gb|EMS51274.1| hypothetical protein TRIUR3_06873 [Triticum urartu]
Length=377

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG ++NGNFE    ++++NG+ V  + A+P W  TGFVEYI  G  Q  M+LVVPEG  A
Sbjct  23   DGPLLNGNFEQAPNRSQMNGSRVTGKYAIPHWKATGFVEYIECGAKQDHMVLVVPEGRHA  82

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP---DSGVLPIQTLYSS  519
            VRLG ++SI+ +L+VT+  YYS+TF AARTCAQ EKL+VS+ P     G LP+QT+Y+S
Sbjct  83   VRLGTDSSIEHQLSVTRGKYYSVTFSAARTCAQSEKLSVSIVPGDASGGELPVQTVYTS  141



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = +1

Query  223  LNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAVRLGNEASIKQKLNVTK  402
            + G+ V+   ++P W I GFVEYI +GQ QGDMLLVVPEG  AVRLG+EASIK K+ V K
Sbjct  1    MKGSRVIDPHSIPHWEIWGFVEYIESGQKQGDMLLVVPEGRYAVRLGDEASIKTKVKVEK  60

Query  403  DMYYSITFCAARTCAQEEKLNVSVAP-----DSGVLPIQTLYSS  519
            D++YS++F AARTCAQ+E LN+SV+P     D G+LP+QT+YSS
Sbjct  61   DLFYSLSFSAARTCAQDEVLNLSVSPNKEPNDWGMLPMQTMYSS  104



>ref|XP_003581384.1| PREDICTED: uncharacterized protein LOC100823957 [Brachypodium 
distachyon]
Length=386

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DG ++NGNFE    +++++G  VL  DA+P W  TGFVEY+  G  QGDM L VPEG  A
Sbjct  30   DGPLLNGNFEDTPDRSQMDGLKVLGPDAIPYWKTTGFVEYVERGAKQGDMALTVPEGAHA  89

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQ-EEKLNVSVAPD---SGVLPIQTLYS  516
            VRLG ++SI+Q+L+VT   +Y+ITF AARTC Q +E+LNVS+ PD   +G LPIQT+YS
Sbjct  90   VRLGIQSSIEQQLSVTPGRHYAITFSAARTCTQADERLNVSILPDGVAAGELPIQTIYS  148



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  SQISVAITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLL  327
            S ++  I +GL+ NGNFE P  +T L  TV++ ++++P W I GFVEYI  G   G M  
Sbjct  21   SALAGTILEGLLANGNFEEPPAQTNLKKTVIIGKNSLPSWEINGFVEYISGGPQPGGMFF  80

Query  328  VVPEGYAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQT  507
             V  G  AVRLGNEASI Q +NV K   Y++TF A+RTCAQ+E L+V V P +G LP+QT
Sbjct  81   PVAHGVHAVRLGNEASISQIINVKKGSLYALTFGASRTCAQDEVLSVLVPPQNGSLPLQT  140

Query  508  LYSS  519
            LYSS
Sbjct  141  LYSS  144



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  175  GLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAAV  354
            GL+ NGNFE     ++L GT V+   A+P W  +GFVEYI +G+ QGDM+LVVPEG  AV
Sbjct  16   GLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEYIPSGRKQGDMVLVVPEGSHAV  75

Query  355  RLGNEASIKQKL-NVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            RLGNEASI+Q+L    +   Y++TF AARTCAQ E+LNVS +    VLP+QT+YSS
Sbjct  76   RLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNVSASGQWAVLPMQTMYSS  131



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            +GL+ NGNFE P K + L  TV++ ++A+P W I GFVEYI  G   G M   V  G  A
Sbjct  29   EGLLANGNFEEPPKPSSLKKTVLIGKNALPKWEINGFVEYISGGPQPGGMYFAVAHGVHA  88

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEASI Q + V     Y++TF A+RTCAQEE L VSV P +G LP+QTLYSS
Sbjct  89   VRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPPQAGDLPLQTLYSS  144



>ref|XP_003581666.1| PREDICTED: uncharacterized protein LOC100833858 [Brachypodium 
distachyon]
Length=403

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            DGL+ NGNFE     +++NGT V    A+P W  TGFVEYI +G TQG M+L VPEG  A
Sbjct  27   DGLLQNGNFEYAPDGSQMNGTRVTGPHAIPNWESTGFVEYIDSGTTQGGMVLSVPEGAHA  86

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDS-----GVLPIQTLYS  516
            VRLG ++S++Q+L+VT   YYS+TF AARTCAQ EKL +SV P         LPIQT+YS
Sbjct  87   VRLGVDSSVRQQLSVTNGSYYSVTFSAARTCAQSEKLRLSVIPGHDDDAPNELPIQTVYS  146

Query  517  S  519
            +
Sbjct  147  T  147



>ref|XP_002446723.1| hypothetical protein SORBIDRAFT_06g021270 [Sorghum bicolor]
 gb|EES11051.1| hypothetical protein SORBIDRAFT_06g021270 [Sorghum bicolor]
Length=400

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A+ DG ++NGNFE     ++++G+VV  + A+  W  +G +E+I +GQTQGDM+L VP+G
Sbjct  28   AVGDGPLLNGNFEDSPNPSQMSGSVVTGEHAISYWRTSGHIEFICSGQTQGDMVLTVPDG  87

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGV--------LP  498
              A+RLGN ASI+Q++++T   YYS+TF A+RTCAQ+E LNV+ AP SG         LP
Sbjct  88   AHALRLGNGASIEQRISLTPGSYYSLTFSASRTCAQDEVLNVTAAPVSGSGAAAQTGELP  147

Query  499  IQTLYSS  519
            IQT+Y+S
Sbjct  148  IQTVYTS  154



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  163  AITDGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEG  342
            A +DGL+ NGNFE     + L G+VV+ ++++P W I G VEY+ +GQ  GD++LV+PEG
Sbjct  21   AFSDGLLPNGNFEKAPSHSSLKGSVVIGKNSLPDWEIGGAVEYVKSGQKSGDLMLVIPEG  80

Query  343  YAAVRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAP----DSGVLPIQTL  510
            +AAVRLG++A I+Q+++V K   Y++T  AARTCA +EKLNV+V+     DSG++ +QT+
Sbjct  81   FAAVRLGSDAFIRQRVSVNKGELYALTLSAARTCASDEKLNVTVSTDSIRDSGLISVQTI  140

Query  511  YSS  519
            Y++
Sbjct  141  YNA  143



>emb|CDY28002.1| BnaC05g44040D [Brassica napus]
Length=365

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  DGLIVNGNFEAPVKKTELNGTVVLKQDAVPGWIITGFVEYILAGQTQGDMLLVVPEGYAA  351
            +G + NGNFE   KKT++  TV+L + A+P W+ TGFVEYI  G   G M   V  G  A
Sbjct  26   EGFLRNGNFEESPKKTDMKKTVLLGKTALPEWVTTGFVEYIAGGPQPGGMYFPVAHGVHA  85

Query  352  VRLGNEASIKQKLNVTKDMYYSITFCAARTCAQEEKLNVSVAPDSGVLPIQTLYSS  519
            VRLGNEA I QKL V     Y++TF A+RTCAQ+E L VSV P SG LP+QTLY+S
Sbjct  86   VRLGNEAKISQKLKVKPGSLYALTFGASRTCAQDEVLRVSVPPQSGDLPLQTLYNS  141



Lambda      K        H        a         alpha
   0.316    0.131    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000