BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014J24

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004171648.1|  PREDICTED: serine/threonine-protein phosphat...    114   2e-28   
ref|XP_003591564.1|  Serine/threonine protein phosphatase               115   2e-28   
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    120   6e-28   
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    120   6e-28   Fragaria vesca subsp. vesca
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               120   7e-28   Gossypium arboreum [tree cotton]
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          120   7e-28   
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               120   8e-28   Gossypium arboreum [tree cotton]
emb|CDP03570.1|  unnamed protein product                                119   1e-27   Coffea canephora [robusta coffee]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             118   4e-27   Prunus persica
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    117   4e-27   Solanum tuberosum [potatoes]
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    117   4e-27   Prunus mume [ume]
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    117   5e-27   
ref|NP_001266004.1|  Hop-interacting protein THI129                     117   5e-27   Solanum lycopersicum
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    117   5e-27   Cicer arietinum [garbanzo]
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    117   8e-27   Nicotiana sylvestris
gb|EYU44112.1|  hypothetical protein MIMGU_mgv1a025841mg                111   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  116   1e-26   Ricinus communis
gb|EYU38113.1|  hypothetical protein MIMGU_mgv1a0013161mg               116   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_006575099.1|  PREDICTED: serine/threonine-protein phosphat...    116   1e-26   
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    116   2e-26   Cucumis melo [Oriental melon]
gb|AES61845.2|  serine/threonine-protein phosphatase                    116   2e-26   Medicago truncatula
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-26   
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    115   2e-26   
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             115   3e-26   Phaseolus vulgaris [French bean]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    115   3e-26   Glycine max [soybeans]
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    115   3e-26   
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    115   4e-26   Nicotiana tomentosiformis
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         115   4e-26   Jatropha curcas
ref|XP_010556800.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-26   
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    115   5e-26   Pyrus x bretschneideri [bai li]
gb|KJB42021.1|  hypothetical protein B456_007G132700                    114   5e-26   Gossypium raimondii
gb|EPS69063.1|  serine/threonine-protein phosphatase                    111   7e-26   Genlisea aurea
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    114   7e-26   Tarenaya hassleriana [spider flower]
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    114   8e-26   Morella rubra [Chinese arbutus]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    114   8e-26   Sesamum indicum [beniseed]
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    114   1e-25   Vitis vinifera
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-25   Glycine max [soybeans]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    113   2e-25   Gossypium arboreum [tree cotton]
gb|KDO87445.1|  hypothetical protein CISIN_1g002713mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    112   3e-25   Nelumbo nucifera [Indian lotus]
gb|KJB22560.1|  hypothetical protein B456_004G054500                    112   4e-25   Gossypium raimondii
gb|KJB22562.1|  hypothetical protein B456_004G054500                    112   4e-25   Gossypium raimondii
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             112   4e-25   Citrus clementina [clementine]
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             112   4e-25   Citrus clementina [clementine]
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             112   4e-25   Capsella rubella
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    112   5e-25   Brassica rapa
emb|CDX90906.1|  BnaA03g25860D                                          112   5e-25   
emb|CDY17964.1|  BnaC03g30360D                                          112   5e-25   Brassica napus [oilseed rape]
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    111   8e-25   Eucalyptus grandis [rose gum]
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    111   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    110   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    110   2e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    110   2e-24   
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    110   2e-24   
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    110   2e-24   
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             110   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM83219.1|  AT4g03080/T4I9_4                                        109   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    109   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321044.2|  phosphatase family protein                         108   8e-24   
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    107   2e-23   Arabis alpina [alpine rockcress]
ref|XP_008813653.1|  PREDICTED: serine/threonine-protein phosphat...    103   3e-23   Phoenix dactylifera
ref|XP_008813652.1|  PREDICTED: serine/threonine-protein phosphat...    103   3e-23   
ref|XP_008813651.1|  PREDICTED: serine/threonine-protein phosphat...    103   3e-23   
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    107   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    106   3e-23   Nelumbo nucifera [Indian lotus]
emb|CDY62088.1|  BnaC02g46770D                                          106   5e-23   Brassica napus [oilseed rape]
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             106   5e-23   Eutrema salsugineum [saltwater cress]
ref|XP_011011094.1|  PREDICTED: serine/threonine-protein phosphat...    106   5e-23   Populus euphratica
emb|CDX97296.1|  BnaA02g20870D                                          106   6e-23   
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    106   6e-23   Populus euphratica
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    106   6e-23   Populus euphratica
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    105   7e-23   Brassica rapa
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    105   9e-23   Populus euphratica
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    105   9e-23   Populus euphratica
ref|XP_002301559.1|  phosphatase family protein                         105   1e-22   
emb|CAN67846.1|  hypothetical protein VITISV_016669                   98.2    8e-22   Vitis vinifera
gb|AEK86563.1|  serine/threonine-protein phosphatase                    102   2e-21   Camellia sinensis [black tea]
ref|XP_010910522.1|  PREDICTED: serine/threonine-protein phosphat...  97.8    2e-21   Elaeis guineensis
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    101   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    101   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN47652.1|  Serine/threonine-protein phosphatase BSL1             80.5    2e-16   Glycine soja [wild soybean]
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  82.8    5e-15   Elaeis guineensis
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    1e-14   Setaria italica
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440        80.5    3e-14   Sorghum bicolor [broomcorn]
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    4e-14   Phoenix dactylifera
gb|AFW82656.1|  hypothetical protein ZEAMMB73_760112                  78.2    1e-13   
ref|XP_006846753.1|  hypothetical protein AMTR_s00276p00018700        75.1    2e-13   
ref|NP_001054625.1|  Os05g0144400                                     77.8    3e-13   
gb|EEE62303.1|  hypothetical protein OsJ_17091                        77.8    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...  77.8    3e-13   Zea mays [maize]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...  77.8    3e-13   Zea mays [maize]
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...  77.8    3e-13   Brachypodium distachyon [annual false brome]
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1           75.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...  72.8    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...  72.8    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1        70.9    6e-11   
gb|KHN03760.1|  Serine/threonine-protein phosphatase BSL1             63.9    1e-10   Glycine soja [wild soybean]
gb|AFW82657.1|  hypothetical protein ZEAMMB73_760112                  63.5    1e-09   
ref|XP_001781021.1|  predicted protein                                60.8    1e-07   
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...  60.5    1e-07   
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...  60.5    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...  60.1    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_001782643.1|  predicted protein                                58.9    3e-07   
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    4e-07   Eucalyptus grandis [rose gum]
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371           58.5    5e-07   
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932           58.5    5e-07   
gb|KGN66599.1|  hypothetical protein Csa_1G638460                     58.2    7e-07   Cucumis sativus [cucumbers]
ref|XP_001760494.1|  predicted protein                                58.2    7e-07   
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2        58.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19666.1|  AT1G08420                                            58.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2           58.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690        58.2    7e-07   
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...  58.2    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    1e-06   
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    1e-06   
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    1e-06   Glycine max [soybeans]
ref|XP_006367867.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    1e-06   
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   Fragaria vesca subsp. vesca
gb|KJB35474.1|  hypothetical protein B456_006G116600                  57.4    1e-06   Gossypium raimondii
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   Prunus mume [ume]
gb|KJB35473.1|  hypothetical protein B456_006G116600                  57.4    1e-06   Gossypium raimondii
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   Prunus mume [ume]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg           57.4    1e-06   Prunus persica
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...  57.4    1e-06   Gossypium arboreum [tree cotton]
gb|KJB35470.1|  hypothetical protein B456_006G116600                  57.4    1e-06   Gossypium raimondii
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g           57.4    1e-06   Phaseolus vulgaris [French bean]
gb|KHG00523.1|  Serine/threonine-protein phosphatase BSL3 -like p...  56.6    1e-06   Gossypium arboreum [tree cotton]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    1e-06   
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...  57.4    1e-06   Gossypium arboreum [tree cotton]
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2        57.4    2e-06   
ref|XP_006594918.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    2e-06   Glycine max [soybeans]
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    2e-06   Glycine max [soybeans]
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    2e-06   Glycine max [soybeans]
gb|KJB55556.1|  hypothetical protein B456_009G082300                  57.0    2e-06   Gossypium raimondii
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1        57.0    2e-06   
ref|XP_002513729.1|  hypothetical protein RCOM_1754260                53.9    2e-06   
ref|XP_004166313.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-06   
ref|XP_002889692.1|  kelch repeat-containing protein                  57.0    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g           57.0    2e-06   Phaseolus vulgaris [French bean]
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    2e-06   Glycine max [soybeans]
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                 57.0    2e-06   Citrus sinensis [apfelsine]
gb|EYU25964.1|  hypothetical protein MIMGU_mgv1a0006242mg             56.2    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_001765008.1|  predicted protein                                57.0    2e-06   
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    2e-06   Vitis vinifera
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg           56.6    2e-06   Citrus clementina [clementine]
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg           56.6    2e-06   
ref|XP_010658896.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    2e-06   
ref|NP_001266022.1|  Hop-interacting protein THI140                   56.6    2e-06   Solanum lycopersicum
emb|CBI24435.3|  unnamed protein product                              56.6    2e-06   Vitis vinifera
ref|XP_010658894.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    2e-06   
gb|EYU41291.1|  hypothetical protein MIMGU_mgv1a0202661mg             55.8    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg           56.6    2e-06   Capsella rubella
ref|XP_010658895.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    2e-06   
emb|CBI24997.3|  unnamed protein product                              56.6    3e-06   Vitis vinifera
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                  56.6    3e-06   Arabis alpina [alpine rockcress]
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...  56.2    3e-06   Vitis vinifera
emb|CDY22684.1|  BnaC08g43180D                                        56.2    3e-06   Brassica napus [oilseed rape]
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    3e-06   Brassica rapa
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g           56.2    3e-06   
emb|CDY06313.1|  BnaA09g48900D                                        56.2    3e-06   
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    3e-06   Populus euphratica
gb|KDP42962.1|  hypothetical protein JCGZ_23904                       55.8    4e-06   Jatropha curcas
dbj|BAF00990.1|  putative phosphoprotein phosphatase                  55.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    5e-06   
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    5e-06   Glycine max [soybeans]
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    5e-06   Nicotiana sylvestris
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    5e-06   Nicotiana sylvestris
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    5e-06   Nicotiana sylvestris
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    6e-06   
ref|XP_003596905.1|  Serine/threonine protein phosphatase             55.5    6e-06   Medicago truncatula
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    6e-06   Cicer arietinum [garbanzo]
ref|XP_001769730.1|  predicted protein                                55.1    6e-06   
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    6e-06   Populus euphratica
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Populus euphratica
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_002313501.2|  kelch repeat-containing family protein           55.1    7e-06   
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Cucumis melo [Oriental melon]
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg           55.1    7e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    8e-06   Camelina sativa [gold-of-pleasure]
gb|AFW68154.1|  hypothetical protein ZEAMMB73_166373                  52.8    8e-06   
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    8e-06   Sesamum indicum [beniseed]
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    8e-06   Sesamum indicum [beniseed]
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    8e-06   Sesamum indicum [beniseed]
gb|KJB21740.1|  hypothetical protein B456_004G011600                  55.1    8e-06   Gossypium raimondii
gb|AAF22889.1|AC006932_6  T27G7.10                                    55.1    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001785960.1|  predicted protein                                54.7    8e-06   
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg           54.7    8e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009788953.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    9e-06   Nicotiana sylvestris
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    9e-06   Solanum tuberosum [potatoes]
emb|CDP15567.1|  unnamed protein product                              54.7    9e-06   Coffea canephora [robusta coffee]
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    9e-06   
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    9e-06   Nicotiana tomentosiformis
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    9e-06   Solanum lycopersicum
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    9e-06   Nicotiana tomentosiformis
dbj|BAK03675.1|  predicted protein                                    54.3    9e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY31148.1|  BnaA08g26980D                                        54.7    1e-05   Brassica napus [oilseed rape]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    1e-05   Solanum lycopersicum
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3        54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    1e-05   Brassica rapa
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like   54.7    1e-05   Solanum tuberosum [potatoes]
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3           54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX97481.1|  BnaC08g13460D                                        54.7    1e-05   
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg              54.7    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...  54.7    1e-05   
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    1e-05   Solanum lycopersicum
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...  54.3    1e-05   Medicago truncatula
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg           54.3    1e-05   
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    1e-05   Solanum tuberosum [potatoes]
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    1e-05   Solanum tuberosum [potatoes]
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    1e-05   Solanum lycopersicum
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...  53.9    1e-05   Nicotiana tomentosiformis
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...  53.5    2e-05   Zea mays [maize]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...  53.5    2e-05   
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  53.5    2e-05   Nicotiana sylvestris
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...  53.1    3e-05   Cucumis sativus [cucumbers]
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...  53.1    3e-05   Cicer arietinum [garbanzo]
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...  53.1    3e-05   Sesamum indicum [beniseed]
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...  53.1    3e-05   Sesamum indicum [beniseed]
gb|EPS70499.1|  hypothetical protein M569_04238                       53.1    3e-05   Genlisea aurea
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...  53.1    3e-05   Setaria italica
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850        53.1    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    4e-05   Zea mays [maize]
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    4e-05   Beta vulgaris subsp. vulgaris [field beet]
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...  52.8    4e-05
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...  52.4    5e-05   
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...  52.4    5e-05   
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...  52.4    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75832.1|  hypothetical protein OsI_12812                        52.4    6e-05   Oryza sativa Indica Group [Indian rice]
emb|CDY57485.1|  BnaAnng14650D                                        52.0    7e-05   Brassica napus [oilseed rape]
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...  52.0    7e-05   Brassica rapa
emb|CDY57791.1|  BnaCnng32470D                                        52.0    7e-05   Brassica napus [oilseed rape]
gb|AAD26883.1|  putative phosphoprotein phosphatase                   51.6    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...  51.2    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...  51.2    1e-04   Setaria italica
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460        51.2    1e-04   Sorghum bicolor [broomcorn]
ref|XP_009598633.1|  PREDICTED: serine/threonine-protein phosphat...  50.8    1e-04   Nicotiana tomentosiformis
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...  51.2    1e-04   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg           51.2    1e-04   
gb|EPS67556.1|  serine/threonine-protein phosphatase                  50.4    1e-04   Genlisea aurea
ref|NP_001067290.1|  Os12g0617900                                     51.2    1e-04   
ref|XP_009598634.1|  PREDICTED: serine/threonine-protein phosphat...  50.4    2e-04   Nicotiana tomentosiformis
ref|XP_003605990.1|  Serine/threonine protein phosphatase             50.4    2e-04   
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...  50.8    2e-04   Oryza brachyantha
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...  50.8    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_004173418.1|  PREDICTED: serine/threonine-protein phosphat...  50.4    2e-04   
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...  50.4    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    3e-04   Phoenix dactylifera
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    3e-04   Phoenix dactylifera
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    3e-04   Phoenix dactylifera
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    3e-04   
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2             48.9    8e-04   Glycine soja [wild soybean]
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...  48.9    8e-04   Elaeis guineensis
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...  48.5    8e-04   Elaeis guineensis



>ref|XP_004171648.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like, partial 
[Cucumis sativus]
Length=173

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSAAPGIRLAGVTNSVHSYD  81



>ref|XP_003591564.1| Serine/threonine protein phosphatase, partial [Medicago truncatula]
Length=203

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN++H+YD
Sbjct  61   STSAPGIRLAGVTNSVHAYD  80



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSSAPGIRLAGVTNSVHSYD  81



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M++KPWLYPAPTYR+LET+WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MSSKPWLYPAPTYRTLETYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>ref|XP_010112705.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
 gb|EXC34663.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
Length=883

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR LET+WDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYRSLETFW TD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSLETFWATDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            NGG  GIRLAGVTN+IHSYD
Sbjct  61   NGGAPGIRLAGVTNSIHSYD  80



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            NG   GIRLAGVTN IHSYD
Sbjct  61   NGAAPGIRLAGVTNCIHSYD  80



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>ref|XP_004496005.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Cicer arietinum]
Length=885

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN++HSYD
Sbjct  61   SSSAPGIRLAGVTNSVHSYD  80



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            NG   GIRLAGVTN IHSYD
Sbjct  61   NGAAPGIRLAGVTNCIHSYD  80



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN++HSYD
Sbjct  61   SSSAPGIRLAGVTNSVHSYD  80



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +G   GIRLAGVTN +HSYD
Sbjct  61   SGAAPGIRLAGVTNCVHSYD  80



>gb|EYU44112.1| hypothetical protein MIMGU_mgv1a025841mg [Erythranthe guttata]
Length=207

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
            +GG    + LAGVTN IHSYD
Sbjct  61   SGGLSPFLGLAGVTNCIHSYD  81



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT THGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   GSSSAPGIRLAGVTNSVHSYD  81



>gb|EYU38113.1| hypothetical protein MIMGU_mgv1a0013161mg, partial [Erythranthe 
guttata]
Length=696

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +GG  GIRLAGVTN IHSYD
Sbjct  61   SGGAPGIRLAGVTNCIHSYD  80



>ref|XP_006575099.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Glycine max]
Length=753

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSAPGIRLAGVTNTVHSYD  80



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSAAPGIRLAGVTNSVHSYD  81



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN++H+YD
Sbjct  61   STSAPGIRLAGVTNSVHAYD  80



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCSHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSAAPGIRLAGVTNSVHSYD  81



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPA TYR+LETFWDTDED PGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPASTYRNLETFWDTDEDGPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSAPGIRLAGVTNTVHSYD  80



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSAPGIRLAGVTNTVHSYD  80



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRLAGVTN++HSYD
Sbjct  61   AASAPGIRLAGVTNSVHSYD  80



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATK HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKIHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +G   GIRLAGVTN +HSYD
Sbjct  61   SGAAPGIRLAGVTNCVHSYD  80



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT +HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNSHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   GSSSAPGIRLAGVTNSVHSYD  81



>ref|XP_010556800.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X3 [Tarenaya hassleriana]
Length=756

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            N    GIRLAGVTN++HSYD
Sbjct  61   NSSTPGIRLAGVTNSVHSYD  80



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  --nggpgiRLAGVTNAIHSYD  510
              +  PGIRLAGVTN++HSYD
Sbjct  61   GPSSAPGIRLAGVTNSVHSYD  81



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQSPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSSSPGIRLAGVTNSVHSYD  81



>gb|EPS69063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=348

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR LE+FWD ++D+PGPRCGHTLTAV+ATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLESFWDAEDDSPGPRCGHTLTAVSATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            NG   GIRLAGVTN++HSYD
Sbjct  61   NGAAPGIRLAGVTNSVHSYD  80



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            N    GIRLAGVTN++HSYD
Sbjct  61   NSSTPGIRLAGVTNSVHSYD  80



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL PAPTYR+LET+WDTDEDAPGPRCGHTLTAVAATK+HG RLILFGGATAIEGG
Sbjct  1    MGSKPWLSPAPTYRTLETYWDTDEDAPGPRCGHTLTAVAATKSHGARLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSSAPGIRLAGVTNSVHSYD  81



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL PAPTYR+LE++WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLCPAPTYRTLESYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            NGG  GIRLAGVTN++HSYD
Sbjct  61   NGGAPGIRLAGVTNSVHSYD  80



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 2/79 (3%)
 Frame = +1

Query  280  AKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggng  459
            +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILFGGATAIEGG  
Sbjct  4    SKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGAS  63

Query  460  gpg--iRLAGVTNAIHSYD  510
                 IRLAGVTN++HSYD
Sbjct  64   SSAPGIRLAGVTNSVHSYD  82



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR++ET WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETVWDTDEDAPGPRCGHTLTAVAATKTLGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +H+YD
Sbjct  61   SSSAPGIRLAGVTNTVHAYD  80



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQPPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
            +      IRLAGVTN++HSYD
Sbjct  61   SSSSSPGIRLAGVTNSVHSYD  81



>gb|KDO87445.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=769

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++H YD
Sbjct  61   ATSSAPGIRLAGVTNSVHLYD  81



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYRS+ET W+TDEDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSVETSWETDEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  n-ggpgiRLAGVTNAIHSYD  510
                PGIRLAGVT+++HSYD
Sbjct  61   GPSAPGIRLAGVTSSVHSYD  80



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++H YD
Sbjct  61   ATSSAPGIRLAGVTNSVHLYD  81



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++H YD
Sbjct  61   ATSSAPGIRLAGVTNSVHLYD  81



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN++HSYD
Sbjct  61   SSSVPGIRLAGVTNSVHSYD  80



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            N    GIRLAGVTN +HSYD
Sbjct  61   NSSVPGIRLAGVTNTVHSYD  80



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            N    GIRLAGVTN +HSYD
Sbjct  61   NSSVPGIRLAGVTNTVHSYD  80



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            N    GIRLAGVTN +HSYD
Sbjct  61   NSSVPGIRLAGVTNTVHSYD  80



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WD DEDAP PR GHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRNLETYWDADEDAPLPRVGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   AASSAPGIRLAGVTNSVHSYD  81



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
            +      IRLAGVTN++HSYD
Sbjct  61   STSSVPGIRLAGVTNSVHSYD  81



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWDT+EDAPGPRC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYQALETFWDTEEDAPGPRCAHTLTAVAATKTRGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            N    GIRLAGVTN++HSYD
Sbjct  61   NSSTPGIRLAGVTNSVHSYD  80



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN++HSYD
Sbjct  61   SSSVPGIRLAGVTNSVHSYD  80



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   GSSSVPGIRLAGVTNSVHSYD  81



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpgiRLAGVTNAIHSYD  510
                   + GVTN++HSYD
Sbjct  61   AASAPG-ITGVTNSVHSYD  78



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   GSSSVPGIRLAGVTNSVHSYD  81



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSVPGIRLAGVTNTVHSYD  80



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSVPGIRLAGVTNTVHSYD  80



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSVPGIRLAGVTNTVHSYD  80



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAPTYR+LET+WD+D+DAPG RC HTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRTLETYWDSDDDAPGSRCAHTLTAVAATKSQGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRLAGVTN++HSYD
Sbjct  61   ASSAPGIRLAGVTNSVHSYD  80



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MA KP+L+PAP Y+SLETFWD ++DAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MATKPFLHPAPQYKSLETFWDEEDDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSVPGIRLAGVTNTVHSYD  80



>ref|XP_008813653.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Phoenix dactylifera]
Length=349

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN+IHSYD
Sbjct  61   ASSAVPGIRLAGVTNSIHSYD  81



>ref|XP_008813652.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Phoenix dactylifera]
Length=350

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN+IHSYD
Sbjct  61   ASSAVPGIRLAGVTNSIHSYD  81



>ref|XP_008813651.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Phoenix dactylifera]
Length=351

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN+IHSYD
Sbjct  61   ASSAVPGIRLAGVTNSIHSYD  81



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = +1

Query  271  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  450
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  451  g--nggpgiRLAGVTNAIHSYD  510
            G  +  PGIRLAGVTN++HSYD
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYD  83



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = +1

Query  271  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  450
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  451  g--nggpgiRLAGVTNAIHSYD  510
            G  +  PGIRLAGVTN++HSYD
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYD  83



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
            N      IRLAGVTN++HSYD
Sbjct  61   NSSSVPGIRLAGVTNSVHSYD  81



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  K WL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKQWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
            +    GIRLAGVTN +HSYD
Sbjct  61   SSSLPGIRLAGVTNTVHSYD  80



>ref|XP_011011094.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X3 [Populus euphratica]
Length=781

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRL G TN++HSYD
Sbjct  61   ASSAPGIRLDGATNSVHSYD  80



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
            N      IRLAGVTN++HSYD
Sbjct  61   NSPSVPGIRLAGVTNSVHSYD  81



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRLAGVTN++HSYD
Sbjct  61   ASSAPGIRLAGVTNSVHSYD  80



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRLAGVTN++HSYD
Sbjct  61   ASSAPGIRLAGVTNSVHSYD  80



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
            N      IRLAGVTN++HSYD
Sbjct  61   NSPSVPGIRLAGVTNSVHSYD  81



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRL G TN++HSYD
Sbjct  61   ASSAPGIRLDGATNSVHSYD  80



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  454  nggp-giRLAGVTNAIHSYD  510
                 GIRL G TN++HSYD
Sbjct  61   ASSAPGIRLDGATNSVHSYD  80



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRALETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  454  nggp---giRLAGVTNAIHSYD  510
                     RL G TN++HSYD
Sbjct  61   ASSAPGISYRLDGATNSVHSYD  82



>emb|CAN67846.1| hypothetical protein VITISV_016669 [Vitis vinifera]
Length=208

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  277  AAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF  426
             +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILF
Sbjct  3    GSKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILF  52



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +    YPAPTYR+LET+WD+D+D+PGPRC HTLTAV+ATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSNRQFYPAPTYRTLETYWDSDDDSPGPRCSHTLTAVSATKSQGPRLILFGGATAIEGG  60

Query  454  nggpgi---RLAGVTNAIHSYD  510
                     RLAGVTNAIHSYD
Sbjct  61   ASSSSAPGIRLAGVTNAIHSYD  82



>ref|XP_010910522.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Elaeis guineensis]
Length=278

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M  K W  PAPTYR L+  WD D+DAPGPRCGH+LT VAATK+HGPRL+LFGGATAIEGG
Sbjct  1    MGTKSWTIPAPTYRPLDASWDNDDDAPGPRCGHSLTTVAATKSHGPRLVLFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSAVPGIRLAGVTNSVHSYD  81



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  277  AAKPWLYPAPTYRSL-ETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            ++KPWL PAP+Y  L ++FWD+DEDAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  3    SSKPWLQPAPSYTPLLDSFWDSDEDAPGPRCGHTLTAVAATKSQGPRLILFGGATAIEGG  62

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  63   ASSSAPGIRLAGVTNSVHSYD  83



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +KPWL PAP YR L++ W+TD+DAPGPRCGH+LTAV A+K+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLIPAPNYRRLDSSWETDDDAPGPRCGHSLTAVDASKSRGPRLILFGGATAIEGG  60

Query  454  nggpg--iRLAGVTNAIHSYD  510
                   IRLAGVTN++HSYD
Sbjct  61   ASSAVPGIRLAGVTNSVHSYD  81



>gb|KHN47652.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=89

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF  426
            M +K WLY  PTYR++ETFW TDE+AP P CGHT T VA TKT GP +ILF
Sbjct  1    MGSKSWLYLVPTYRTIETFWVTDENAPSPHCGHTFTVVATTKTQGPHVILF  51



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M +K  L PAP+YR +E  W+   D+PGPRC HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSKTRLVPAPSYRPVEASWEAAGDSPGPRCSHTLTAVPATGSHGPRLILFGGTTAIEGS  60

Query  454  n-ggpgiRLAGVTNAIHSYD  510
                PGIRLAGVTN++HS+D
Sbjct  61   XPPAPGIRLAGVTNSVHSFD  80



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    EDAPG RCGH+LTAVA TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGVGEDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  69   PGIRLAGVTNSVHSYD  84



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +DAPG RCGH+LTAVA TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGVGDDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  69   PGIRLAGVTNSVHSYD  84



>ref|XP_008795124.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=867

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            M ++  L PAP+YR +E  W+   DAPGPR  HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSRTRLVPAPSYRPVEASWEAAGDAPGPRYAHTLTAVPATGSHGPRLILFGGGTAIEGS  60

Query  454  nggpgiRLAGVTNAIHSYD  510
              GPGIRLAGVTN +HS+D
Sbjct  61   PCGPGIRLAGVTNWVHSFD  79



>gb|AFW82656.1| hypothetical protein ZEAMMB73_760112 [Zea mays]
Length=491

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggp-  465
            W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIETGASSGL  68

Query  466  -giRLAGVTNAIHSYD  510
             GIRLAGVTN++HSYD
Sbjct  69   PGIRLAGVTNSVHSYD  84



>ref|XP_006846753.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
 gb|ERN08334.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
Length=218

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 62/93 (67%), Gaps = 14/93 (15%)
 Frame = +1

Query  274  MAAKPWLYPAP----TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH----------GP  411
            M +K  L PAP     YR ++T W+TDED+PGPRCGHTLT V+               GP
Sbjct  1    MGSKLRLCPAPLPASAYRVVDTSWETDEDSPGPRCGHTLTPVSTPSNSSSSSGSHHYVGP  60

Query  412  RLILFggataieggnggpgiRLAGVTNAIHSYD  510
            RLILFGGATAIE  + G GIRLAGVTN++HSYD
Sbjct  61   RLILFGGATAIEMSSTGAGIRLAGVTNSVHSYD  93



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIEAGASSGM  68

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  69   PGIRLAGVTNSVHSYD  84



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIEAGASSGM  68

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  69   PGIRLAGVTNSVHSYD  84



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE G     
Sbjct  101  WVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIETGASSGL  160

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  161  PGIRLAGVTNSVHSYD  176



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE G     
Sbjct  101  WVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIETGASSGL  160

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  161  PGIRLAGVTNSVHSYD  176



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  469  --iRLAGVTNAIHSYD  510
              IRLAGVTN++HSYD
Sbjct  69   PGIRLAGVTNSVHSYD  84



>ref|NP_171844.6| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
 sp|Q9LR78.2|BSU1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSU1; AltName: 
Full=Bri1 suppressor protein 1 [Arabidopsis thaliana]
 gb|AAR19789.1| BSU1 Ser/Thr phosphatase [Arabidopsis thaliana]
 gb|AEE27572.1| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
Length=793

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +1

Query  283  KPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggngg  462
            + + YP+P+Y S++TF+DTDED PGPRCGHTLTAV    +H  +LILFGG+T     +  
Sbjct  5    QSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNS  62

Query  463  pgiRLA--GVTNAIHSYD  510
                ++  GVTN++HS+D
Sbjct  63   SLPEISLDGVTNSVHSFD  80



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 55/87 (63%), Gaps = 13/87 (15%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  469  -------------iRLAGVTNAIHSYD  510
                          RLAGVTN++HSYD
Sbjct  69   PGISSVPPPSLAPPRLAGVTNSVHSYD  95



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 55/87 (63%), Gaps = 13/87 (15%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  468
            W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  469  -------------iRLAGVTNAIHSYD  510
                          RLAGVTN++HSYD
Sbjct  69   PGISSVPPPSLAPPRLAGVTNSVHSYD  95



>ref|XP_002892160.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68419.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
Length=795

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +1

Query  295  YPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggp--g  468
            YP+P+Y S++TF+DTDE  PGPRCGHTLT V    +H  +LILFGG++     +      
Sbjct  11   YPSPSYESIQTFYDTDEGWPGPRCGHTLTGVFVNNSH--QLILFGGSSTAVTTHDSSLPE  68

Query  469  iRLAGVTNAIHSYD  510
            I L GVTN++HS+D
Sbjct  69   ISLEGVTNSVHSFD  82



>gb|KHN03760.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=50

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRC  366
            M +KPWLYPAPTYR++ET WDTDEDAPGPRC
Sbjct  1    MGSKPWLYPAPTYRTIETVWDTDEDAPGPRC  31



>gb|AFW82657.1| hypothetical protein ZEAMMB73_760112 [Zea mays]
Length=198

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  289  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF  426
            W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILF
Sbjct  101  WVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILF  146



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 47/85 (55%), Gaps = 14/85 (16%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF--------gga  435
            PAPTYR + +  +  +D PGPRCGHTLTAVA+          GPRLILF          A
Sbjct  106  PAPTYRVVNSVIEKRDDGPGPRCGHTLTAVASVNEEGSPGYIGPRLILFGGATALEGSSA  165

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
               +  + G GIRLAG T  +H YD
Sbjct  166  AGPQAASSGAGIRLAGATADVHCYD  190



>ref|XP_010474966.1| PREDICTED: serine/threonine-protein phosphatase BSU1-like [Camelina 
sativa]
Length=800

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF--ggataie  447
            MA+  + Y + +Y  L+ F D DED PGPRCGHTLTA+ A  +H  +L+LF         
Sbjct  1    MASHSYPY-STSYDYLQNFSDNDEDWPGPRCGHTLTAIFANDSH--QLVLFGGSTDAVTT  57

Query  448  ggnggpgiRLAGVTNAIHSYD  510
              +  P I L GVTN++HS+D
Sbjct  58   DDSSLPAISLGGVTNSVHSFD  78



>ref|XP_010457353.1| PREDICTED: serine/threonine-protein phosphatase BSU1-like [Camelina 
sativa]
Length=796

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +1

Query  274  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  453
            MA+  + YP+ +Y  L+TF + DE  PGPRCGHTLTAV A  +H  +L+LFGG+T     
Sbjct  1    MASHSYPYPSTSYEYLQTFANDDE-WPGPRCGHTLTAVFANDSH--QLVLFGGSTTAVTT  57

Query  454  nggpg--iRLAGVTNAIHSYD  510
            N      I L GVTN++HS+D
Sbjct  58   NDYSLPGISLEGVTNSVHSFD  78



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAPTY  +E   +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E    
Sbjct  81   PAPTYSVVEANIEKKEDGPGPRCGHTLTAVAAVGEEGTAGYIGPRLILFGGATALEGNSA  140

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                    G  GIRLAG T  +H YD
Sbjct  141  ASGPPSSAGSAGIRLAGATADVHCYD  166



>ref|XP_001782643.1| predicted protein [Physcomitrella patens]
 gb|EDQ52546.1| predicted protein, partial [Physcomitrella patens]
Length=493

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 37/65 (57%), Gaps = 8/65 (12%)
 Frame = +1

Query  250  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GP  411
            + G +   MA+ P   PAP YR +    +  ED PGPRCGHTLTAVAA          GP
Sbjct  132  VAGRQQVSMASSP--RPAPAYRVVSAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYLGP  189

Query  412  RLILF  426
            RLILF
Sbjct  190  RLILF  194



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataiegg--  453
            PAPTY  +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG   
Sbjct  64   PAPTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSA  123

Query  454  -------nggpgiRLAGVTNAIHSYD  510
                    G  GIRLAG T  +H YD
Sbjct  124  ASGAPSSAGNAGIRLAGATADVHCYD  149



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 49/87 (56%), Gaps = 16/87 (18%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggn-  456
            PAP+YR +    +  ED PGPRCGHTLT+VAA          GPRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  457  ---------ggpgiRLAGVTNAIHSYD  510
                          RLAG T  +H +D
Sbjct  122  AAPTPPPAGNAGISRLAGATADVHCFD  148



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 51/86 (59%), Gaps = 15/86 (17%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  459
            PAP+YR +    +  ED PGPRCGHTLT+VAA          GPRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  460  ---------gpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H +D
Sbjct  122  AAPTPPPAGNAGIRLAGATADVHCFD  147



>gb|KGN66599.1| hypothetical protein Csa_1G638460 [Cucumis sativus]
Length=736

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  462
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  463  pgi---------RLAGVTNAIHSYD  510
             G          RLAG T  +H YD
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYD  156



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 50/87 (57%), Gaps = 16/87 (18%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  459
            PAP +R +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG + 
Sbjct  7    PAPAFRMVSAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYVGPRLILFGGATALEGNSS  66

Query  460  g----------pgiRLAGVTNAIHSYD  510
                        GIRLAG T  +H YD
Sbjct  67   AAGGPQTAAAGAGIRLAGATADVHCYD  93



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = +1

Query  226  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  405
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  406  ------GPRLILFggataie---------ggnggpgiRLAGVTNAIHSYD  510
                  GPRL+LFGGATA+E            G  GIRLAG T  +H YD
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYD  169



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = +1

Query  226  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  405
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  406  ------GPRLILFggataie---------ggnggpgiRLAGVTNAIHSYD  510
                  GPRL+LFGGATA+E            G  GIRLAG T  +H YD
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYD  169



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = +1

Query  226  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  405
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  406  ------GPRLILFggataie---------ggnggpgiRLAGVTNAIHSYD  510
                  GPRL+LFGGATA+E            G  GIRLAG T  +H YD
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYD  169



>ref|XP_006826448.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
 gb|ERM93685.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
Length=1423

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 49/89 (55%), Gaps = 18/89 (20%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  459
            PAPTY  +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG + 
Sbjct  66   PAPTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSS  125

Query  460  gpg------------iRLAGVTNAIHSYD  510
                           IRLAG T  +H YD
Sbjct  126  STAPSGPPSSGGNAGIRLAGATADVHCYD  154



>gb|ABV91338.1| kelch repeat-containing protein /serine/threonine phosphoesterase 
family protein [Arabidopsis thaliana]
Length=1018

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = +1

Query  226  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  405
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  406  ------GPRLILFggataie---------ggnggpgiRLAGVTNAIHSYD  510
                  GPRL+LFGGATA+E            G  GIRLAG T  +H YD
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATPDVHCYD  169



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 49/86 (57%), Gaps = 15/86 (17%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAPTY  +E   +  ED PG RCGHTLTA+AA          GPRLILFGGATA+E    
Sbjct  84   PAPTYSVVEAIIEKKEDGPGSRCGHTLTAIAAVGEEGTPGYIGPRLILFGGATALEGNAA  143

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                    G  GIRLAG T  +H YD
Sbjct  144  ASGPPSSAGSAGIRLAGATADVHCYD  169



>ref|XP_006592360.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Glycine max]
Length=986

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF            
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  IH YD
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYD  152



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF            
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  IH YD
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYD  152



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF            
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  IH YD
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYD  152



>ref|XP_006367867.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=367

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataiegg---  453
            APTY ++++  +  ED PGPRCGHTLTAV A          GPRLILFGGATA+EG    
Sbjct  51   APTYTAVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  110

Query  454  ------nggpgiRLAGVTNAIHSYD  510
                   GG GIRLAG T  +HSYD
Sbjct  111  AAAPSSPGGAGIRLAGATADVHSYD  135



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  462
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  45   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  104

Query  463  pgi---------RLAGVTNAIHSYD  510
             G          RLAG T  +H YD
Sbjct  105  AGTPTSAGNAGIRLAGATADVHCYD  129



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  462
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  463  pgi---------RLAGVTNAIHSYD  510
             G          RLAG T  +H YD
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYD  156



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  64   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALEGNSAA  123

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYD  148



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYD  164



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYD  154



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYD  157



>gb|KJB35473.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1001

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYD  164



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYD  157



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYD  157



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYD  157



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  71   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYD  155



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYD  164



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYD  164



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggngg  462
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG +  
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGSSAA  132

Query  463  pgi---------RLAGVTNAIHSYD  510
             G          RLAG T  +H YD
Sbjct  133  SGTPSSAGNAGIRLAGATADVHCYD  157



>gb|KHG00523.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=315

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y  ++   +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  78   APPYSVVDAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYD  162



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYD  154



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYFGPRLILFGGATALEGNSAA  129

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYD  154



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           +
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYD  168



>ref|XP_010101992.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
 gb|EXB91212.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
Length=1084

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  86   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  145

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  146  SGTPSAAGSAGIRLAGATADVHCYD  170



>ref|XP_006594918.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=877

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYD  148



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 56/111 (50%), Gaps = 19/111 (17%)
 Frame = +1

Query  229  NQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH-  405
            +  S  ++G  +L      P    APTY  ++   D  ED PGPRCGHTLTAV A     
Sbjct  65   SSQSAPVVGQEQLQAQVVGPRC--APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEG  122

Query  406  -----GPRLILFggataie-----------ggnggpgiRLAGVTNAIHSYD  510
                 GPRL+LFGGATA+E              G  GIRLAG T  +H YD
Sbjct  123  TPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVHCYD  173



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  76   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  135

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  136  SGTPSSAGNAGIRLAGATADVHCYD  160



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  76   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  135

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  136  SGTPSSAGNAGIRLAGATADVHCYD  160



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           +
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  144  AGTPSSAGSAGIRLAGATADVHCYD  168



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  143

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYD  168



>ref|XP_002513729.1| hypothetical protein RCOM_1754260 [Ricinus communis]
 gb|EEF48676.1| hypothetical protein RCOM_1754260 [Ricinus communis]
Length=136

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 6/48 (13%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF  426
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF
Sbjct  76   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGSPGYIGPRLILF  123



>ref|XP_004166313.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=174

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 6/48 (13%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILF  426
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILF
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILF  119



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 55/108 (51%), Gaps = 17/108 (16%)
 Frame = +1

Query  232  QSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH--  405
            Q +  ++G  +       P    APTY  ++   D  ED PGPRCGHTLTAV A      
Sbjct  63   QQAAAVVGQEQQPAQVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDEGT  120

Query  406  ----GPRLILFggataie---------ggnggpgiRLAGVTNAIHSYD  510
                GPRL+LFGGATA+E            G  GIRLAG T  +H YD
Sbjct  121  PGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYD  168



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  62   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSSAGNAGIRLAGATADVHCYD  146



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYD  148



>gb|KDO46578.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=975

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYD  156



>gb|EYU25964.1| hypothetical protein MIMGU_mgv1a0006242mg, partial [Erythranthe 
guttata]
Length=340

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP+Y  +    D  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYD  153



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 44/86 (51%), Gaps = 15/86 (17%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gg  432
            PAP ++++    +  +D PGPRCGHTLTAVAA          GPRLILF           
Sbjct  34   PAPAFKAITAICERKDDGPGPRCGHTLTAVAAVGEEGSPAYIGPRLILFGGATALEGNSS  93

Query  433  ataieggnggpgiRLAGVTNAIHSYD  510
                +    G GIRLAG T  +H YD
Sbjct  94   QAGPQTAVAGAGIRLAGATADVHCYD  119



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  71   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYD  155



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYD  156



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYD  156



>ref|XP_010658896.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X4 [Vitis vinifera]
Length=869

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 46/84 (55%), Gaps = 15/84 (18%)
 Frame = +1

Query  304  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng--  459
            PTY  + T  +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  460  -------gpgiRLAGVTNAIHSYD  510
                      IRLAG T  +H YD
Sbjct  102  GALSSPGSSSIRLAGATADVHCYD  125



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataiegg---  453
            APTY  +++  +  ED PGPRCGHTLTAV A          GPRLILFGGATA+EG    
Sbjct  50   APTYTVVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  109

Query  454  ------nggpgiRLAGVTNAIHSYD  510
                   GG GIRLAG T  +HSYD
Sbjct  110  AAAPSSPGGAGIRLAGATADVHSYD  134



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  43   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  102

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  103  SGTPSSAGSAGIRLAGATADVHCYD  127



>ref|XP_010658894.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Vitis vinifera]
Length=884

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 46/84 (55%), Gaps = 15/84 (18%)
 Frame = +1

Query  304  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng--  459
            PTY  + T  +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  460  -------gpgiRLAGVTNAIHSYD  510
                      IRLAG T  +H YD
Sbjct  102  GALSSPGSSSIRLAGATADVHCYD  125



>gb|EYU41291.1| hypothetical protein MIMGU_mgv1a0202661mg, partial [Erythranthe 
guttata]
Length=340

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP+Y  +    D  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYD  153



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  85   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPSYIGPRLVLFGGATALEGNSGG  144

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  145  TGTPTSAGSAGIRLAGATADVHCYD  169



>ref|XP_010658895.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Vitis vinifera]
Length=875

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 46/84 (55%), Gaps = 15/84 (18%)
 Frame = +1

Query  304  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng--  459
            PTY  + T  +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  460  -------gpgiRLAGVTNAIHSYD  510
                      IRLAG T  +H YD
Sbjct  102  GALSSPGSSSIRLAGATADVHCYD  125



>emb|CBI24997.3| unnamed protein product [Vitis vinifera]
Length=928

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 46/84 (55%), Gaps = 15/84 (18%)
 Frame = +1

Query  304  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng--  459
            PTY  + T  +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  460  -------gpgiRLAGVTNAIHSYD  510
                      IRLAG T  +H YD
Sbjct  102  GALSSPGSSSIRLAGATADVHCYD  125



>gb|KFK43163.1| hypothetical protein AALP_AA1G088000 [Arabis alpina]
Length=1016

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 48/86 (56%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  83   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  142

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                    G  GIRLAG T  +H YD
Sbjct  143  TGTPTSAAGSAGIRLAGATADVHCYD  168



>ref|XP_002262846.2| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010658893.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
Length=976

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 46/84 (55%), Gaps = 15/84 (18%)
 Frame = +1

Query  304  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng--  459
            PTY  + T  +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  460  -------gpgiRLAGVTNAIHSYD  510
                      IRLAG T  +H YD
Sbjct  102  GALSSPGSSSIRLAGATADVHCYD  125



>emb|CDY22684.1| BnaC08g43180D [Brassica napus]
Length=995

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 47/86 (55%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  65   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGAPGYIGPRLVLFGGATALEGNSGG  124

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H YD
Sbjct  125  TGTPTSATPSAGIRLAGATADVHCYD  150



>ref|XP_009118376.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Brassica 
rapa]
Length=992

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 47/86 (55%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H YD
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYD  147



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    D  ED PGPRCGHTLT VAA          GPRLILF           +
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYD  161



>emb|CDY06313.1| BnaA09g48900D [Brassica napus]
Length=992

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 47/86 (55%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H YD
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYD  147



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    D  ED PGPRCGHTLT VAA          GPRLILF           +
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALGGNSAS  136

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYD  161



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 49/85 (58%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataiegg---  453
            APTY  +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG    
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  133

Query  454  ------nggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  134  SGAPSSAGNAGIRLAGATADVHCYD  158



>dbj|BAF00990.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=707

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYD  158



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP+Y  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYD  151



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP+Y  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYD  151



>ref|XP_009770254.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana sylvestris]
Length=982

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    + +ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYD  146



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    + +ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYD  146



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    + +ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYD  146



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 56/112 (50%), Gaps = 19/112 (17%)
 Frame = +1

Query  226  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  405
            + Q +  ++G  +       P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  59   SQQQTDPVVGQEQHQAQVVGPRC--APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDE  116

Query  406  ------GPRLILFggataie-----------ggnggpgiRLAGVTNAIHSYD  510
                  GPRL+LFGGATA+E              G  GIRLAG T  +H YD
Sbjct  117  GTPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVHCYD  168



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  64   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYD  148



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggngg  462
            AP Y  +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG +  
Sbjct  70   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  129

Query  463  pgi---------RLAGVTNAIHSYD  510
             G          RLAG T  +H YD
Sbjct  130  SGTPTSAGNAGIRLAGATADVHCYD  154



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 43/85 (51%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y+++    +  +D PGPRCGHTLTAVAA          GPRLILF            
Sbjct  25   APAYKAITAICERKDDGPGPRCGHTLTAVAAVGEEGKLAYVGPRLILFGGATALEGNSSQ  84

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
               +    G GIRLAG T  +H YD
Sbjct  85   AGPQMAVAGAGIRLAGATADVHCYD  109



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           +
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYD  161



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           +
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYD  161



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  81   APTYSVVNAIIENKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  140

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  141  TGTPSSAGSAGIRLAGATADVHCYD  165



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  81   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  140

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  141  TGTPTSAGSAGIRLAGATADVHCYD  165



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYD  166



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           +
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            T      G  GIRLAG T  +H YD
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYD  161



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    D  ED PGPRCGHTLTAV +          GPRLILF           A
Sbjct  69   APTYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H +D
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFD  153



>ref|XP_010419412.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1003

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  74   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  133

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYD  158



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYD  166



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 54/97 (56%), Gaps = 15/97 (15%)
 Frame = +1

Query  259  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLI  420
            AE   +AA P   PAP Y  +    +  ED PG RCGHTLTAVAA          GPRLI
Sbjct  40   AEAQPVAAGP--RPAPGYSVVNAVIERKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  97

Query  421  LFggataieggng-------gpgiRLAGVTNAIHSYD  510
            LFGGATA+EG +          GIRLAG T  +H YD
Sbjct  98   LFGGATALEGNSAAPASPTGSAGIRLAGATADVHCYD  134



>ref|XP_006417691.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
 gb|ESQ36044.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
Length=1012

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 47/86 (55%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            AP Y  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  78   APNYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  137

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                    G  GIRLAG T  +H YD
Sbjct  138  TGTPTSAAGSAGIRLAGATADVHCYD  163



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 48/88 (55%), Gaps = 18/88 (20%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  ++   D  ED PGPRCGHTLTAV A          GPRL+LFGGATA+E     
Sbjct  87   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  146

Query  448  -------ggnggpgiRLAGVTNAIHSYD  510
                      G  GIRLAG T  +H YD
Sbjct  147  GGGTGTPTSAGSAGIRLAGATADVHCYD  174



>gb|AFW68154.1| hypothetical protein ZEAMMB73_166373 [Zea mays]
Length=185

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 41/84 (49%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF-------ggat  438
            PAP Y  +    D  ED PG RCGHTLTAV A          GPRLILF       G + 
Sbjct  59   PAPGYTVVNAVIDKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  118

Query  439  aieggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  119  TPPSSAGSAGIRLAGATADVHCYD  142



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYD  156



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYD  156



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYD  156



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y  +    +  ED PGPRCGHTLTAVAA          GPRLILF           A
Sbjct  78   APPYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYD  162



>gb|AAF22889.1|AC006932_6 T27G7.10 [Arabidopsis thaliana]
Length=1088

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 38/73 (52%), Gaps = 8/73 (11%)
 Frame = +1

Query  226  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  405
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  406  ------GPRLILF  426
                  GPRL+LF
Sbjct  120  GTPGYIGPRLVLF  132



>ref|XP_001785960.1| predicted protein [Physcomitrella patens]
 gb|EDQ49228.1| predicted protein, partial [Physcomitrella patens]
Length=834

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 36/65 (55%), Gaps = 8/65 (12%)
 Frame = +1

Query  250  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GP  411
            + G +   MA+ P   PAP +R +    +  ED PGPRCGHTLT VAA          GP
Sbjct  158  VAGRQQVSMASSP--RPAPAHRVVSALIEKKEDGPGPRCGHTLTTVAAVGEEGTPGYVGP  215

Query  412  RLILF  426
            RLILF
Sbjct  216  RLILF  220



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSGG  132

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  133  TGTPTSAGSAGIRLAGATADVHCYD  157



>ref|XP_009788953.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
 ref|XP_009788954.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=709

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 47/86 (55%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggngg  462
            APTY  ++   +  ED PGPRCGHTLTAV A          GPRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGTSNYIGPRLILFGGATALEGNSAA  106

Query  463  pgi----------RLAGVTNAIHSYD  510
                         RLAG T  +H YD
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYD  132



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYD  148



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  82   APTYTVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  141

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  142  SGTPSSAGSAGIRLAGATADVHCYD  166



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYD  146



>ref|XP_009587046.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=989

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYD  146



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYD  146



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYD  146



>dbj|BAK03675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y ++    D  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  61   PAPGYTAVNAVIDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYD  144



>emb|CDY31148.1| BnaA08g26980D [Brassica napus]
Length=990

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 50/103 (49%), Gaps = 16/103 (16%)
 Frame = +1

Query  250  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GP  411
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A          GP
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTNGYIGP  106

Query  412  RLILFggataie----------ggnggpgiRLAGVTNAIHSYD  510
            RL+LFGGATA+E                GIRLAG T  +H YD
Sbjct  107  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYD  149



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYD  146



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYD  158



>ref|XP_009110896.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Brassica 
rapa]
Length=990

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 50/103 (49%), Gaps = 16/103 (16%)
 Frame = +1

Query  250  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GP  411
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A          GP
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  106

Query  412  RLILFggataie----------ggnggpgiRLAGVTNAIHSYD  510
            RL+LFGGATA+E                GIRLAG T  +H YD
Sbjct  107  RLVLFGGATALEDNSGGTGTPTSAAPSAGIRLAGATADVHCYD  149



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYD  148



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 53/97 (55%), Gaps = 15/97 (15%)
 Frame = +1

Query  259  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLI  420
             E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA          GPRLI
Sbjct  41   VEAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  98

Query  421  LFggataie-------ggnggpgiRLAGVTNAIHSYD  510
            LFGGATA+E          G  GIRLAG T  +H YD
Sbjct  99   LFGGATALEGNSAAPASPAGSAGIRLAGATADVHCYD  135



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYD  158



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 53/97 (55%), Gaps = 15/97 (15%)
 Frame = +1

Query  259  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLI  420
             E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA          GPRLI
Sbjct  41   VEAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  98

Query  421  LFggataie-------ggnggpgiRLAGVTNAIHSYD  510
            LFGGATA+E          G  GIRLAG T  +H YD
Sbjct  99   LFGGATALEGNSAAPASPAGSAGIRLAGATADVHCYD  135



>emb|CDX97481.1| BnaC08g13460D [Brassica napus]
Length=992

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 50/103 (49%), Gaps = 16/103 (16%)
 Frame = +1

Query  250  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GP  411
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A          GP
Sbjct  49   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  108

Query  412  RLILFggataie----------ggnggpgiRLAGVTNAIHSYD  510
            RL+LFGGATA+E                GIRLAG T  +H YD
Sbjct  109  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYD  151



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 46/85 (54%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            AP Y  +    D  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  73   APMYTVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSGA  132

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYD  157



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  70   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSGYIGPRLILFGGATALEGNSGG  129

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  130  TGTPTSAGSAGIRLAGATADVHCYD  154



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  136

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  137  TGTPTSAGSAGIRLAGATADVHCYD  161



>ref|XP_010313488.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum lycopersicum]
Length=995

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYD  149



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggngg  462
            AP+Y  ++   +  ED PGPRCGHTLTAV A          GPRLILFGGATA+EG +  
Sbjct  69   APSYTVVDAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  463  pgi---------RLAGVTNAIHSYD  510
             G          RLAG T  +H YD
Sbjct  129  SGTPTSAGNAGIRLAGATADVHCYD  153



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 47/85 (55%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  131

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  132  TGTPTSAGSAGIRLAGATADVHCYD  156



>ref|XP_006340328.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=994

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYD  148



>ref|XP_006340327.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum tuberosum]
Length=996

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYD  148



>ref|XP_004251224.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum lycopersicum]
Length=997

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYD  149



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 49/84 (58%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  459
            PAPTYR + +  +  ED  G RCGHTLTAV A          GPRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNSIIEKKEDGAGCRCGHTLTAVPAVGEEGTPGFIGPRLILFGGATALEGNSA  106

Query  460  -------gpgiRLAGVTNAIHSYD  510
                     GIRLAG T  +H YD
Sbjct  107  APPSPAGSAGIRLAGATADVHCYD  130



>ref|XP_009587594.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
tomentosiformis]
Length=978

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 49/86 (57%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataiegg---  453
            APTY  ++   +  ED PGPRCGHTLTAV A          GPRLILFGGATA+EG    
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGSSNYIGPRLILFGGATALEGNSAA  106

Query  454  -------nggpgiRLAGVTNAIHSYD  510
                    G  GIRLAG T  +H YD
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYD  132



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y  ++   D  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYD  144



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y  ++   D  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYD  144



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 46/85 (54%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY       +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  64   APTYSVAHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  +H YD
Sbjct  124  PGTPSSAGSAGIRLAGATADVHCYD  148



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 41/85 (48%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y  +    D  ED PGPRCGHTLTAV +          GPRLILF           A
Sbjct  69   APAYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H +D
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFD  153



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 42/85 (49%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP+Y  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  68   APSYTVVNAILEKKEDGPGPRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSAA  127

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  128  SGTPSSAGNAGIRLAGATADVHCYD  152



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 41/85 (48%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYD  165



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 41/85 (48%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
            +      G  GIRLAG T  +H YD
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYD  165



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 46/85 (54%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            AP Y  +    +  ED PGPRCGHTLTAV A          GPR+ILFGGATA+E     
Sbjct  74   APMYNVVNVIIEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRMILFGGATALEGNSGG  133

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  IH YD
Sbjct  134  TGTPTSAGSAGIRLAGATADIHCYD  158



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y  ++   D  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  63   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  122

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  123  TPPSSAGSAGIRLAGATADVHCYD  146



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y  ++   D  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  74   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  133

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  134  TPPSSAGSAGIRLAGATADVHCYD  157



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 52/93 (56%), Gaps = 15/93 (16%)
 Frame = +1

Query  271  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFgg  432
            G+ A P   PAP Y  ++   D  ED PG RCGHTLTAV A          GPRLILFGG
Sbjct  57   GLVAGP--RPAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGG  114

Query  433  ataieggng-------gpgiRLAGVTNAIHSYD  510
            ATA+EG +          GIRLAG T  +H YD
Sbjct  115  ATALEGNSATPPSPAGSAGIRLAGATADVHCYD  147



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 40/85 (47%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF---------gga  435
            AP+Y  +    D  ED  GPRCGHTLTAV A          GPRLILF           A
Sbjct  85   APSYSVVNAIIDKKEDGAGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  144

Query  436  taieggnggpgiRLAGVTNAIHSYD  510
                   G  GIRLAG T  IH YD
Sbjct  145  AGTPSSAGSAGIRLAGATADIHCYD  169



>pir||T00913 probable phosphoprotein phosphatase (EC 3.1.3.16) F21B7.27 - 
Arabidopsis thaliana
Length=729

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 4/59 (7%)
 Frame = +1

Query  340  DEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpgiRLA--GVTNAIHSYD  510
            DED PGPRCGHTLTAV    +H  +LILFGG+T     +      ++  GVTN++HS+D
Sbjct  74   DEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNSSLPEISLDGVTNSVHSFD  130



>tpg|DAA50299.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=924

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y ++    +  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  67   PAPGYTAVNAVIEKKEDGPGCRCGHTLTAVPAVGEEGAPGYIGPRLILFGGATALEGNSA  126

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  127  TPPSSAGSAGIRLAGATADVHCYD  150



>ref|XP_008643918.1| PREDICTED: uncharacterized protein LOC100381465 isoform X1 [Zea 
mays]
Length=633

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y  +    D  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  59   PAPGYTVVNAVIDKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  118

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  119  TPPSSAGSAGIRLAGATADVHCYD  142



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y ++    +  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYD  151



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  447
            PAP Y ++    +  ED PG RCGHTLTAV A          GPRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  448  ---ggnggpgiRLAGVTNAIHSYD  510
                  G  GIRLAG T  +H YD
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYD  151



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 45/86 (52%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  125

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H YD
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYD  151



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 45/86 (52%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEERSANYIGPRLILFGGATALEGNSGG  125

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H YD
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYD  151



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 45/86 (52%), Gaps = 16/86 (19%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  65   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  124

Query  448  -----ggnggpgiRLAGVTNAIHSYD  510
                       GIRLAG T  +H YD
Sbjct  125  TGTPTSAGSAGGIRLAGATADVHCYD  150



>gb|AAD26883.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=715

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 44/85 (52%), Gaps = 15/85 (18%)
 Frame = +1

Query  301  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  447
            APTY  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  50   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  109

Query  448  ----ggnggpgiRLAGVTNAIHSYD  510
                  +      LAG T  +H YD
Sbjct  110  TGTPTSSNVSYAGLAGATADVHCYD  134



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +1

Query  298  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  459
            PAPTYR +    +  ED  G RCGHTLTAV            GPRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNAIIEKKEDGAGCRCGHTLTAVPPVGEEGTPGYIGPRLILFGGATALEGNSA  106

Query  460  g-------pgiRLAGVTNAIHSYD  510
                     GIRLAG T  +H YD
Sbjct  107  APPSPAGTAGIRLAGATADVHCYD  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115