BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014G15

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248326.1|  PREDICTED: serine/threonine-protein kinase D...  78.6    2e-13   Solanum lycopersicum
ref|XP_006352558.1|  PREDICTED: protein kinase G11A-like isoform X1   72.8    1e-11   Solanum tuberosum [potatoes]
emb|CDP13698.1|  unnamed protein product                              69.7    2e-10   Coffea canephora [robusta coffee]
ref|XP_009625903.1|  PREDICTED: serine/threonine-protein kinase D...  65.1    4e-09   Nicotiana tomentosiformis
ref|XP_004244035.1|  PREDICTED: serine/threonine-protein kinase D...  55.8    5e-06   Solanum lycopersicum
ref|XP_006346118.1|  PREDICTED: protein kinase G11A-like isoform X1   55.5    8e-06   Solanum tuberosum [potatoes]
ref|XP_009625904.1|  PREDICTED: serine/threonine-protein kinase D...  52.8    6e-05   Nicotiana tomentosiformis
ref|XP_009774023.1|  PREDICTED: serine/threonine-protein kinase D...  51.2    2e-04   Nicotiana sylvestris
ref|XP_011095569.1|  PREDICTED: serine/threonine-protein kinase D...  50.8    2e-04   Sesamum indicum [beniseed]



>ref|XP_004248326.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
 ref|XP_010327213.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
Length=613

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 76/154 (49%), Gaps = 43/154 (28%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTPSKTSKNSNS-------------------  363
            MAS P VKSSLE+ N     Q +ER+  R  PS+ SK+ NS                   
Sbjct  1    MASTPSVKSSLEKLNKSAGIQAVERNPRRSAPSQVSKSINSGSTTSKELQHNDREVASKQ  60

Query  364  --------------ENLRSEEVLANHLDSSLNLGSIKKPPSGDTKGLPERR-----ADQE  486
                          + + S ++L +  DSSL LG++K  PSG    L E +      DQE
Sbjct  61   LMAEATTKKKSNSYQQVGSADLLVDKFDSSLYLGNLKHAPSGAASALCEAKGSQCAVDQE  120

Query  487  KKASGSGTVKDTSASIEVSNGESSVAKTSGIGKT  588
            KKASG+G +KD SA  +VS+G  S+AKTSG  K 
Sbjct  121  KKASGNGDIKDNSAPAKVSDGAGSLAKTSGSAKV  154



>ref|XP_006352558.1| PREDICTED: protein kinase G11A-like isoform X1 [Solanum tuberosum]
 ref|XP_006352559.1| PREDICTED: protein kinase G11A-like isoform X2 [Solanum tuberosum]
 ref|XP_006352560.1| PREDICTED: protein kinase G11A-like isoform X3 [Solanum tuberosum]
 ref|XP_006352561.1| PREDICTED: protein kinase G11A-like isoform X4 [Solanum tuberosum]
Length=613

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 75/154 (49%), Gaps = 43/154 (28%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTPSKTSKNSNS-------------------  363
            MAS P VKSSLE+ N     Q +ER+  R  PS+ SK+SNS                   
Sbjct  1    MASTPSVKSSLEKLNKSAGIQAVERNPRRSAPSQVSKSSNSGSTTSKELQHNDREVASKQ  60

Query  364  --------------ENLRSEEVLANHLDSSLNLGSIKKPPSGDTKGLPERRA-----DQE  486
                          + + S ++L +  DSSL LG++K  PS       E +      DQE
Sbjct  61   LMAEATTKKKSNSYQQVGSADLLVDKFDSSLYLGNLKHAPSSAASAPCEAKGSQCAIDQE  120

Query  487  KKASGSGTVKDTSASIEVSNGESSVAKTSGIGKT  588
            KKAS +G VKD SAS +VS+G  S+AKTSG  K 
Sbjct  121  KKASENGAVKDNSASAKVSDGAGSLAKTSGSAKV  154



>emb|CDP13698.1| unnamed protein product [Coffea canephora]
Length=607

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 77/149 (52%), Gaps = 38/149 (26%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTPSKTSKNSNSENLR-SEEV----------  387
            MAS+ G K SL++QN     +TLE  S +P+P   SK S S     ++EV          
Sbjct  1    MASRSGTKGSLDKQNKAFGIETLEGISRKPSPLLASKTSKSGTASVAQEVPPKQLNIETT  60

Query  388  ----------------LANHLDSSLNLGSIKK------PPSGDTKGLPERRADQEKKASG  501
                            LA  LD+SL LG+ K+      PP+ +TKG  E+ AD EKK S 
Sbjct  61   ANKKLHNAGQNGLLDSLAGKLDTSLRLGNTKQTQASLSPPATETKGSVEKIADHEKKTSE  120

Query  502  SGTVKDTSASIEVSNGESSVAKTSGIGKT  588
             GTVKD  +S +VS+G SS+AKTSG  K 
Sbjct  121  HGTVKDGVSSAKVSDGASSLAKTSGSAKI  149



>ref|XP_009625903.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X1 [Nicotiana tomentosiformis]
Length=631

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 88/171 (51%), Gaps = 35/171 (20%)
 Frame = +1

Query  157  FFLSIRE-GYMRWTGVLSDGFG*LEKI*LSVFVSMASKPGVKSSLERQNQT-----LERS  318
            F LSI E     W   LS+GFG    I  S+F+ MAS P VKSSLE+  ++     +E +
Sbjct  11   FILSIFELSCCCWK--LSNGFGRPGCIEESLFILMASTPSVKSSLEKLKKSTGSHAVEGN  68

Query  319  SHRPTPSKTSKNSNSEN-----LRSEE----------------VLANHLDSSLNLGSIKK  435
            S    PS+ SK+  SE+     LRS++                +L + L+SSL LG++K 
Sbjct  69   SRTSAPSQVSKSGKSESTTSKELRSDDRKVASKQLTAEAGSADLLVDKLNSSLYLGNLKH  128

Query  436  PPSGDTKGLPERRADQEKKASGSGTVKDTSASIEVSNGESSVAKTSGIGKT  588
             P G    +P      + K S + TV D SAS +VS+G SS+ KTSG  K 
Sbjct  129  APIGAV-SMP-----CDTKGSENETVNDCSASAKVSDGASSLGKTSGSAKV  173



>ref|XP_004244035.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
 ref|XP_010324244.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
 ref|XP_010324245.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
Length=604

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 72/150 (48%), Gaps = 44/150 (29%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTPSKTSKNSNSENLRSEE------------  384
            MAS P  KS  E+ N     QT ERSS R TPS+  KN+  E   S+E            
Sbjct  1    MASTPSSKSLAEKLNKTTGNQTTERSSRRSTPSQVPKNNKLETTISKEREVVSKQLVVES  60

Query  385  ----------------VLANHLDSSLNLGSIKKPPSG------DTKGLPERRADQEKKAS  498
                             LA+  DS+L LG+ K   SG      +TKG  +  ADQE+K S
Sbjct  61   TVTQKSQSSQPKGSSNSLADKFDSNLYLGNSKNSASGVGSMPTETKG-SQGTADQERKNS  119

Query  499  GSGTVKDTSASIEVSNGESSVAKTSGIGKT  588
                 KD+SAS +VS+G SS+AKTSG  K 
Sbjct  120  ----TKDSSASAKVSDGASSIAKTSGSAKI  145



>ref|XP_006346118.1| PREDICTED: protein kinase G11A-like isoform X1 [Solanum tuberosum]
 ref|XP_006346119.1| PREDICTED: protein kinase G11A-like isoform X2 [Solanum tuberosum]
 ref|XP_006346120.1| PREDICTED: protein kinase G11A-like isoform X3 [Solanum tuberosum]
 ref|XP_006346121.1| PREDICTED: protein kinase G11A-like isoform X4 [Solanum tuberosum]
Length=604

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 72/150 (48%), Gaps = 44/150 (29%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTPSKTSKNSNSENLRSEE------------  384
            MAS P  KS  E+ N     QT ERSS R TPS+  KN+  E   S+E            
Sbjct  1    MASTPSSKSLAEKLNKTTGNQTTERSSRRSTPSQVPKNNKLEIATSKEREVVSKQLVVES  60

Query  385  ----------------VLANHLDSSLNLGSIKKPPSG------DTKGLPERRADQEKKAS  498
                             LA+  DS+L LG+ K   SG      + KG  +  ADQE+K S
Sbjct  61   TVSQKSQSSQPKGSSNSLADKFDSNLYLGNSKYSASGVGSMPTEAKG-SQGTADQERKNS  119

Query  499  GSGTVKDTSASIEVSNGESSVAKTSGIGKT  588
                +KD+SAS +VS+G SS+AKTSG  K 
Sbjct  120  ----IKDSSASAKVSDGASSIAKTSGSAKI  145



>ref|XP_009625904.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009625905.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009625906.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
Length=589

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 70/137 (51%), Gaps = 32/137 (23%)
 Frame = +1

Query  256  MASKPGVKSSLERQ-----NQTLERSSHRPTPSKTSKNSNSEN-----LRSEE-------  384
            MAS P VKSSLE+      +  +E +S    PS+ SK+  SE+     LRS++       
Sbjct  1    MASTPSVKSSLEKLKKSTGSHAVEGNSRTSAPSQVSKSGKSESTTSKELRSDDRKVASKQ  60

Query  385  ---------VLANHLDSSLNLGSIKKPPSGDTKGLPERRADQEKKASGSGTVKDTSASIE  537
                     +L + L+SSL LG++K  P G    +P      + K S + TV D SAS +
Sbjct  61   LTAEAGSADLLVDKLNSSLYLGNLKHAPIGAV-SMP-----CDTKGSENETVNDCSASAK  114

Query  538  VSNGESSVAKTSGIGKT  588
            VS+G SS+ KTSG  K 
Sbjct  115  VSDGASSLGKTSGSAKV  131



>ref|XP_009774023.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
Length=587

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 12/92 (13%)
 Frame = +1

Query  331  TPSKTSKNSNSENLRSEEVLANHLDSSLNLGSIKKPPSG------DTKGLPERRADQEKK  492
            T SK S++S  +   S  +LA+  DSSL LG+ K+ P G      + KG     ADQE+K
Sbjct  44   TASKKSQSSQPKG--SPNLLADKFDSSLYLGNSKEAPGGVGTLPSEAKGPQGSTADQERK  101

Query  493  ASGSGTVKDTSASIEVSNGESSVAKTSGIGKT  588
            +S    +KD+SAS +VS+G SS+AKTSG  K 
Sbjct  102  SS----IKDSSASAKVSDGASSLAKTSGSAKI  129



>ref|XP_011095569.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
 ref|XP_011095570.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
 ref|XP_011095571.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
 ref|XP_011095573.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
Length=587

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 6/67 (9%)
 Frame = +1

Query  388  LANHLDSSLNLGSIKKPPSGDTKGLPERRADQEKKASGSGTVKDTSASIEVSNGESSVAK  567
            L   +DSSL+LG+ K+ P      +  + A+QEKK S  G VKD++AS +VS+G SS+AK
Sbjct  69   LTGKMDSSLHLGNPKQAP------ILNQTAEQEKKTSDDGNVKDSAASAKVSDGASSLAK  122

Query  568  TSGIGKT  588
            TSG  K 
Sbjct  123  TSGSAKI  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925