BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF014G07

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604671.1|  PREDICTED: vesicle-associated membrane prote...    266   7e-87   Nicotiana tomentosiformis
ref|XP_009618936.1|  PREDICTED: vesicle-associated membrane prote...    266   2e-86   Nicotiana tomentosiformis
ref|XP_009802587.1|  PREDICTED: vesicle-associated membrane prote...    265   4e-86   Nicotiana sylvestris
ref|XP_004233223.1|  PREDICTED: vesicle-associated membrane prote...    264   6e-86   
ref|XP_007147528.1|  hypothetical protein PHAVU_006G132100g             257   3e-83   Phaseolus vulgaris [French bean]
ref|XP_008225792.1|  PREDICTED: vesicle-associated membrane prote...    257   4e-83   Prunus mume [ume]
ref|XP_007212008.1|  hypothetical protein PRUPE_ppa011167mg             256   1e-82   Prunus persica
ref|XP_007024900.1|  Vesicle-associated membrane protein 726 isof...    253   2e-82   
ref|XP_003535044.1|  PREDICTED: vesicle-associated membrane prote...    255   3e-82   
ref|XP_006448758.1|  hypothetical protein CICLE_v10016613mg             253   4e-82   
gb|KDO77469.1|  hypothetical protein CISIN_1g027612mg                   252   6e-82   Citrus sinensis [apfelsine]
gb|KDO77468.1|  hypothetical protein CISIN_1g027612mg                   253   6e-82   Citrus sinensis [apfelsine]
ref|XP_007024899.1|  Vesicle-associated membrane protein 726 isof...    254   6e-82   Theobroma cacao [chocolate]
ref|XP_010242074.1|  PREDICTED: vesicle-associated membrane prote...    254   9e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006448759.1|  hypothetical protein CICLE_v10016613mg             253   2e-81   Citrus clementina [clementine]
gb|KDO77466.1|  hypothetical protein CISIN_1g027612mg                   251   2e-81   Citrus sinensis [apfelsine]
gb|KHN14368.1|  Putative vesicle-associated membrane protein 726        252   3e-81   Glycine soja [wild soybean]
gb|ACU19359.1|  unknown                                                 252   3e-81   Glycine max [soybeans]
ref|XP_008459063.1|  PREDICTED: vesicle-associated membrane prote...    252   3e-81   Cucumis melo [Oriental melon]
ref|XP_011016724.1|  PREDICTED: vesicle-associated membrane prote...    252   4e-81   Populus euphratica
gb|KGN66898.1|  hypothetical protein Csa_1G707630                       251   4e-81   Cucumis sativus [cucumbers]
gb|ACJ84389.1|  unknown                                                 251   6e-81   Medicago truncatula
ref|XP_006377004.1|  hypothetical protein POPTR_0012s12000g             251   7e-81   Populus trichocarpa [western balsam poplar]
ref|XP_002322360.1|  hypothetical protein POPTR_0015s15690g             251   7e-81   Populus trichocarpa [western balsam poplar]
gb|AFY26886.1|  vesicle-associated membrane protein 72                  251   8e-81   Morella rubra [Chinese arbutus]
ref|XP_008383321.1|  PREDICTED: vesicle-associated membrane prote...    251   8e-81   Malus domestica [apple tree]
ref|NP_001236634.1|  uncharacterized protein LOC100500089               251   1e-80   
ref|XP_003607843.1|  Vesicle-associated membrane protein                251   1e-80   
gb|AFK40215.1|  unknown                                                 251   1e-80   Medicago truncatula
ref|XP_004145455.1|  PREDICTED: putative vesicle-associated membr...    250   2e-80   Cucumis sativus [cucumbers]
ref|XP_011040378.1|  PREDICTED: vesicle-associated membrane prote...    249   3e-80   Populus euphratica
ref|XP_010092659.1|  Putative vesicle-associated membrane protein...    249   3e-80   Morus notabilis
ref|XP_003594451.1|  Vesicle-associated membrane protein                249   4e-80   
gb|KJB57022.1|  hypothetical protein B456_009G150900                    248   5e-80   Gossypium raimondii
gb|AFK36461.1|  unknown                                                 249   5e-80   Lotus japonicus
emb|CDP18918.1|  unnamed protein product                                249   5e-80   Coffea canephora [robusta coffee]
ref|XP_004505324.1|  PREDICTED: vesicle-associated membrane prote...    248   9e-80   
gb|KJB69906.1|  hypothetical protein B456_011G049200                    246   9e-80   Gossypium raimondii
gb|KHN08022.1|  Putative vesicle-associated membrane protein 726        248   1e-79   Glycine soja [wild soybean]
gb|AFK47779.1|  unknown                                                 248   2e-79   Medicago truncatula
ref|XP_002530145.1|  Vesicle-associated membrane protein, putative      248   2e-79   Ricinus communis
gb|KJB57019.1|  hypothetical protein B456_009G150900                    247   4e-79   Gossypium raimondii
gb|KHG23670.1|  vesicle-associated membrane protein                     248   4e-79   Gossypium arboreum [tree cotton]
gb|KJB69905.1|  hypothetical protein B456_011G049200                    246   5e-79   Gossypium raimondii
gb|KDP29315.1|  hypothetical protein JCGZ_19410                         246   1e-78   Jatropha curcas
ref|XP_007049803.1|  Vesicle-associated membrane protein 726            244   3e-78   
ref|XP_011096786.1|  PREDICTED: vesicle-associated membrane prote...    244   4e-78   Sesamum indicum [beniseed]
ref|XP_009588661.1|  PREDICTED: vesicle-associated membrane prote...    244   6e-78   Nicotiana tomentosiformis
ref|XP_006583934.1|  PREDICTED: vesicle-associated membrane prote...    243   1e-77   Glycine max [soybeans]
ref|XP_006352702.1|  PREDICTED: putative vesicle-associated membr...    243   2e-77   Solanum tuberosum [potatoes]
ref|XP_009787803.1|  PREDICTED: vesicle-associated membrane prote...    242   3e-77   Nicotiana sylvestris
ref|XP_008235502.1|  PREDICTED: vesicle-associated membrane prote...    241   4e-77   Prunus mume [ume]
ref|XP_004242395.1|  PREDICTED: vesicle-associated membrane prote...    241   8e-77   
gb|AAQ15287.1|  synptobrevin-related protein                            240   9e-77   Pyrus pyrifolia [sha li]
ref|NP_001280954.1|  putative vesicle-associated membrane protein...    241   1e-76   Malus domestica [apple tree]
gb|KJB10140.1|  hypothetical protein B456_001G186000                    240   1e-76   Gossypium raimondii
ref|XP_010069066.1|  PREDICTED: putative vesicle-associated membr...    240   1e-76   Eucalyptus grandis [rose gum]
gb|KHG28831.1|  Vesicle-associated membrane protein                     241   1e-76   Gossypium arboreum [tree cotton]
ref|XP_006443628.1|  hypothetical protein CICLE_v10022162mg             240   1e-76   Citrus clementina [clementine]
ref|XP_002276767.1|  PREDICTED: putative vesicle-associated membr...    240   2e-76   Vitis vinifera
ref|XP_010522412.1|  PREDICTED: vesicle-associated membrane prote...    240   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_010522416.1|  PREDICTED: vesicle-associated membrane prote...    240   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_007200441.1|  hypothetical protein PRUPE_ppa011218mg             238   2e-76   
ref|XP_007200442.1|  hypothetical protein PRUPE_ppa011218mg             239   2e-76   Prunus persica
ref|XP_009371395.1|  PREDICTED: putative vesicle-associated membr...    239   4e-76   Pyrus x bretschneideri [bai li]
ref|XP_010109710.1|  Putative vesicle-associated membrane protein...    239   4e-76   Morus notabilis
ref|XP_006306317.1|  hypothetical protein CARUB_v10012187mg             239   4e-76   Capsella rubella
ref|XP_009119258.1|  PREDICTED: vesicle-associated membrane prote...    239   4e-76   Brassica rapa
emb|CDY18254.1|  BnaC05g02770D                                          239   4e-76   Brassica napus [oilseed rape]
gb|KDP26403.1|  hypothetical protein JCGZ_17561                         239   5e-76   Jatropha curcas
ref|XP_010556950.1|  PREDICTED: vesicle-associated membrane prote...    239   5e-76   Tarenaya hassleriana [spider flower]
ref|XP_008380599.1|  PREDICTED: putative vesicle-associated membr...    239   5e-76   Malus domestica [apple tree]
ref|XP_002264270.1|  PREDICTED: vesicle-associated membrane prote...    239   6e-76   Vitis vinifera
ref|XP_002889523.1|  vesicle-associated membrane protein 7B             239   6e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_008372458.1|  PREDICTED: putative vesicle-associated membr...    238   8e-76   
gb|KDO49381.1|  hypothetical protein CISIN_1g0277592mg                  237   8e-76   Citrus sinensis [apfelsine]
emb|CDY19450.1|  BnaC04g11490D                                          238   9e-76   Brassica napus [oilseed rape]
emb|CDX79510.1|  BnaC03g18460D                                          238   1e-75   
ref|XP_002521112.1|  Vesicle-associated membrane protein, putative      238   1e-75   Ricinus communis
ref|XP_009351028.1|  PREDICTED: putative vesicle-associated membr...    238   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_007034424.1|  Vesicle-associated membrane protein 726 isof...    238   1e-75   
gb|KDP20321.1|  hypothetical protein JCGZ_06407                         238   1e-75   Jatropha curcas
ref|XP_007034425.1|  Vesicle-associated membrane protein 726 isof...    238   2e-75   
ref|XP_009132911.1|  PREDICTED: vesicle-associated membrane prote...    238   2e-75   Brassica rapa
ref|XP_010932918.1|  PREDICTED: putative vesicle-associated membr...    237   2e-75   
ref|NP_171968.1|  vesicle-associated membrane protein 726               237   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413307.1|  PREDICTED: vesicle-associated membrane prote...    237   2e-75   
gb|AAF40460.1|AC004809_18  Strong similarity to the synaptobrevin...    238   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KHM99990.1|  Putative vesicle-associated membrane protein 726        238   2e-75   Glycine soja [wild soybean]
gb|EYU43691.1|  hypothetical protein MIMGU_mgv1a013245mg                238   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_003556884.1|  PREDICTED: putative vesicle-associated membr...    237   3e-75   Glycine max [soybeans]
ref|XP_006418096.1|  hypothetical protein EUTSA_v10008729mg             237   3e-75   Eutrema salsugineum [saltwater cress]
ref|XP_006420620.1|  hypothetical protein CICLE_v10005852mg             237   3e-75   
ref|XP_010264069.1|  PREDICTED: vesicle-associated membrane prote...    237   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_009370116.1|  PREDICTED: putative vesicle-associated membr...    237   4e-75   Pyrus x bretschneideri [bai li]
ref|XP_009143895.1|  PREDICTED: vesicle-associated membrane prote...    237   4e-75   Brassica rapa
emb|CDP03855.1|  unnamed protein product                                236   4e-75   Coffea canephora [robusta coffee]
ref|XP_004290222.1|  PREDICTED: vesicle-associated membrane prote...    236   5e-75   Fragaria vesca subsp. vesca
ref|XP_010556949.1|  PREDICTED: vesicle-associated membrane prote...    236   5e-75   Tarenaya hassleriana [spider flower]
ref|XP_010457534.1|  PREDICTED: putative vesicle-associated membr...    236   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009335952.1|  PREDICTED: putative vesicle-associated membr...    236   7e-75   Pyrus x bretschneideri [bai li]
gb|ADK78986.1|  VAMP721                                                 236   7e-75   Petunia integrifolia subsp. inflata
emb|CDY10053.1|  BnaC08g43980D                                          236   1e-74   Brassica napus [oilseed rape]
gb|KFK42811.1|  hypothetical protein AALP_AA1G041700                    236   1e-74   Arabis alpina [alpine rockcress]
ref|XP_002879406.1|  hypothetical protein ARALYDRAFT_482195             235   1e-74   
gb|KFK31144.1|  hypothetical protein AALP_AA6G074500                    235   1e-74   Arabis alpina [alpine rockcress]
ref|XP_011080177.1|  PREDICTED: vesicle-associated membrane prote...    235   1e-74   Sesamum indicum [beniseed]
ref|XP_004247095.1|  PREDICTED: vesicle-associated membrane prote...    235   1e-74   
ref|XP_009627066.1|  PREDICTED: vesicle-associated membrane prote...    235   1e-74   Nicotiana tomentosiformis
ref|XP_009118621.1|  PREDICTED: vesicle-associated membrane prote...    235   1e-74   Brassica rapa
ref|XP_006857408.1|  hypothetical protein AMTR_s00067p00148060          235   1e-74   
ref|XP_010413966.1|  PREDICTED: putative vesicle-associated membr...    235   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006364264.1|  PREDICTED: vesicle-associated membrane prote...    235   1e-74   Solanum tuberosum [potatoes]
gb|KFK31080.1|  hypothetical protein AALP_AA6G065800                    235   2e-74   Arabis alpina [alpine rockcress]
ref|XP_010413912.1|  PREDICTED: vesicle-associated membrane prote...    235   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010241141.1|  PREDICTED: putative vesicle-associated membr...    234   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010475140.1|  PREDICTED: putative vesicle-associated membr...    234   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010509926.1|  PREDICTED: vesicle-associated membrane prote...    234   3e-74   Camelina sativa [gold-of-pleasure]
gb|KEH41273.1|  synaptobrevin-like protein                              234   3e-74   Medicago truncatula
ref|XP_008234811.1|  PREDICTED: putative vesicle-associated membr...    234   3e-74   Prunus mume [ume]
ref|NP_180871.1|  vesicle-associated membrane protein 722               234   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775432.1|  PREDICTED: vesicle-associated membrane prote...    234   3e-74   
emb|CDX86608.1|  BnaC08g00950D                                          234   3e-74   
ref|XP_007226125.1|  hypothetical protein PRUPE_ppa011188mg             234   3e-74   Prunus persica
ref|XP_010069661.1|  PREDICTED: vesicle-associated membrane prote...    234   4e-74   Eucalyptus grandis [rose gum]
ref|XP_006410450.1|  hypothetical protein EUTSA_v10017216mg             234   4e-74   Eutrema salsugineum [saltwater cress]
gb|AFK34145.1|  unknown                                                 233   4e-74   Lotus japonicus
gb|AFK39584.1|  unknown                                                 233   4e-74   Lotus japonicus
ref|XP_011083121.1|  PREDICTED: vesicle-associated membrane prote...    234   5e-74   Sesamum indicum [beniseed]
gb|EYU46345.1|  hypothetical protein MIMGU_mgv1a013442mg                234   5e-74   Erythranthe guttata [common monkey flower]
ref|XP_006410397.1|  hypothetical protein EUTSA_v10017717mg             235   5e-74   
emb|CDY06150.1|  BnaA09g50530D                                          234   5e-74   
ref|XP_002267063.1|  PREDICTED: vesicle-associated membrane prote...    234   5e-74   Vitis vinifera
ref|XP_008224587.1|  PREDICTED: putative vesicle-associated membr...    233   6e-74   Prunus mume [ume]
ref|XP_008438380.1|  PREDICTED: putative vesicle-associated membr...    233   7e-74   Cucumis melo [Oriental melon]
ref|XP_011016158.1|  PREDICTED: vesicle-associated membrane prote...    233   7e-74   Populus euphratica
ref|XP_006294968.1|  hypothetical protein CARUB_v10024024mg             233   7e-74   Capsella rubella
ref|XP_002518125.1|  Vesicle-associated membrane protein, putative      233   8e-74   Ricinus communis
gb|KJB33093.1|  hypothetical protein B456_006G056000                    232   8e-74   Gossypium raimondii
gb|KCW57284.1|  hypothetical protein EUGRSUZ_H00084                     238   8e-74   Eucalyptus grandis [rose gum]
ref|XP_006304190.1|  hypothetical protein CARUB_v10010251mg             233   9e-74   Capsella rubella
ref|XP_002892239.1|  vesicle-associated membrane protein 7B             233   9e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_011020670.1|  PREDICTED: vesicle-associated membrane prote...    232   9e-74   Populus euphratica
gb|AAC04496.1|  putative synaptobrevin                                  233   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304708.1|  synptobrevin-related family protein                233   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006293513.1|  hypothetical protein CARUB_v10024029mg             233   1e-73   Capsella rubella
ref|XP_011020669.1|  PREDICTED: vesicle-associated membrane prote...    233   1e-73   Populus euphratica
ref|XP_009621355.1|  PREDICTED: putative vesicle-associated membr...    233   1e-73   Nicotiana tomentosiformis
ref|XP_008371850.1|  PREDICTED: vesicle-associated membrane prote...    233   1e-73   
ref|XP_004506588.1|  PREDICTED: vesicle-associated membrane prote...    233   1e-73   Cicer arietinum [garbanzo]
gb|AFK40729.1|  unknown                                                 233   1e-73   Lotus japonicus
ref|XP_004134008.1|  PREDICTED: putative vesicle-associated membr...    233   1e-73   Cucumis sativus [cucumbers]
ref|XP_010524695.1|  PREDICTED: putative vesicle-associated membr...    233   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_010469563.1|  PREDICTED: vesicle-associated membrane prote...    232   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010475139.1|  PREDICTED: vesicle-associated membrane prote...    232   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009132860.1|  PREDICTED: putative vesicle-associated membr...    232   2e-73   Brassica rapa
gb|KFK42812.1|  hypothetical protein AALP_AA1G041800                    232   2e-73   Arabis alpina [alpine rockcress]
ref|NP_171967.1|  vesicle-associated membrane protein 7B                232   2e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43410.1|  putative vesicle-associated membrane protein, sy...    232   2e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19154.1|  BnaA04g18940D                                          232   2e-73   Brassica napus [oilseed rape]
ref|XP_003604990.1|  Vesicle-associated membrane protein                232   3e-73   Medicago truncatula
ref|XP_004296647.1|  PREDICTED: putative vesicle-associated membr...    232   3e-73   Fragaria vesca subsp. vesca
gb|KJB33092.1|  hypothetical protein B456_006G056000                    232   3e-73   Gossypium raimondii
ref|XP_010542985.1|  PREDICTED: vesicle-associated membrane prote...    232   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_008803805.1|  PREDICTED: putative vesicle-associated membr...    232   3e-73   
ref|XP_004152023.1|  PREDICTED: putative vesicle-associated membr...    231   3e-73   Cucumis sativus [cucumbers]
ref|XP_010910152.1|  PREDICTED: vesicle-associated membrane prote...    231   4e-73   
ref|NP_180826.2|  vesicle-associated membrane protein 725               234   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535217.1|  PREDICTED: putative vesicle-associated membr...    231   5e-73   Glycine max [soybeans]
ref|XP_010038359.1|  PREDICTED: vesicle-associated membrane prote...    231   5e-73   Eucalyptus grandis [rose gum]
gb|AAA56991.1|  formerly called HAT24; synaptobrevin-related protein    231   5e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KJB71677.1|  hypothetical protein B456_011G160700                    231   6e-73   Gossypium raimondii
gb|EPS70718.1|  hypothetical protein M569_04041                         231   6e-73   Genlisea aurea
ref|XP_010413913.1|  PREDICTED: vesicle-associated membrane prote...    231   7e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009408466.1|  PREDICTED: vesicle-associated membrane prote...    231   7e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU17981.1|  hypothetical protein MIMGU_mgv1a013452mg                231   8e-73   Erythranthe guttata [common monkey flower]
ref|XP_006650747.1|  PREDICTED: vesicle-associated membrane prote...    231   8e-73   Oryza brachyantha
ref|XP_007145403.1|  hypothetical protein PHAVU_007G235900g             231   8e-73   Phaseolus vulgaris [French bean]
gb|KCW50174.1|  hypothetical protein EUGRSUZ_K03606                     230   8e-73   Eucalyptus grandis [rose gum]
ref|XP_009767969.1|  PREDICTED: putative vesicle-associated membr...    230   1e-72   Nicotiana sylvestris
ref|XP_008465086.1|  PREDICTED: vesicle-associated membrane prote...    230   1e-72   Cucumis melo [Oriental melon]
ref|XP_009417150.1|  PREDICTED: vesicle-associated membrane prote...    230   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06809.1|  hypothetical protein F383_08210                         230   2e-72   Gossypium arboreum [tree cotton]
ref|XP_011073775.1|  PREDICTED: putative vesicle-associated membr...    230   2e-72   Sesamum indicum [beniseed]
emb|CDY15521.1|  BnaA08g28050D                                          230   2e-72   Brassica napus [oilseed rape]
gb|KJB37798.1|  hypothetical protein B456_006G220500                    229   2e-72   Gossypium raimondii
ref|XP_004293741.1|  PREDICTED: putative vesicle-associated membr...    229   2e-72   Fragaria vesca subsp. vesca
ref|XP_009141263.1|  PREDICTED: vesicle-associated membrane prote...    229   2e-72   Brassica rapa
ref|XP_002303031.1|  hypothetical protein POPTR_0002s24200g             229   3e-72   
ref|XP_006360344.1|  PREDICTED: vesicle-associated membrane prote...    229   4e-72   Solanum tuberosum [potatoes]
ref|XP_004514024.1|  PREDICTED: putative vesicle-associated membr...    229   4e-72   Cicer arietinum [garbanzo]
ref|XP_009143949.1|  PREDICTED: putative vesicle-associated membr...    229   5e-72   Brassica rapa
emb|CDY48531.1|  BnaC04g43180D                                          228   7e-72   Brassica napus [oilseed rape]
gb|ABK22119.1|  unknown                                                 228   8e-72   Picea sitchensis
ref|XP_010674670.1|  PREDICTED: vesicle-associated membrane prote...    228   9e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB22568.1|  hypothetical protein B456_004G058500                    228   1e-71   Gossypium raimondii
gb|KJB22566.1|  hypothetical protein B456_004G058500                    227   1e-71   Gossypium raimondii
ref|XP_010547077.1|  PREDICTED: vesicle-associated membrane prote...    228   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_009398406.1|  PREDICTED: putative vesicle-associated membr...    228   1e-71   
gb|KJB22567.1|  hypothetical protein B456_004G058500                    228   2e-71   Gossypium raimondii
gb|KJB57021.1|  hypothetical protein B456_009G150900                    227   2e-71   Gossypium raimondii
gb|KFK31079.1|  hypothetical protein AALP_AA6G065700                    227   2e-71   Arabis alpina [alpine rockcress]
ref|XP_011091409.1|  PREDICTED: vesicle-associated membrane prote...    227   2e-71   Sesamum indicum [beniseed]
gb|EYU31743.1|  hypothetical protein MIMGU_mgv1a013482mg                226   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_004247839.1|  PREDICTED: putative vesicle-associated membr...    226   3e-71   Solanum lycopersicum
ref|XP_009757440.1|  PREDICTED: putative vesicle-associated membr...    226   4e-71   Nicotiana sylvestris
ref|XP_009608699.1|  PREDICTED: putative vesicle-associated membr...    226   4e-71   Nicotiana tomentosiformis
ref|XP_007140572.1|  hypothetical protein PHAVU_008G123900g             226   5e-71   Phaseolus vulgaris [French bean]
ref|XP_007157801.1|  hypothetical protein PHAVU_002G099400g             226   5e-71   Phaseolus vulgaris [French bean]
gb|KJB42279.1|  hypothetical protein B456_007G153200                    226   5e-71   Gossypium raimondii
ref|NP_001031469.1|  vesicle-associated membrane protein 722            226   9e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335953.1|  PREDICTED: putative vesicle-associated membr...    225   1e-70   
gb|KHG06808.1|  hypothetical protein F383_08210                         227   1e-70   Gossypium arboreum [tree cotton]
ref|XP_009141288.1|  PREDICTED: vesicle-associated membrane prote...    225   1e-70   Brassica rapa
gb|EPS61521.1|  hypothetical protein M569_13274                         224   2e-70   Genlisea aurea
ref|XP_002297816.2|  hypothetical protein POPTR_0001s14430g             224   3e-70   
ref|XP_002881263.1|  hypothetical protein ARALYDRAFT_482248             224   3e-70   
ref|XP_011034474.1|  PREDICTED: vesicle-associated membrane prote...    223   5e-70   Populus euphratica
ref|XP_003552141.1|  PREDICTED: vesicle-associated membrane prote...    222   1e-69   Glycine max [soybeans]
emb|CDY37751.1|  BnaA04g19170D                                          222   2e-69   Brassica napus [oilseed rape]
dbj|BAJ88124.1|  predicted protein                                      221   5e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009111083.1|  PREDICTED: vesicle-associated membrane prote...    221   6e-69   Brassica rapa
gb|KCW63002.1|  hypothetical protein EUGRSUZ_G00602                     219   6e-69   Eucalyptus grandis [rose gum]
ref|XP_008457256.1|  PREDICTED: vesicle-associated membrane prote...    219   8e-69   Cucumis melo [Oriental melon]
ref|XP_004138954.1|  PREDICTED: putative vesicle-associated membr...    220   1e-68   Cucumis sativus [cucumbers]
gb|KCW63001.1|  hypothetical protein EUGRSUZ_G00601                     219   1e-68   Eucalyptus grandis [rose gum]
gb|EMT18448.1|  Putative vesicle-associated membrane protein 726        221   1e-68   
ref|NP_001241434.1|  uncharacterized protein LOC100804314               220   1e-68   Glycine max [soybeans]
ref|XP_010547078.1|  PREDICTED: vesicle-associated membrane prote...    219   2e-68   Tarenaya hassleriana [spider flower]
gb|EPS71680.1|  hypothetical protein M569_03080                         219   2e-68   Genlisea aurea
ref|NP_001148792.1|  vesicle-associated membrane protein 725            219   3e-68   Zea mays [maize]
ref|XP_003622969.1|  Vesicle-associated membrane protein                219   3e-68   Medicago truncatula
ref|XP_010065488.1|  PREDICTED: vesicle-associated membrane prote...    219   3e-68   Eucalyptus grandis [rose gum]
ref|XP_008457255.1|  PREDICTED: vesicle-associated membrane prote...    218   3e-68   Cucumis melo [Oriental melon]
ref|XP_008457254.1|  PREDICTED: vesicle-associated membrane prote...    219   3e-68   Cucumis melo [Oriental melon]
ref|NP_001130551.1|  uncharacterized protein LOC100191650               216   4e-68   
ref|XP_003532299.1|  PREDICTED: vesicle-associated membrane prote...    218   6e-68   Glycine max [soybeans]
ref|XP_010065492.1|  PREDICTED: vesicle-associated membrane prote...    218   7e-68   Eucalyptus grandis [rose gum]
tpg|DAA42470.1|  TPA: putative vesicle-associated membrane protei...    216   8e-68   
ref|XP_008457253.1|  PREDICTED: vesicle-associated membrane prote...    219   9e-68   
ref|XP_009418833.1|  PREDICTED: vesicle-associated membrane prote...    217   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA42471.1|  TPA: putative vesicle-associated membrane protei...    216   2e-67   
gb|KJB42280.1|  hypothetical protein B456_007G153200                    216   2e-67   Gossypium raimondii
ref|XP_002459506.1|  hypothetical protein SORBIDRAFT_02g005730          216   3e-67   Sorghum bicolor [broomcorn]
ref|NP_001059109.1|  Os07g0194000                                       216   3e-67   
ref|XP_004955737.1|  PREDICTED: vesicle-associated membrane prote...    216   3e-67   Setaria italica
ref|XP_010326817.1|  PREDICTED: putative vesicle-associated membr...    217   3e-67   
ref|XP_007140571.1|  hypothetical protein PHAVU_008G123800g             216   3e-67   Phaseolus vulgaris [French bean]
ref|XP_004253005.1|  PREDICTED: putative vesicle-associated membr...    216   5e-67   Solanum lycopersicum
ref|XP_006349936.1|  PREDICTED: vesicle-associated membrane prote...    216   5e-67   Solanum tuberosum [potatoes]
ref|XP_010923320.1|  PREDICTED: vesicle-associated membrane prote...    216   6e-67   
ref|XP_006657530.1|  PREDICTED: vesicle-associated membrane prote...    216   6e-67   Oryza brachyantha
gb|KHG13199.1|  vesicle-associated membrane protein                     217   7e-67   Gossypium arboreum [tree cotton]
ref|XP_010065491.1|  PREDICTED: vesicle-associated membrane prote...    216   8e-67   Eucalyptus grandis [rose gum]
gb|KEH22817.1|  synaptobrevin-like protein                              214   1e-66   Medicago truncatula
ref|XP_004985585.1|  PREDICTED: putative vesicle-associated membr...    215   1e-66   Setaria italica
ref|XP_004985586.1|  PREDICTED: putative vesicle-associated membr...    214   2e-66   Setaria italica
ref|XP_003622943.1|  Vesicle-associated membrane protein                214   2e-66   Medicago truncatula
ref|XP_008651398.1|  PREDICTED: putative vesicle-associated membr...    214   2e-66   
ref|XP_008651397.1|  PREDICTED: putative vesicle-associated membr...    214   2e-66   
ref|NP_001051606.1|  Os03g0803000                                       214   4e-66   
ref|XP_010934067.1|  PREDICTED: putative vesicle-associated membr...    213   4e-66   
ref|XP_008808719.1|  PREDICTED: vesicle-associated membrane prote...    213   6e-66   
ref|XP_004981381.1|  PREDICTED: vesicle-associated membrane prote...    213   7e-66   Setaria italica
gb|ACG34366.1|  vesicle-associated membrane protein 725                 214   2e-65   Zea mays [maize]
emb|CAN65946.1|  hypothetical protein VITISV_029427                     211   2e-65   Vitis vinifera
ref|XP_009388457.1|  PREDICTED: vesicle-associated membrane prote...    211   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002967324.1|  hypothetical protein SELMODRAFT_86867              211   4e-65   Selaginella moellendorffii
ref|XP_002960391.1|  hypothetical protein SELMODRAFT_164037             211   4e-65   Selaginella moellendorffii
ref|XP_010684935.1|  PREDICTED: vesicle-associated membrane prote...    211   5e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004492323.1|  PREDICTED: vesicle-associated membrane prote...    211   5e-65   Cicer arietinum [garbanzo]
ref|XP_006853346.1|  hypothetical protein AMTR_s00032p00095920          211   5e-65   
ref|XP_008660540.1|  PREDICTED: putative vesicle-associated membr...    211   6e-65   Zea mays [maize]
ref|XP_008660539.1|  PREDICTED: putative vesicle-associated membr...    211   6e-65   Zea mays [maize]
ref|XP_010065490.1|  PREDICTED: vesicle-associated membrane prote...    211   6e-65   Eucalyptus grandis [rose gum]
ref|XP_003557429.1|  PREDICTED: vesicle-associated membrane prote...    211   7e-65   Brachypodium distachyon [annual false brome]
ref|XP_004514025.1|  PREDICTED: putative vesicle-associated membr...    210   7e-65   Cicer arietinum [garbanzo]
ref|NP_001149329.1|  vesicle-associated membrane protein 725            210   1e-64   Zea mays [maize]
gb|KDO77470.1|  hypothetical protein CISIN_1g027612mg                   207   1e-64   Citrus sinensis [apfelsine]
ref|XP_002466264.1|  hypothetical protein SORBIDRAFT_01g004700          210   1e-64   
gb|KDO77463.1|  hypothetical protein CISIN_1g027612mg                   208   3e-64   
gb|KDO77471.1|  hypothetical protein CISIN_1g027612mg                   206   4e-64   
ref|XP_006448760.1|  hypothetical protein CICLE_v10016613mg             206   4e-64   
ref|XP_001777330.1|  R-SNARE, VAMP72-family                             208   5e-64   
ref|XP_010228179.1|  PREDICTED: vesicle-associated membrane prote...    208   7e-64   
ref|XP_006649451.1|  PREDICTED: putative vesicle-associated membr...    207   9e-64   
ref|XP_010269629.1|  PREDICTED: vesicle-associated membrane prote...    207   9e-64   
ref|XP_008644423.1|  PREDICTED: vesicle-associated membrane prote...    207   1e-63   
ref|NP_850201.1|  vesicle-associated membrane protein 723               206   2e-63   
gb|ABK24294.1|  unknown                                                 206   5e-63   
gb|ABK27118.1|  unknown                                                 206   5e-63   
gb|AAC04922.1|  putative synaptobrevin                                  205   6e-63   
gb|EEC81677.1|  hypothetical protein OsI_25239                          206   6e-63   
ref|XP_008662658.1|  PREDICTED: vesicle-associated membrane prote...    206   1e-62   
ref|XP_002986717.1|  hypothetical protein SELMODRAFT_235084             204   1e-62   
ref|XP_001784148.1|  R-SNARE, VAMP72-family                             204   1e-62   
ref|XP_010259650.1|  PREDICTED: vesicle-associated membrane prote...    204   3e-62   
ref|NP_001049070.1|  Os03g0165800                                       203   4e-62   
ref|XP_003607844.1|  Vesicle-associated membrane protein                199   8e-62   
ref|XP_008662650.1|  PREDICTED: vesicle-associated membrane prote...    204   8e-62   
ref|XP_008662654.1|  PREDICTED: vesicle-associated membrane prote...    203   1e-61   
ref|XP_002273101.1|  PREDICTED: vesicle-associated membrane prote...    201   4e-61   
ref|XP_008351206.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    198   5e-61   
ref|XP_006855544.1|  hypothetical protein AMTR_s00057p00217050          201   5e-61   
emb|CDM82457.1|  unnamed protein product                                206   1e-60   
ref|XP_009784059.1|  PREDICTED: vesicle-associated membrane prote...    199   1e-60   
ref|XP_006342793.1|  PREDICTED: vesicle-associated membrane prote...    199   1e-60   
ref|XP_007154271.1|  hypothetical protein PHAVU_003G104700g             199   1e-60   
ref|XP_009592498.1|  PREDICTED: vesicle-associated membrane prote...    199   2e-60   
ref|XP_006582892.1|  PREDICTED: uncharacterized protein LOC100781...    199   2e-60   
ref|NP_001242377.1|  uncharacterized protein LOC100781950               199   2e-60   
ref|XP_011090953.1|  PREDICTED: vesicle-associated membrane prote...    199   2e-60   
ref|XP_004229234.1|  PREDICTED: vesicle-associated membrane prote...    199   3e-60   
gb|KHN14630.1|  Vesicle-associated membrane protein 724                 199   3e-60   
ref|NP_001237046.1|  uncharacterized protein LOC100527252               199   3e-60   
ref|XP_004487861.1|  PREDICTED: vesicle-associated membrane prote...    198   3e-60   
gb|ACJ84394.1|  unknown                                                 198   3e-60   
ref|XP_010068178.1|  PREDICTED: vesicle-associated membrane prote...    198   4e-60   
ref|XP_009343983.1|  PREDICTED: vesicle-associated membrane prote...    198   4e-60   
gb|KCW62998.1|  hypothetical protein EUGRSUZ_G00599                     198   4e-60   
gb|ABK23325.1|  unknown                                                 199   4e-60   
gb|EMT03059.1|  Putative vesicle-associated membrane protein 726        199   5e-60   
ref|XP_008392281.1|  PREDICTED: vesicle-associated membrane prote...    198   5e-60   
ref|XP_009352245.1|  PREDICTED: vesicle-associated membrane prote...    198   5e-60   
gb|KJB57023.1|  hypothetical protein B456_009G150900                    197   6e-60   
ref|XP_003558739.1|  PREDICTED: putative vesicle-associated membr...    198   6e-60   
ref|XP_003577814.1|  PREDICTED: putative vesicle-associated membr...    197   7e-60   
ref|XP_007138903.1|  hypothetical protein PHAVU_009G247400g             197   7e-60   
gb|AFK38247.1|  unknown                                                 197   8e-60   
ref|XP_008223166.1|  PREDICTED: vesicle-associated membrane prote...    197   8e-60   
ref|XP_007226119.1|  hypothetical protein PRUPE_ppa011159mg             197   8e-60   
gb|KJB12631.1|  hypothetical protein B456_002G028200                    196   1e-59   
gb|ACO87682.1|  synaptobrevin-like protein                              197   1e-59   
ref|XP_003550254.1|  PREDICTED: vesicle-associated membrane prote...    197   1e-59   
ref|XP_008390678.1|  PREDICTED: vesicle-associated membrane prote...    197   1e-59   
ref|XP_010098294.1|  Vesicle-associated membrane protein 724            196   2e-59   
gb|KCW61131.1|  hypothetical protein EUGRSUZ_H039041                    194   2e-59   
ref|XP_006419598.1|  hypothetical protein CICLE_v10005844mg             196   2e-59   
gb|KJB12632.1|  hypothetical protein B456_002G028200                    196   2e-59   
ref|XP_004296828.1|  PREDICTED: vesicle-associated membrane prote...    196   3e-59   
ref|XP_006389238.1|  hypothetical protein POPTR_0034s00330g             196   3e-59   
ref|XP_011045447.1|  PREDICTED: vesicle-associated membrane prote...    196   3e-59   
ref|XP_002468451.1|  hypothetical protein SORBIDRAFT_01g046130          196   5e-59   
ref|XP_003533403.1|  PREDICTED: vesicle-associated membrane prote...    196   5e-59   
ref|XP_002516908.1|  Vesicle-associated membrane protein, putative      196   5e-59   
ref|XP_011071446.1|  PREDICTED: vesicle-associated membrane prote...    195   8e-59   
ref|XP_007035565.1|  Vesicle-associated membrane protein 724            194   1e-58   
gb|KJB12629.1|  hypothetical protein B456_002G028200                    196   1e-58   
ref|XP_006414448.1|  hypothetical protein EUTSA_v10026189mg             194   1e-58   
gb|KFK44987.1|  hypothetical protein AALP_AA1G329300                    194   2e-58   
ref|XP_006284495.1|  hypothetical protein CARUB_v10005687mg             194   2e-58   
ref|XP_010024689.1|  PREDICTED: vesicle-associated membrane prote...    194   2e-58   
ref|XP_010551064.1|  PREDICTED: vesicle-associated membrane prote...    194   2e-58   
gb|KHG15268.1|  Vesicle-associated membrane protein                     194   2e-58   
ref|NP_193313.5|  vesicle-associated membrane protein 724               193   3e-58   
sp|O23429.2|VA724_ARATH  RecName: Full=Vesicle-associated membran...    193   4e-58   
ref|XP_002868180.1|  hypothetical protein ARALYDRAFT_915207             193   4e-58   
emb|CDP19534.1|  unnamed protein product                                193   5e-58   
ref|XP_010449891.1|  PREDICTED: vesicle-associated membrane prote...    193   5e-58   
ref|XP_009146719.1|  PREDICTED: vesicle-associated membrane prote...    192   8e-58   
gb|KJB38624.1|  hypothetical protein B456_006G263500                    192   9e-58   
ref|XP_004171337.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    192   9e-58   
ref|XP_008458455.1|  PREDICTED: vesicle-associated membrane prote...    192   1e-57   
ref|XP_004143088.1|  PREDICTED: vesicle-associated membrane prote...    192   1e-57   
emb|CDY22900.1|  BnaA01g18380D                                          192   2e-57   
ref|XP_010434919.1|  PREDICTED: vesicle-associated membrane prote...    191   3e-57   
gb|KJB33094.1|  hypothetical protein B456_006G056000                    188   3e-57   
ref|XP_006855103.1|  hypothetical protein AMTR_s00031p00183990          191   3e-57   
gb|KHG04679.1|  Vesicle-associated membrane protein                     191   3e-57   
emb|CDY44179.1|  BnaC01g22290D                                          190   5e-57   
ref|XP_009412477.1|  PREDICTED: vesicle-associated membrane prote...    190   6e-57   
gb|KCW84470.1|  hypothetical protein EUGRSUZ_B01305                     189   6e-57   
ref|XP_004963344.1|  PREDICTED: putative vesicle-associated membr...    189   1e-56   
ref|XP_010037394.1|  PREDICTED: vesicle-associated membrane prote...    189   2e-56   
ref|XP_002269134.1|  PREDICTED: vesicle-associated membrane prote...    189   2e-56   
ref|XP_010931625.1|  PREDICTED: vesicle-associated membrane prote...    189   2e-56   
ref|XP_007142865.1|  hypothetical protein PHAVU_007G023300g             188   5e-56   
ref|XP_010554503.1|  PREDICTED: vesicle-associated membrane prote...    188   8e-56   
ref|XP_010031285.1|  PREDICTED: vesicle-associated membrane prote...    187   1e-55   
ref|XP_008788949.1|  PREDICTED: vesicle-associated membrane prote...    187   2e-55   
gb|KJB60248.1|  hypothetical protein B456_009G303300                    187   2e-55   
ref|XP_009336053.1|  PREDICTED: vesicle-associated membrane prote...    185   2e-55   
ref|XP_002515759.1|  Vesicle-associated membrane protein, putative      186   2e-55   
ref|XP_008800852.1|  PREDICTED: vesicle-associated membrane prote...    186   3e-55   
ref|XP_010024691.1|  PREDICTED: vesicle-associated membrane prote...    185   8e-55   
ref|XP_002315429.1|  hypothetical protein POPTR_0010s24630g             185   8e-55   
ref|XP_006664247.1|  PREDICTED: vesicle-associated membrane prote...    184   9e-55   
ref|XP_010910975.1|  PREDICTED: vesicle-associated membrane prote...    184   2e-54   
gb|KDO44423.1|  hypothetical protein CISIN_1g0264261mg                  182   2e-54   
ref|XP_006445743.1|  hypothetical protein CICLE_v10016922mg             182   2e-54   
ref|XP_006403590.1|  hypothetical protein EUTSA_v10010674mg             184   2e-54   
ref|XP_002311006.1|  Vesicle-associated membrane protein 727            184   2e-54   
ref|XP_010695070.1|  PREDICTED: vesicle-associated membrane prote...    184   2e-54   
emb|CDX67594.1|  BnaA07g16340D                                          184   3e-54   
ref|NP_001067392.2|  Os12g0639800                                       183   3e-54   
ref|XP_011032884.1|  PREDICTED: vesicle-associated membrane prote...    184   3e-54   
gb|KDO44422.1|  hypothetical protein CISIN_1g0264261mg                  182   3e-54   
ref|XP_003536697.1|  PREDICTED: vesicle-associated membrane prote...    184   3e-54   
ref|XP_007218295.1|  hypothetical protein PRUPE_ppa010737mg             183   4e-54   
ref|XP_009103912.1|  PREDICTED: vesicle-associated membrane prote...    184   4e-54   
ref|XP_007010423.1|  Vesicle-associated membrane protein 727            183   4e-54   
gb|KDP43378.1|  hypothetical protein JCGZ_26478                         183   6e-54   
ref|XP_006485186.1|  PREDICTED: vesicle-associated membrane prote...    183   7e-54   
ref|XP_008244890.1|  PREDICTED: vesicle-associated membrane prote...    182   8e-54   
ref|XP_004306429.1|  PREDICTED: vesicle-associated membrane prote...    182   9e-54   
emb|CDY07551.1|  BnaC06g15130D                                          182   1e-53   
ref|XP_003555880.1|  PREDICTED: vesicle-associated membrane prote...    182   2e-53   
ref|XP_008345948.1|  PREDICTED: vesicle-associated membrane prote...    182   2e-53   
ref|XP_011024182.1|  PREDICTED: vesicle-associated membrane prote...    181   2e-53   
gb|EMT21571.1|  Vesicle-associated membrane protein 727                 183   2e-53   
ref|XP_010245408.1|  PREDICTED: vesicle-associated membrane prote...    181   2e-53   
ref|XP_009355010.1|  PREDICTED: vesicle-associated membrane prote...    181   2e-53   
ref|XP_004170493.1|  PREDICTED: vesicle-associated membrane prote...    179   3e-53   
gb|ACU23563.1|  unknown                                                 181   4e-53   
ref|XP_003574932.1|  PREDICTED: vesicle-associated membrane prote...    181   4e-53   
gb|ACU24529.1|  unknown                                                 181   4e-53   
gb|ADE76573.1|  unknown                                                 177   4e-53   
ref|XP_011101625.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    181   4e-53   
ref|XP_009419510.1|  PREDICTED: vesicle-associated membrane prote...    181   4e-53   
ref|XP_010109712.1|  Putative vesicle-associated membrane protein...    176   5e-53   
gb|KJB60252.1|  hypothetical protein B456_009G303300                    180   6e-53   
ref|XP_008806092.1|  PREDICTED: vesicle-associated membrane prote...    180   7e-53   
gb|AAS88558.1|  putative synaptobrevin                                  179   9e-53   
gb|AAV49990.1|  putative synaptobrevin/VAMP                             179   9e-53   
ref|XP_008456603.1|  PREDICTED: vesicle-associated membrane prote...    180   9e-53   
ref|XP_008347223.1|  PREDICTED: vesicle-associated membrane prote...    179   9e-53   
ref|XP_009622317.1|  PREDICTED: vesicle-associated membrane prote...    180   9e-53   
emb|CDO99918.1|  unnamed protein product                                180   9e-53   
gb|EYU19818.1|  hypothetical protein MIMGU_mgv1a012998mg                180   9e-53   
emb|CAJ15414.1|  unnamed protein product                                179   1e-52   
ref|XP_010943829.1|  PREDICTED: vesicle-associated membrane prote...    179   1e-52   
ref|XP_004974203.1|  PREDICTED: vesicle-associated membrane prote...    179   2e-52   
ref|XP_004140905.1|  PREDICTED: vesicle-associated membrane prote...    179   2e-52   
ref|XP_009412480.1|  PREDICTED: vesicle-associated membrane prote...    179   2e-52   
ref|XP_003637224.1|  Vesicle-associated membrane protein                179   2e-52   
ref|XP_002877968.1|  ATVAMP727                                          179   2e-52   
ref|NP_190998.1|  vesicle-associated membrane protein 727               179   2e-52   
emb|CDX73490.1|  BnaC08g25130D                                          179   2e-52   
ref|XP_009139247.1|  PREDICTED: vesicle-associated membrane prote...    179   2e-52   
emb|CDX76153.1|  BnaA04g04170D                                          179   2e-52   
emb|CAJ13968.1|  unnamed protein product                                179   2e-52   
gb|KDP27786.1|  hypothetical protein JCGZ_18866                         177   3e-52   
emb|CAJ13552.1|  unnamed protein product                                178   3e-52   
gb|EPS64544.1|  hypothetical protein M569_10239                         178   4e-52   
ref|XP_010427103.1|  PREDICTED: vesicle-associated membrane prote...    178   4e-52   
emb|CAJ13539.1|  unnamed protein product                                178   4e-52   
ref|NP_001062495.1|  Os08g0558600                                       177   7e-52   
ref|XP_001692216.1|  R-SNARE protein, VAMP72-family                     177   8e-52   
ref|XP_006361486.1|  PREDICTED: vesicle-associated membrane prote...    177   1e-51   
ref|XP_004497141.1|  PREDICTED: vesicle-associated membrane prote...    177   1e-51   
ref|XP_004249955.1|  PREDICTED: vesicle-associated membrane prote...    177   1e-51   
ref|XP_006659694.1|  PREDICTED: vesicle-associated membrane prote...    177   1e-51   
ref|XP_009414577.1|  PREDICTED: vesicle-associated membrane prote...    177   1e-51   
ref|XP_010504230.1|  PREDICTED: vesicle-associated membrane prote...    177   2e-51   
ref|XP_006291777.1|  hypothetical protein CARUB_v10017948mg             176   3e-51   
ref|XP_001779971.1|  R-SNARE, VAMP72-family                             176   4e-51   
ref|XP_010515951.1|  PREDICTED: vesicle-associated membrane prote...    176   5e-51   
ref|XP_009116118.1|  PREDICTED: vesicle-associated membrane prote...    175   5e-51   
ref|XP_010088810.1|  Vesicle-associated membrane protein 727            174   6e-51   
gb|AFW70552.1|  putative vesicle-associated membrane protein fami...    174   7e-51   
ref|NP_001136721.1|  uncharacterized protein LOC100216858               175   7e-51   
ref|XP_002959057.1|  hypothetical protein VOLCADRAFT_70298              174   9e-51   
emb|CDX78228.1|  BnaA09g34230D                                          174   1e-50   
ref|XP_003561275.1|  PREDICTED: vesicle-associated membrane prote...    173   4e-50   
gb|EAZ07996.1|  hypothetical protein OsI_30258                          181   7e-50   
ref|XP_001764415.1|  R-SNARE, VAMP72-family                             171   2e-49   
ref|NP_001059291.1|  Os07g0249200                                       171   2e-49   
ref|XP_008667191.1|  PREDICTED: uncharacterized protein LOC100193...    171   4e-49   
gb|EEE69144.1|  hypothetical protein OsJ_28268                          181   7e-49   
ref|XP_002459621.1|  hypothetical protein SORBIDRAFT_02g007620          171   2e-48   
ref|XP_008651494.1|  PREDICTED: vesicle-associated membrane prote...    167   1e-47   
gb|EPS66300.1|  hypothetical protein M569_08477                         163   3e-47   
ref|NP_001150264.1|  vesicle-associated membrane protein 724            166   4e-47   
ref|XP_004955897.1|  PREDICTED: vesicle-associated membrane prote...    164   1e-46   
ref|XP_005648444.1|  R-SNARE protein, VAMP72-family                     159   9e-45   
ref|XP_001777794.1|  R-SNARE, VAMP72-family                             159   1e-44   
gb|ABA99617.1|  Synaptobrevin family protein, expressed                 157   2e-44   
ref|XP_005843431.1|  hypothetical protein CHLNCDRAFT_28123              157   3e-44   
ref|XP_002442624.1|  hypothetical protein SORBIDRAFT_08g023180          155   2e-43   
ref|XP_011396003.1|  Putative vesicle-associated membrane protein...    153   4e-43   
ref|XP_009146727.1|  PREDICTED: vesicle-associated membrane prote...    153   6e-43   
ref|XP_008651495.1|  PREDICTED: vesicle-associated membrane prote...    153   2e-42   
ref|XP_005643794.1|  R-SNARE protein, VAMP72-family                     150   2e-41   
ref|XP_010680955.1|  PREDICTED: vesicle-associated membrane prote...    150   2e-41   
ref|XP_002507800.1|  synaptobrevin like protein                         150   3e-41   
ref|XP_001418265.1|  predicted protein                                  148   8e-41   
emb|CEF98429.1|  Synaptobrevin                                          140   9e-38   
pir||B71423  hypothetical protein - Arabidopsis thaliana                138   1e-37
emb|CDO99425.1|  unnamed protein product                                138   4e-37   
ref|NP_001030968.1|  vesicle-associated membrane protein 7B             137   5e-37   
ref|XP_010326818.1|  PREDICTED: putative vesicle-associated membr...    135   3e-36   
gb|KJB57020.1|  hypothetical protein B456_009G150900                    135   4e-36   
ref|XP_010314763.1|  PREDICTED: putative vesicle-associated membr...    129   1e-33   
ref|XP_006349937.1|  PREDICTED: vesicle-associated membrane prote...    129   1e-33   
gb|AAB80624.1|  Strong similarity to Arabidopsis ATHSAR1 (gb|M904...    127   3e-33   
gb|AFK42000.1|  unknown                                                 127   7e-33   
ref|XP_003062253.1|  predicted protein                                  128   8e-33   
gb|KIZ05558.1|  Vesicle-associated membrane protein                     127   9e-33   
ref|XP_006658441.1|  PREDICTED: vesicle-associated membrane prote...    126   2e-32   
gb|KJB37799.1|  hypothetical protein B456_006G220500                    124   4e-32   



>ref|XP_009604671.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
tomentosiformis]
 ref|XP_009759428.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
sylvestris]
Length=222

 Score =   266 bits (681),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQKALIYAFV RGN +LAE+TDF+GNFNSIA+QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQKALIYAFVGRGNVILAEYTDFSGNFNSIAYQCLQKLPASNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVAEES GRQVP+AFLER+KDDFVSKYGGGKAATAP NSL+KEFGPKL++HMQ
Sbjct  61   DNGFTYCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATAPPNSLNKEFGPKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YCADHP+EISK+AKVKA
Sbjct  121  YCADHPDEISKIAKVKA  137



>ref|XP_009618936.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
tomentosiformis]
Length=222

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQKALIYAFVARGN +LAE+TDF+GNFNSIAFQCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQKALIYAFVARGNVLLAEYTDFSGNFNSIAFQCLQKLPASNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVAEES GRQVP+AFLER+KDDFVSKYGGGKAATA  NSL+KEFGPKL++HM 
Sbjct  61   DNGFTYCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATATPNSLNKEFGPKLKEHMH  120

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKLAKVKA
Sbjct  121  YCADHPEEISKLAKVKA  137



>ref|XP_009802587.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
sylvestris]
Length=222

 Score =   265 bits (676),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQKALIYAFVARGN +L+E+TDF+GNFNSIAFQCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQKALIYAFVARGNVLLSEYTDFSGNFNSIAFQCLQKLPASNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVAEES GRQVP+AFLER+KDDFVSKYGGGKAATA  NSL+KEFGPKL++HM 
Sbjct  61   DNGFTYCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATATPNSLNKEFGPKLKEHMH  120

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKLAKVKA
Sbjct  121  YCADHPEEISKLAKVKA  137



>ref|XP_004233223.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
lycopersicum]
 ref|XP_006362607.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
tuberosum]
Length=222

 Score =   264 bits (675),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQKALIYAFV RGN +LAE+TDF+GNFNSIA+QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQKALIYAFVGRGNVILAEYTDFSGNFNSIAYQCLQKLPASNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVAEES GRQ+P+AFLERIKDDF+SKYG GKAATAP NSL+KEFGPKL++HMQ
Sbjct  61   DNGFTYCVVAEESVGRQIPIAFLERIKDDFMSKYGSGKAATAPPNSLNKEFGPKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YCA+HPEEISKLAKVKA
Sbjct  121  YCAEHPEEISKLAKVKA  137



>ref|XP_007147528.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
 gb|ESW19522.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
Length=221

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 131/137 (96%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ ++LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLP+SNNKFTYNCD HTFNYLV
Sbjct  1    MGQ-RSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPASNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYC+VA+ES GRQVPMAFLER+KDDFVSKYGGGKAATAPANSL+KEFGPKLR+HMQ
Sbjct  60   DNGYTYCIVADESIGRQVPMAFLERVKDDFVSKYGGGKAATAPANSLNKEFGPKLREHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_008225792.1| PREDICTED: vesicle-associated membrane protein 721-like [Prunus 
mume]
Length=221

 Score =   257 bits (656),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ KALIYAFVARG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KALIYAFVARGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES+GRQVP+AFLERIKDDFVSKYGGGKAATAPANSL+KEFG KL++HMQ
Sbjct  60   DNGYTYCVVADESSGRQVPIAFLERIKDDFVSKYGGGKAATAPANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_007212008.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
 gb|EMJ13207.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
Length=221

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 132/137 (96%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFVARG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KSLIYAFVARGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES+GRQVP+AFLERIKDDFVSKYGGGKAATAPANSL+KEFG KL++HMQ
Sbjct  60   DNGYTYCVVADESSGRQVPIAFLERIKDDFVSKYGGGKAATAPANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_007024900.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
 gb|EOY27522.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
Length=162

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVSRGEVILAEYTEFSGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES GRQVP+AFLERIKDDFVSKYG GKAATAPAN L+KEFGPKL++HMQYC 
Sbjct  63   YTYCVVADESAGRQVPIAFLERIKDDFVSKYGSGKAATAPANGLNKEFGPKLKEHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            +HPEEISKLAKVKA
Sbjct  123  EHPEEISKLAKVKA  136



>ref|XP_003535044.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
1 [Glycine max]
 gb|ACJ61478.1| synaptobrevin-related protein [Glycine max]
 gb|KHN22964.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 131/137 (96%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQ-KSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES GRQ+PMAFLER+KD+FVSKYGGGKAATAPANSL+KEFGPKLR+HMQ
Sbjct  60   DNGYTYCVVADESIGRQLPMAFLERVKDEFVSKYGGGKAATAPANSLNKEFGPKLREHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_006448758.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|ESR61998.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|KDO77467.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=175

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARGN VLAE+T+F+GNFNSIA+QCLQKLP+SNNKFTYNCD HTFNYLVDNG
Sbjct  3    QKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES+GRQ+PMAFLER+KD+FVSKYGGGKAATAPAN L+KEFGPKL++ MQYC 
Sbjct  63   YTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>gb|KDO77469.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=160

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARGN VLAE+T+F+GNFNSIA+QCLQKLP+SNNKFTYNCD HTFNYLVDNG
Sbjct  3    QKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES+GRQ+PMAFLER+KD+FVSKYGGGKAATAPAN L+KEFGPKL++ MQYC 
Sbjct  63   YTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>gb|KDO77468.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=186

 Score =   253 bits (645),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARGN VLAE+T+F+GNFNSIA+QCLQKLP+SNNKFTYNCD HTFNYLVDNG
Sbjct  3    QKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES+GRQ+PMAFLER+KD+FVSKYGGGKAATAPAN L+KEFGPKL++ MQYC 
Sbjct  63   YTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>ref|XP_007024899.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY27521.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=221

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVSRGEVILAEYTEFSGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES GRQVP+AFLERIKDDFVSKYG GKAATAPAN L+KEFGPKL++HMQYC 
Sbjct  63   YTYCVVADESAGRQVPIAFLERIKDDFVSKYGSGKAATAPANGLNKEFGPKLKEHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            +HPEEISKLAKVKA
Sbjct  123  EHPEEISKLAKVKA  136



>ref|XP_010242074.1| PREDICTED: vesicle-associated membrane protein 721-like [Nelumbo 
nucifera]
Length=222

 Score =   254 bits (648),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MG QK+LIYAFVARG  VLAE T+F GNFNSIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGGQKSLIYAFVARGTVVLAEFTEFTGNFNSIALQCLQKLPASNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA+E+ GRQVPMAFLERIKDDFVS+YGGGKAATAPANSL+KEFG KL++HMQ
Sbjct  61   EDGYTYCVVADETVGRQVPMAFLERIKDDFVSRYGGGKAATAPANSLNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  121  YCIDHPEEISKLAKVKA  137



>ref|XP_006448759.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 ref|XP_006468428.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR61999.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|KDO77464.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=221

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARGN VLAE+T+F+GNFNSIA+QCLQKLP+SNNKFTYNCD HTFNYLVDNG
Sbjct  3    QKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES+GRQ+PMAFLER+KD+FVSKYGGGKAATAPAN L+KEFGPKL++ MQYC 
Sbjct  63   YTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>gb|KDO77466.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=189

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARGN VLAE+T+F+GNFNSIA+QCLQKLP+SNNKFTYNCD HTFNYLVDNG
Sbjct  3    QKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES+GRQ+PMAFLER+KD+FVSKYGGGKAATAPAN L+KEFGPKL++ MQYC 
Sbjct  63   YTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>gb|KHN14368.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQ-KSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES GRQ+PMAFLER+KD+FV+KYGGGKAATAP NSL+KEFGPKLR+HMQ
Sbjct  60   DNGYTYCVVADESIGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|ACU19359.1| unknown [Glycine max]
Length=221

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQ-KSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+E  GRQ+PMAFLER+KD+FVSKYGGGKAATAPANSL+KEFGPKLR+HMQ
Sbjct  60   DNGYTYCVVADEPIGRQLPMAFLERVKDEFVSKYGGGKAATAPANSLNKEFGPKLREHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_008459063.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=222

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARG  +LAE+T+++GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVARGTVILAEYTEYSGNFNSIAFQCLQKLPTANNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA ES GRQVP+AFLERIKDDFVSKYGGGKA+TAPANSL+KEFG KL++HMQYC 
Sbjct  63   YTYCVVATESAGRQVPIAFLERIKDDFVSKYGGGKASTAPANSLNKEFGSKLKEHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE+SKLAKVKA
Sbjct  123  DHPEEVSKLAKVKA  136



>ref|XP_011016724.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=221

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAF +RG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFASRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA+ES GRQVPMAFLER++DDFVSKYGGGKAATA AN L+KEFGPKL++HM+YCA
Sbjct  63   FTYCVVADESAGRQVPMAFLERVRDDFVSKYGGGKAATAQANGLNKEFGPKLKEHMKYCA  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>gb|KGN66898.1| hypothetical protein Csa_1G707630 [Cucumis sativus]
Length=208

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARG  +LAE+T+++GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVARGTVILAEYTEYSGNFNSIAFQCLQKLPTANNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA ES GRQVP+AFLERIKDDFVSKY GGKA+TAPANSL+KEFG KL++HMQYC 
Sbjct  63   YTYCVVATESAGRQVPIAFLERIKDDFVSKYAGGKASTAPANSLNKEFGSKLKEHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE+SKLAKVKA
Sbjct  123  DHPEEVSKLAKVKA  136



>gb|ACJ84389.1| unknown [Medicago truncatula]
Length=197

 Score =   251 bits (640),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 132/138 (96%), Gaps = 1/138 (1%)
 Frame = +1

Query  148  MGQ-QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYL  324
            MGQ QK+LIYAFV+RG+ +L+E+T+F+GNFNSIAFQCLQKLP+SNNKFTYNCDGHTFNYL
Sbjct  1    MGQNQKSLIYAFVSRGSVILSEYTEFSGNFNSIAFQCLQKLPASNNKFTYNCDGHTFNYL  60

Query  325  VDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHM  504
            VDNG+TYCVVA+E+ GRQVP+AFLER+KDDFV+KYGGGKA+TA  NSL+KEFGPKL++HM
Sbjct  61   VDNGYTYCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHM  120

Query  505  QYCADHPEEISKLAKVKA  558
            QYC DHPEE+SKLAKVKA
Sbjct  121  QYCVDHPEEVSKLAKVKA  138



>ref|XP_006377004.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
 gb|ABK92923.1| unknown [Populus trichocarpa]
 gb|ABK94486.1| unknown [Populus trichocarpa]
 gb|ABK95420.1| unknown [Populus trichocarpa]
 gb|ERP54801.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
Length=221

 Score =   251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFV+RG  +LAE T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYL DNG
Sbjct  3    QKSLIYAFVSRGTVILAEFTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLADNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA+ES GRQVPMAFLER+KDDFVSKYGGGKAATA AN L+KEFGPKL++HM+YCA
Sbjct  63   FTYCVVADESAGRQVPMAFLERVKDDFVSKYGGGKAATAQANGLNKEFGPKLKEHMKYCA  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>ref|XP_002322360.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
 gb|EEF06487.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
Length=219

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFV+RG  +LA++T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVSRGTVILADYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA ES GRQVP+AFLER+KDDFV+KYGGGKAATA AN L+KEFGPKL++HMQYCA
Sbjct  63   FTYCVVAAESAGRQVPIAFLERVKDDFVTKYGGGKAATAQANGLNKEFGPKLKEHMQYCA  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>gb|AFY26886.1| vesicle-associated membrane protein 72 [Morella rubra]
Length=219

 Score =   251 bits (641),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK LIYAFV+RG  VLAE+T+F+GNFNSIA+QCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKPLIYAFVSRGTVVLAEYTEFSGNFNSIAYQCLQKLPATNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES GRQVPMAFLERIKDDF+S+YGGGKA+TAPAN L+KEFGPKL++HM+YC 
Sbjct  63   YTYCVVADESVGRQVPMAFLERIKDDFLSRYGGGKASTAPANGLNKEFGPKLKEHMKYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>ref|XP_008383321.1| PREDICTED: vesicle-associated membrane protein 721-like [Malus 
domestica]
 ref|XP_009353936.1| PREDICTED: vesicle-associated membrane protein 721-like [Pyrus 
x bretschneideri]
Length=221

 Score =   251 bits (641),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ KALIYAFVARG  VLAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KALIYAFVARGTVVLAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES+GRQVP+AFLER+KDDFV+KYG GKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGYTYCVVADESSGRQVPIAFLERVKDDFVAKYGSGKAATAAANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|NP_001236634.1| uncharacterized protein LOC100500089 [Glycine max]
 gb|ACU14879.1| unknown [Glycine max]
Length=221

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQ-KSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES GRQ+PMAFLER+KD+FV+KYGGGKAATAP NSL+KEFGPKLR+HMQ
Sbjct  60   DNGYTYCVVADESFGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_003607843.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|ACJ83853.1| unknown [Medicago truncatula]
 gb|AES90040.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 132/138 (96%), Gaps = 1/138 (1%)
 Frame = +1

Query  148  MGQ-QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYL  324
            MGQ QK+LIYAFV+RG+ +L+E+T+F+GNFNSIAFQCLQKLP+SNNKFTYNCDGHTFNYL
Sbjct  1    MGQNQKSLIYAFVSRGSVILSEYTEFSGNFNSIAFQCLQKLPASNNKFTYNCDGHTFNYL  60

Query  325  VDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHM  504
            VDNG+TYCVVA+E+ GRQVP+AFLER+KDDFV+KYGGGKA+TA  NSL+KEFGPKL++HM
Sbjct  61   VDNGYTYCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHM  120

Query  505  QYCADHPEEISKLAKVKA  558
            QYC DHPEE+SKLAKVKA
Sbjct  121  QYCVDHPEEVSKLAKVKA  138



>gb|AFK40215.1| unknown [Medicago truncatula]
Length=220

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 132/138 (96%), Gaps = 1/138 (1%)
 Frame = +1

Query  148  MGQ-QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYL  324
            MGQ QK+LIYAFV+RG+ +L+E+T+F+GNFNSIAFQCLQKLP+SNNKFTYNCDGHTFNYL
Sbjct  1    MGQNQKSLIYAFVSRGSVILSEYTEFSGNFNSIAFQCLQKLPASNNKFTYNCDGHTFNYL  60

Query  325  VDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHM  504
            VDNG+TYCVVA+E+ GRQVP+AFLER+KDDFV+KYGGGKA+TA  NSL+KEFGPKL++HM
Sbjct  61   VDNGYTYCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHM  120

Query  505  QYCADHPEEISKLAKVKA  558
            QYC DHPEE+SKLAKVKA
Sbjct  121  QYCVDHPEEVSKLAKVKA  138



>ref|XP_004145455.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004165486.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
Length=222

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFVARG  +LAE+T+++GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVARGTVILAEYTEYSGNFNSIAFQCLQKLPTANNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA ES GRQVP+AFLERIKDDFVSKY GGKA+TAPANSL+KEFG KL++HMQYC 
Sbjct  63   YTYCVVATESAGRQVPIAFLERIKDDFVSKYAGGKASTAPANSLNKEFGSKLKEHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE+SKLAKVKA
Sbjct  123  DHPEEVSKLAKVKA  136



>ref|XP_011040378.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFV+RG  +LA++T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLVDNG
Sbjct  3    QKSLIYAFVSRGTVILADYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA ES GRQVP+AFLER+KDDFV+K+GGGKAATA AN L+KEFGPKL++HMQYCA
Sbjct  63   FTYCVVAAESAGRQVPIAFLERVKDDFVTKFGGGKAATAQANGLNKEFGPKLKEHMQYCA  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>ref|XP_010092659.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXB51910.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=221

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFV+RG  +L+E+T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KSLIYAFVSRGTVILSEYTEFSGNFNSIAFQCLQKLPAANNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES GRQVP+AFLER+KDDFVSKYG GKA+TA ANSL+KEFGPKL++HMQ
Sbjct  60   DNGYTYCVVADESVGRQVPLAFLERVKDDFVSKYGAGKASTAAANSLNKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_003594451.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES64702.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK LIYAFV+RG  +LAE T+F+GNFNSIAFQCLQKLPS+NNKFTYNCD HTFNYL+DNG
Sbjct  7    QKQLIYAFVSRGTVILAEFTEFSGNFNSIAFQCLQKLPSTNNKFTYNCDNHTFNYLIDNG  66

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+E+TGRQVPMAFLER+KDDFVSKYGG KA+TAP NSL+KEFGPKL++HMQYC 
Sbjct  67   YTYCVVADETTGRQVPMAFLERVKDDFVSKYGGEKASTAPPNSLNKEFGPKLKEHMQYCV  126

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  127  DHPDEISKLAKVKA  140



>gb|KJB57022.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=175

 Score =   248 bits (632),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
             K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG
Sbjct  3    HKSLIYAFVSRGEVILAEYTEFSGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+E  GRQVP+AFLER+K+DFVSKYG GKAATAPANSL+KEFGPKL++HMQYC 
Sbjct  63   YTYCVVADELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            +HPEEISKLAK+K+
Sbjct  123  EHPEEISKLAKIKS  136



>gb|AFK36461.1| unknown [Lotus japonicus]
Length=226

 Score =   249 bits (636),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK LIYAFV+RG  +LAE T+F+GNFNSIAFQCLQKLPS++NKFTYNCD HTFN+LVDNG
Sbjct  10   QKPLIYAFVSRGTVILAEFTEFSGNFNSIAFQCLQKLPSTSNKFTYNCDAHTFNFLVDNG  69

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYC+VA+ES GRQVPMAFLER+KDDFVSKYG GKAATAPANSL+KEFGPKL++HMQYC 
Sbjct  70   YTYCIVADESVGRQVPMAFLERVKDDFVSKYGDGKAATAPANSLNKEFGPKLKEHMQYCV  129

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  130  DHPEEISKLAKVKA  143



>emb|CDP18918.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   249 bits (636),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 2/137 (1%)
 Frame = +1

Query  154  QQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLP--SSNNKFTYNCDGHTFNYLV  327
            Q+ +LIYAFVARG  VLAEHTDF+GNFNSIA+QCLQKLP  S+NNKFT+NCD HTFNYLV
Sbjct  5    QKSSLIYAFVARGPVVLAEHTDFSGNFNSIAYQCLQKLPANSNNNKFTFNCDAHTFNYLV  64

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVAEES GRQ+P+AFLER+KDDFVSKYGGGKA TAPAN L+KEFGPKL+DHM+
Sbjct  65   DNGFTYCVVAEESAGRQIPIAFLERVKDDFVSKYGGGKATTAPANGLNKEFGPKLKDHMK  124

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  125  YCMDHPEEISKLAKVKA  141



>ref|XP_004505324.1| PREDICTED: vesicle-associated membrane protein 722-like [Cicer 
arietinum]
Length=222

 Score =   248 bits (634),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIYAFV+RG+ +LAE T+F+GNFNSIAFQCLQKLP+SNNKFTYNCDGHTFNYLVDNG
Sbjct  7    QKSLIYAFVSRGSVILAEFTEFSGNFNSIAFQCLQKLPASNNKFTYNCDGHTFNYLVDNG  66

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+ES GRQVP+AFLER+KDDFV KYGGGKA+TA  NSL+KEFGPKL++HMQYC 
Sbjct  67   YTYCVVADESVGRQVPVAFLERVKDDFVVKYGGGKASTAAPNSLNKEFGPKLKEHMQYCV  126

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  127  DHPEEISKLAKVKA  140



>gb|KJB69906.1| hypothetical protein B456_011G049200 [Gossypium raimondii]
 gb|KJB69907.1| hypothetical protein B456_011G049200 [Gossypium raimondii]
Length=157

 Score =   246 bits (628),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  160  KALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGF  339
            K+LIYAFV+RG  +LAE+T+++GNFNSIA QCLQKLPSSNNKFTYNCDGHTFNYLVDNG+
Sbjct  4    KSLIYAFVSRGGVILAEYTEYSGNFNSIALQCLQKLPSSNNKFTYNCDGHTFNYLVDNGY  63

Query  340  TYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  519
            TYCVVA+ES GRQVP+AFLERIKDDFVSKY  GKAATAPANSL+KEFGPKL++HMQYC +
Sbjct  64   TYCVVADESAGRQVPIAFLERIKDDFVSKYDNGKAATAPANSLNKEFGPKLKEHMQYCME  123

Query  520  HPEEISKLAKVKA  558
            HPEEISKLAKVKA
Sbjct  124  HPEEISKLAKVKA  136



>gb|KHN08022.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 130/140 (93%), Gaps = 3/140 (2%)
 Frame = +1

Query  148  MGQ---QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFN  318
            MGQ   Q++LIYAFV+RG  +LAE+T+F+GNFN+IAFQCLQKLP+SNNKFTYNCDGHTFN
Sbjct  1    MGQDQNQRSLIYAFVSRGTVILAEYTEFSGNFNTIAFQCLQKLPASNNKFTYNCDGHTFN  60

Query  319  YLVDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRD  498
            YLVDNGFTYCVVA+ES GRQVP+AFLER+KDDFV+KYGGGKAAT  ANSL+KEFG KL++
Sbjct  61   YLVDNGFTYCVVADESIGRQVPVAFLERVKDDFVAKYGGGKAATVAANSLNKEFGSKLKE  120

Query  499  HMQYCADHPEEISKLAKVKA  558
            HMQYC +HPEEISKLAKVKA
Sbjct  121  HMQYCVEHPEEISKLAKVKA  140



>gb|AFK47779.1| unknown [Medicago truncatula]
Length=219

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK LIYAFV+RG  +LAE T+F+GNFNSIAFQCLQKLPS+NNKFTYNCD HTFNYL+DNG
Sbjct  7    QKQLIYAFVSRGTVILAEFTEFSGNFNSIAFQCLQKLPSTNNKFTYNCDNHTFNYLIDNG  66

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            +TYCVVA+E+TGRQVPMAFLER+KDDFVSKYGG KA+TAP NSL+KEFGPKL++HMQYC 
Sbjct  67   YTYCVVADETTGRQVPMAFLERVKDDFVSKYGGEKASTAPPNSLNKEFGPKLKEHMQYCV  126

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  127  DHPDEISKLAKVKA  140



>ref|XP_002530145.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF32237.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=221

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 128/137 (93%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MG+ K+LIYAFV+RG  VLAE+T+F+GNFNSIAFQCLQKLPS+NNKFTYNCD HTFN+LV
Sbjct  1    MGE-KSLIYAFVSRGTVVLAEYTEFSGNFNSIAFQCLQKLPSTNNKFTYNCDAHTFNFLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA+ES GRQVPMAFLERIK+DF+++YG GKAATAPANSL KEFGPKL++HMQ
Sbjct  60   DNGFTYCVVADESAGRQVPMAFLERIKEDFMARYGNGKAATAPANSLDKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK AKVKA
Sbjct  120  YCVDHPEEISKFAKVKA  136



>gb|KJB57019.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=222

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  160  KALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGF  339
            K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG+
Sbjct  4    KSLIYAFVSRGEVILAEYTEFSGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGY  63

Query  340  TYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  519
            TYCVVA+E  GRQVP+AFLER+K+DFVSKYG GKAATAPANSL+KEFGPKL++HMQYC +
Sbjct  64   TYCVVADELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCVE  123

Query  520  HPEEISKLAKVKA  558
            HPEEISKLAK+K+
Sbjct  124  HPEEISKLAKIKS  136



>gb|KHG23670.1| vesicle-associated membrane protein [Gossypium arboreum]
Length=241

 Score =   248 bits (632),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF  IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFTGNFTGIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVPMAFLERIK+DF  +YGGGKAA+APANSLSKEFGPKL++HMQ
Sbjct  60   DNGFTYCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAASAPANSLSKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>gb|KJB69905.1| hypothetical protein B456_011G049200 [Gossypium raimondii]
Length=222

 Score =   246 bits (629),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  160  KALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGF  339
            K+LIYAFV+RG  +LAE+T+++GNFNSIA QCLQKLPSSNNKFTYNCDGHTFNYLVDNG+
Sbjct  4    KSLIYAFVSRGGVILAEYTEYSGNFNSIALQCLQKLPSSNNKFTYNCDGHTFNYLVDNGY  63

Query  340  TYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  519
            TYCVVA+ES GRQVP+AFLERIKDDFVSKY  GKAATAPANSL+KEFGPKL++HMQYC +
Sbjct  64   TYCVVADESAGRQVPIAFLERIKDDFVSKYDNGKAATAPANSLNKEFGPKLKEHMQYCME  123

Query  520  HPEEISKLAKVKA  558
            HPEEISKLAKVKA
Sbjct  124  HPEEISKLAKVKA  136



>gb|KDP29315.1| hypothetical protein JCGZ_19410 [Jatropha curcas]
Length=221

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQ-KSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES GRQVPMAFLERIK+DF++KYG GKA TA ANSL KEFGPKL++HMQ
Sbjct  60   DNGYTYCVVADESAGRQVPMAFLERIKEDFMAKYGNGKATTAVANSLDKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_007049803.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
 gb|EOX93960.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
Length=219

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGF+YCVVA ES GRQVP+AFLERIK+DF   YGGGKAATAPANSLS+EFGPKL++HMQ
Sbjct  60   DNGFSYCVVAIESVGRQVPIAFLERIKEDFTKIYGGGKAATAPANSLSREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>ref|XP_011096786.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=226

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 4/141 (3%)
 Frame = +1

Query  148  MGQ--QKALIYAFVARGN--AVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTF  315
            MGQ  +K LIYA VARG+   VLAE+T+F+GNFNSIAFQCLQKLPSSNNKFTYNCD HTF
Sbjct  1    MGQNSRKTLIYALVARGSPPVVLAEYTEFSGNFNSIAFQCLQKLPSSNNKFTYNCDNHTF  60

Query  316  NYLVDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLR  495
            NYLV +GFTYCVVAEES GRQVPMAFL+RIKDDFV+KYGGGKAATAPAN L+KEFGPKL+
Sbjct  61   NYLVHDGFTYCVVAEESVGRQVPMAFLDRIKDDFVAKYGGGKAATAPANGLNKEFGPKLK  120

Query  496  DHMQYCADHPEEISKLAKVKA  558
            +HMQYC +HPEEISKLAKVKA
Sbjct  121  EHMQYCIEHPEEISKLAKVKA  141



>ref|XP_009588661.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
tomentosiformis]
Length=220

 Score =   244 bits (622),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL++EFGPK+++ MQ
Sbjct  60   DNGFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNREFGPKMKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCIDHPEEISKLAKVKA  136



>ref|XP_006583934.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
 gb|KHN42974.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 3/140 (2%)
 Frame = +1

Query  148  MGQ---QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFN  318
            MGQ   Q++LIYAFV+RG  +LAE+T+F+GNFN+IAFQCLQKLP+SNNKFTYNCDGHTFN
Sbjct  1    MGQDQNQRSLIYAFVSRGTVILAEYTEFSGNFNTIAFQCLQKLPASNNKFTYNCDGHTFN  60

Query  319  YLVDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRD  498
            YLVDN FTYCVVA+ES GRQVP+AFLER KDDFV+KYGGGKA TA ANSL+KEFG KL++
Sbjct  61   YLVDNEFTYCVVADESIGRQVPVAFLERAKDDFVAKYGGGKATTAAANSLNKEFGSKLKE  120

Query  499  HMQYCADHPEEISKLAKVKA  558
            HMQYC +HPEEISKLAKVKA
Sbjct  121  HMQYCVEHPEEISKLAKVKA  140



>ref|XP_006352702.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Solanum tuberosum]
Length=220

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL+KEFGPK++D MQ
Sbjct  60   DDGFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKIKDQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_009787803.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
sylvestris]
Length=220

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL++EFGPK+++ MQ
Sbjct  60   DNGFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNREFGPKMKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCIDHPEEISKLAKVKA  136



>ref|XP_008235502.1| PREDICTED: vesicle-associated membrane protein 722 [Prunus mume]
Length=219

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQ+P+AFLERIK+DF S+YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAIGRQIPIAFLERIKEDFTSRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_004242395.1| PREDICTED: vesicle-associated membrane protein 721-like [Solanum 
lycopersicum]
Length=220

 Score =   241 bits (614),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL+KEFGPK+++ MQ
Sbjct  60   DDGFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKIKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|AAQ15287.1| synptobrevin-related protein [Pyrus pyrifolia]
Length=194

 Score =   240 bits (612),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|NP_001280954.1| putative vesicle-associated membrane protein 726 [Malus domestica]
 gb|AGG35508.1| vesicle-associated membrance protein [Malus domestica]
Length=219

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVVLAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|KJB10140.1| hypothetical protein B456_001G186000 [Gossypium raimondii]
Length=219

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF  IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTMVLADYTEFTGNFTGIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAATA ANSLSKEFGPKL++HM+
Sbjct  60   DNGYTYCVVAVESVGRQVPIAFLERIKEDFTKRYGGGKAATASANSLSKEFGPKLKEHME  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>ref|XP_010069066.1| PREDICTED: putative vesicle-associated membrane protein 726 [Eucalyptus 
grandis]
Length=219

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA ANSL++EFGPKL++HMQ
Sbjct  60   ENGFTYCVVAAESAGRQIPIAFLERIKDDFNKRYGGGKATTAAANSLNREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|KHG28831.1| Vesicle-associated membrane protein [Gossypium arboreum]
Length=252

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF  IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTMVLADYTEFTGNFTGIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAATA ANSLSKEFGPKL++HM+
Sbjct  60   DNGYTYCVVAVESVGRQVPIAFLERIKEDFTKRYGGGKAATASANSLSKEFGPKLKEHME  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>ref|XP_006443628.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 ref|XP_006479311.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR56868.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 gb|KDO65900.1| hypothetical protein CISIN_1g027720mg [Citrus sinensis]
Length=219

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQVP+AFLER+K+DF+ +YGGGKAATA AN L+KEFGPKL++HMQ
Sbjct  60   DDGFTYCVVAVESVGRQVPIAFLERVKEDFIKRYGGGKAATAVANGLNKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCIDHPEEISKLAKVKA  136



>ref|XP_002276767.1| PREDICTED: putative vesicle-associated membrane protein 726 [Vitis 
vinifera]
 emb|CAN81365.1| hypothetical protein VITISV_015772 [Vitis vinifera]
 emb|CBI27181.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 126/136 (93%), Gaps = 1/136 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFVARG  +LAE+T+F+GNFNSIAFQCLQKLP+++NKFTYNCD HTF YL+
Sbjct  1    MGQ-KSLIYAFVARGTVILAEYTEFSGNFNSIAFQCLQKLPATSNKFTYNCDAHTFTYLL  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES GRQVPMAFLERI+DDFV++YGG KAATAPANSL+K+F  KL++HMQ
Sbjct  60   DNGYTYCVVADESVGRQVPMAFLERIRDDFVARYGGEKAATAPANSLNKDFSSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVK  555
            YC DHPEEISKLAKVK
Sbjct  120  YCVDHPEEISKLAKVK  135



>ref|XP_010522412.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLVDNG
Sbjct  3    QQSLIYSFVARGTVILAEYTEFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAADSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>ref|XP_010522416.1| PREDICTED: vesicle-associated membrane protein 725 [Tarenaya 
hassleriana]
Length=220

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_007200441.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
 gb|EMJ01640.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
Length=159

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAIGRQIPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_007200442.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
 gb|EMJ01641.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
Length=219

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAIGRQIPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009371395.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009371400.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=219

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|XP_010109710.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXC24180.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=219

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVVLAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+KEFGPKL++HMQ
Sbjct  60   DDGFTYCVVAVEAVGRQIPIAFLERIKEDFTKRYGGGKAATAVANSLNKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLA VKA
Sbjct  120  YCIDHPEEISKLANVKA  136



>ref|XP_006306317.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
 gb|EOA39215.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
Length=220

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKL+KVKA
Sbjct  120  YCADHPEEISKLSKVKA  136



>ref|XP_009119258.1| PREDICTED: vesicle-associated membrane protein 721 [Brassica 
rapa]
 emb|CDX89793.1| BnaA10g02890D [Brassica napus]
Length=220

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MAQQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  61   EDGFTYCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>emb|CDY18254.1| BnaC05g02770D [Brassica napus]
Length=220

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MSQQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  61   EDGFTYCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>gb|KDP26403.1| hypothetical protein JCGZ_17561 [Jatropha curcas]
Length=219

 Score =   239 bits (609),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEFTEFTGNFTSIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVP+AFLERIK+DF  KY GGKAATA AN L+KEFGPKL++HMQ
Sbjct  60   DNGFTYCVVAVESVGRQVPIAFLERIKEDFTKKYAGGKAATAVANGLNKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_010556950.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   239 bits (609),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFMGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_008380599.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
 ref|XP_009376355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   239 bits (609),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG+ +LAE+T+F GNF +IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGSVILAEYTEFTGNFTTIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L++EFGPKL+DHM+
Sbjct  60   ENGFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNREFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_002264270.1| PREDICTED: vesicle-associated membrane protein 721 [Vitis vinifera]
 emb|CBI40837.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   239 bits (609),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M  Q++LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MVGQQSLIYSFVARGTVILAEYTEFTGNFTSIAAQCLQKLPASNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGKAATA AN L+KEFGPKL++HMQ
Sbjct  61   ENGFTYCVVAVESAGRQIPIAFLERVKDDFNKRYGGGKAATAVANGLNKEFGPKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  121  YCVDHPEEISKLAKVKA  137



>ref|XP_002889523.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65782.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   239 bits (609),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKL+KVKA
Sbjct  120  YCADHPEEISKLSKVKA  136



>ref|XP_008372458.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
Length=219

 Score =   238 bits (608),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEAVGRQVPIAFLERIKEDFXGRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>gb|KDO49381.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
Length=184

 Score =   237 bits (605),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>emb|CDY19450.1| BnaC04g11490D [Brassica napus]
Length=223

 Score =   238 bits (608),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  154  QQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDN  333
            QQ++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+N
Sbjct  4    QQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEN  63

Query  334  GFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYC  513
            GFTYCVVA +S GRQ+PMAFLER+KDDF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  64   GFTYCVVAVDSAGRQIPMAFLERVKDDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  123

Query  514  ADHPEEISKLAKVKA  558
             DHP+EISKLAKVKA
Sbjct  124  MDHPDEISKLAKVKA  138



>emb|CDX79510.1| BnaC03g18460D [Brassica napus]
Length=222

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ +LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MSQQSSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  61   ENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>ref|XP_002521112.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF41263.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=220

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LA++T+F GNF  IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILADYTEFTGNFTGIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVP+AFLERIK++F  KYGGGKAATA ANSL+KEFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESVGRQVPIAFLERIKEEFTKKYGGGKAATATANSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_009351028.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG+ VLAE+T+F GNF +IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-YLIYSFVARGSMVLAEYTEFTGNFTTIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L++EFGPKL+DHM+
Sbjct  60   ENGFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNREFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_007034424.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY05350.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=219

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTMILAEYTEFTGNFTSIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|KDP20321.1| hypothetical protein JCGZ_06407 [Jatropha curcas]
Length=219

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KSLIYSFVARGTVILAEYTEFTGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA +S GRQ+P+AFLER+K+DF  +YGGGKAATA AN L +EFGPKL++HMQ
Sbjct  60   ENGFTYCVVAVDSAGRQIPIAFLERVKEDFKKRYGGGKAATAQANGLKREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCMDHPEEISKLAKVKA  136



>ref|XP_007034425.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
 gb|EOY05351.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
Length=219

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTMILAEYTEFTGNFTSIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009132911.1| PREDICTED: vesicle-associated membrane protein 722-like [Brassica 
rapa]
 emb|CDX84702.1| BnaA03g15280D [Brassica napus]
Length=222

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ +LIY+FVARG  +L E TDF GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MAQQSSLIYSFVARGTVILVEFTDFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  61   ENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>ref|XP_010932918.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=220

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCD HTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPSSNNKFTYNCDSHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFGPKL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|NP_171968.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
 sp|Q9MAS5.2|VA726_ARATH RecName: Full=Putative vesicle-associated membrane protein 726; 
Short=AtVAMP726 [Arabidopsis thaliana]
 gb|AEE27740.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
Length=220

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKL+KVKA
Sbjct  120  YCADHPEEISKLSKVKA  136



>ref|XP_009413307.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNFNSIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFSGNFNSIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA ES GRQ+P+AFLER+K+DF  KYG GKAATA ANSLS+EFG KL++HMQ
Sbjct  60   EDGYTYCVVAVESVGRQIPIAFLERVKEDFNKKYGAGKAATASANSLSREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin homolog F25I18.14 gi|2924792 
from A. thaliana on BAC gb|AC002334 [Arabidopsis thaliana]
Length=229

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKL+KVKA
Sbjct  120  YCADHPEEISKLSKVKA  136



>gb|KHM99990.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=232

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE+++F+GNFN+IA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTMVLAEYSEFSGNFNTIASQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+KD+F  KYGGGKAATA ANSL++EFGPKL+  MQ
Sbjct  60   ENGFTYCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|EYU43691.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
 gb|EYU43692.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
Length=226

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = +1

Query  157  QKALIYAFVARGN--AVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVD  330
            +K LIYA VARG+   VL+E+T+F+GNFNSIA+QCLQKLPSSNNKFTYNCD HTFNYLV 
Sbjct  6    RKTLIYALVARGSPPVVLSEYTEFSGNFNSIAYQCLQKLPSSNNKFTYNCDNHTFNYLVH  65

Query  331  NGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQY  510
            +GFTYC+VAEES GRQ+PMAFLERIKD+FV+KYGGGKAAT PAN L+KEFGPKL++HMQY
Sbjct  66   DGFTYCIVAEESAGRQLPMAFLERIKDNFVAKYGGGKAATTPANGLNKEFGPKLKEHMQY  125

Query  511  CADHPEEISKLAKVKA  558
            C DHPEEISKLAKV+A
Sbjct  126  CMDHPEEISKLAKVQA  141



>ref|XP_003556884.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
Length=221

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE+++F+GNFN+IA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTMVLAEYSEFSGNFNTIASQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+KD+F  KYGGGKAATA ANSL++EFGPKL+  MQ
Sbjct  60   ENGFTYCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_006418096.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
 gb|ESQ36449.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
Length=220

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCL KLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVAAQCLHKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL+ HMQ
Sbjct  60   DNGFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKAATAKANSLNKEFGSKLKQHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_006420620.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006420621.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006489783.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Citrus sinensis]
 gb|ESR33860.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|ESR33861.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|KDO49379.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
 gb|KDO49380.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
Length=219

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010264069.1| PREDICTED: vesicle-associated membrane protein 722 [Nelumbo nucifera]
Length=219

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE+T+F GNF SIA QCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVVLAEYTEFTGNFTSIAAQCLQKLPATNNKFTYNCDSHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGKAATA ANSL+KEFGPKL++HMQ
Sbjct  60   ENGFTYCVVAVESVGRQIPVAFLERVKDDFNKRYGGGKAATAVANSLNKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+ KLAKVKA
Sbjct  120  YCVDHPEEVGKLAKVKA  136



>ref|XP_009370116.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG+ VLAE+T+F GNF +IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-YLIYSFVARGSMVLAEYTEFTGNFTTIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L+ EFGPKL+DHM+
Sbjct  60   ENGFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNSEFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_009143895.1| PREDICTED: vesicle-associated membrane protein 722 [Brassica 
rapa]
 emb|CDY17139.1| BnaA05g10490D [Brassica napus]
Length=223

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  154  QQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDN  333
            QQ++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+N
Sbjct  4    QQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEN  63

Query  334  GFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYC  513
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  64   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  123

Query  514  ADHPEEISKLAKVKA  558
             DHP+EISKLAKVKA
Sbjct  124  MDHPDEISKLAKVKA  138



>emb|CDP03855.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLERIK+DF  KYGGGKAATA ANSL++EFGPKL++ MQ
Sbjct  60   EDGFTYCVVAVESVGRQLPIAFLERIKEDFTKKYGGGKAATAVANSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|XP_004290222.1| PREDICTED: vesicle-associated membrane protein 722 [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE T+F GNF  IA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEFTEFTGNFTGIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQVP+AFLERIK+DF ++YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVAVEALGRQVPIAFLERIKEDFTNRYGGGKAATAVANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010556949.1| PREDICTED: vesicle-associated membrane protein 721 [Tarenaya 
hassleriana]
Length=220

 Score =   236 bits (602),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L+E T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILSEFTEFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAADSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHPEEISKLAKVKA
Sbjct  123  DHPEEISKLAKVKA  136



>ref|XP_010457534.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL++EFG KL++HMQ
Sbjct  60   DNGFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKL+KVKA
Sbjct  120  YCADHPEEISKLSKVKA  136



>ref|XP_009335952.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
Length=220

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG+ VLAE+T+F GNF +IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-YLIYSFVARGSMVLAEYTEFTGNFTTIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L  EFGPKL+DHM+
Sbjct  60   ENGFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLPSEFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|ADK78986.1| VAMP721 [Petunia integrifolia subsp. inflata]
Length=220

 Score =   236 bits (601),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F+GNFN+IA QCLQKLP+SNN+FTYNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFSGNFNTIASQCLQKLPASNNRFTYNCDGHTFNFLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKAATA A SL+KEFGPKL++HM+
Sbjct  60   ENGFTYCVVATESAGRQIPIAFLERIKDDFTKRYGGGKAATATAKSLNKEFGPKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEISKLAKVKA
Sbjct  120  YCVEHPEEISKLAKVKA  136



>emb|CDY10053.1| BnaC08g43980D [Brassica napus]
Length=220

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ++LIY+FVARG  +L E TDF GNF S+A QCLQKLPSSNNKFTY CDGHTF+YLV
Sbjct  1    MAQQQSLIYSFVARGTVILVEFTDFKGNFTSVAAQCLQKLPSSNNKFTYTCDGHTFSYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  61   EDGFTYCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSLNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>gb|KFK42811.1| hypothetical protein AALP_AA1G041700 [Arabis alpina]
Length=220

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVVIESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_002879406.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55665.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQN-LIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  120  YCVDHPDEISKLAKVKA  136



>gb|KFK31144.1| hypothetical protein AALP_AA6G074500 [Arabis alpina]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+K++F  +YGGGKA TA ANSL+KEFG KL+DHMQ
Sbjct  60   ENGFTYCVVAIESVGRQIPMAFLERVKEEFNKRYGGGKATTAKANSLNKEFGSKLKDHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KL+KVKA
Sbjct  120  YCVDHPEEINKLSKVKA  136



>ref|XP_011080177.1| PREDICTED: vesicle-associated membrane protein 721 [Sesamum indicum]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  KYGGGKAATA ANSL++EFGPKL++ MQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLERVKEDFTKKYGGGKAATAVANSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_004247095.1| PREDICTED: vesicle-associated membrane protein 722 [Solanum lycopersicum]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            + GFTYCVVA ES GRQ+P+AFLER K++F  KYGGGKAATA ANSL++EFGPKL++ MQ
Sbjct  60   EEGFTYCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009627066.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
tomentosiformis]
 ref|XP_009777065.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
sylvestris]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER K++F  KYGGGKAATA ANSL++EFGPKL++ MQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009118621.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ++LIY+FVARG  +LAE TDF GNF S+A QCLQKLPSSNNKFTY CDGHTFNYLV
Sbjct  1    MAQQQSLIYSFVARGTVILAEFTDFKGNFTSVAAQCLQKLPSSNNKFTYTCDGHTFNYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANS +KEFG KL++HMQ
Sbjct  61   EDGFTYCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSFNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>ref|XP_006857408.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
 gb|ERN18875.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
Length=217

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ PMAFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQAPMAFLERVKEDFNKRYGGGKAATAVANSLNREFGTKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEMSKLAKVKA  136



>ref|XP_010413966.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQN-LIYSFVARGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQ
Sbjct  60   VNGFTYCVVAVESVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCMDHPEEISKLAKVKA  136



>ref|XP_006364264.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=220

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            + GFTYCVVA ES GRQ+P+AFLER K++F  KYGGGKAATA ANSL++EFGPKL++ MQ
Sbjct  60   EEGFTYCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|KFK31080.1| hypothetical protein AALP_AA6G065800 [Arabis alpina]
Length=221

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCI  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_010413912.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X1 [Camelina sativa]
Length=221

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_010241141.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nelumbo 
nucifera]
Length=219

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLP+SNNKFTYNCD HTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTSVASQCLQKLPASNNKFTYNCDNHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGK  TA A SL+KEFGPKL+ HMQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKDDFSKRYGGGKGTTASAKSLNKEFGPKLKQHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010475140.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKL+KVKA
Sbjct  120  YCADHPEEISKLSKVKA  136



>ref|XP_010509926.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
 ref|XP_010413909.1| PREDICTED: vesicle-associated membrane protein 722 isoform X1 
[Camelina sativa]
 ref|XP_010413910.1| PREDICTED: vesicle-associated membrane protein 722 isoform X2 
[Camelina sativa]
 ref|XP_010469516.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
Length=221

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>gb|KEH41273.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F+GNF++IA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTMILAEYTEFSGNFSTIASQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLER+K++F  KYGGGKAATA A SL+KE+GPKL+  MQ
Sbjct  60   DNGFTYCVVAVESAGRQIPIAFLERVKEEFSKKYGGGKAATASARSLNKEYGPKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_008234811.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=221

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG+ +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGSVILAEYTEFTGNFTSIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LER+KDDF  +Y GGKA TA AN L++EFGPKL+DHM+
Sbjct  60   ENGFTYCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCLDHPEEINKLAKVKA  136



>ref|NP_180871.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 sp|P47192.2|VA722_ARATH RecName: Full=Vesicle-associated membrane protein 722; Short=AtVAMP722; 
AltName: Full=Synaptobrevin-related protein 1 [Arabidopsis 
thaliana]
 gb|AAL31896.1|AF419564_1 At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAC04921.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL62414.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL79587.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAM48025.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM64431.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM91096.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AEC08787.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=221

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_008775432.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=220

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCD HTFN+LV
Sbjct  1    MGQQ-TLIYSFVARGAVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDSHTFNFLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFGPKL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>emb|CDX86608.1| BnaC08g00950D [Brassica napus]
Length=219

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_007226125.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
 gb|EMJ27324.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
Length=220

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG+ +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGSVILAEYTEFTGNFTSIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LER+KDDF  +Y GGKA TA AN L++EFGPKL+DHM+
Sbjct  60   ENGFTYCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_010069661.1| PREDICTED: vesicle-associated membrane protein 722 [Eucalyptus 
grandis]
 gb|KCW58076.1| hypothetical protein EUGRSUZ_H00803 [Eucalyptus grandis]
Length=220

 Score =   234 bits (597),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LA++T+F GNF S+AFQCLQKLP++NNKFTY+CDGHTFN+LV
Sbjct  1    MGQQ-SLIYSFVARGTVILADYTEFTGNFTSVAFQCLQKLPATNNKFTYSCDGHTFNFLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQVP+AFLER+KDDF  +YGGGKAATA A SL+KEFG KL++ MQ
Sbjct  60   DDGFTYCVVAVESVGRQVPIAFLERVKDDFTKRYGGGKAATAVAKSLNKEFGSKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_006410450.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
 gb|ESQ51903.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
Length=221

 Score =   234 bits (597),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+F+ARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFIARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>gb|AFK34145.1| unknown [Lotus japonicus]
Length=197

 Score =   233 bits (594),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+TDFNGNF SIA QCLQKLP+SN KFTYNCDGHTF+YLV
Sbjct  1    MGQQ-SLIYSFVARGTLILAEYTDFNGNFTSIALQCLQKLPASNKKFTYNCDGHTFSYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES G+Q+PMAFLERIK+DF  KY GG+A+TA A SL+KEFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESFGQQIPMAFLERIKEDFTKKYAGGRASTAAAKSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEE++KLAKVKA
Sbjct  120  YCVEHPEEVNKLAKVKA  136



>gb|AFK39584.1| unknown [Lotus japonicus]
Length=191

 Score =   233 bits (594),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  VLAE T+F+GNF SIA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTMVLAEFTEFSGNFTSIACQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K++F  KYGGGKAATA  +SL+KEFGPKL+  MQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEEFSKKYGGGKAATASTHSLNKEFGPKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_011083121.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=220

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLERIKDDF  KYGGGKAATA ANSL++EFG KL++ MQ
Sbjct  60   EDGFTYCVVAVESVGRQLPIAFLERIKDDFTKKYGGGKAATAVANSLNREFGSKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|EYU46345.1| hypothetical protein MIMGU_mgv1a013442mg [Erythranthe guttata]
Length=220

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +L+E+T+F GNF  IA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILSEYTEFTGNFTGIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+A+LERIK+DF  KYGGGKAATA ANSL+KEFGPKL++ MQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAYLERIKEDFTKKYGGGKAATAVANSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|XP_006410397.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
 gb|ESQ51850.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
Length=248

 Score =   235 bits (599),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  50   MGQQN-LIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  108

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL++EFG KL++HMQ
Sbjct  109  ENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQPNSLNREFGSKLKEHMQ  168

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  169  YCVDHPEEISKLAKVKA  185



>emb|CDY06150.1| BnaA09g50530D [Brassica napus]
Length=220

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M QQ++LIY+FVARG  +LAE TDF GNF S+A QCLQKLPSSNNKFTY CDGHTF+YLV
Sbjct  1    MAQQQSLIYSFVARGTVILAEFTDFKGNFTSVAAQCLQKLPSSNNKFTYTCDGHTFSYLV  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANS +KEFG KL++HMQ
Sbjct  61   EDGFTYCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSFNKEFGSKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  121  YCMDHPDEISKLAKVKA  137



>ref|XP_002267063.1| PREDICTED: vesicle-associated membrane protein 722 [Vitis vinifera]
 emb|CBI37278.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE T+F+GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEFTEFSGNFTSIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL+KEFGPKL++ MQ
Sbjct  60   EDGYTYCVVAVEAVGRQIPIAFLERVKEDFTKRYGGGKAATAVANSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_008224587.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=220

 Score =   233 bits (595),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG+ +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGSVILAEYTEFTGNFTSIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+A+LER+KDDF  +Y GGKA TA AN L++EFGPKL+DHM+
Sbjct  60   ENGFTYCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCLDHPEEINKLAKVKA  136



>ref|XP_008438380.1| PREDICTED: putative vesicle-associated membrane protein 726 [Cucumis 
melo]
Length=219

 Score =   233 bits (595),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAVEAAGRQIPIAFLERVKEDFNKRYGGGKAATAVAHSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCLDHPEEISKLAKVKA  136



>ref|XP_011016158.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   233 bits (595),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LA++TDF+GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILADYTDFSGNFASIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGF+YCVVA ES GRQ+P+A+LERIK+DF ++YGGGKAA A ANSL++EFGPKL++ MQ
Sbjct  60   DNGFSYCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCMDHPEEVSKLAKVKA  136



>ref|XP_006294968.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
 gb|EOA27866.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
Length=221

 Score =   233 bits (595),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMA+LER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAYLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_002518125.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF44258.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=219

 Score =   233 bits (595),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA A+ L++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAQAHGLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|KJB33093.1| hypothetical protein B456_006G056000 [Gossypium raimondii]
Length=174

 Score =   232 bits (591),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNFN+IA QCLQKLP+S+N+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFSGNFNTIAAQCLQKLPASSNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAA A A SL++EFG KL+ HM+
Sbjct  60   DNGFTYCVVATESAGRQIPIAFLERVKEDFSKRYGGGKAANAKAKSLNREFGSKLKAHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YCA+HPEEISKLAKVKA
Sbjct  120  YCAEHPEEISKLAKVKA  136



>gb|KCW57284.1| hypothetical protein EUGRSUZ_H00084 [Eucalyptus grandis]
Length=378

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  160  MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLV  218

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA ANSL++EFGPKL++HMQ
Sbjct  219  ENGFTYCVVAAESAGRQIPIAFLERIKDDFNKRYGGGKATTAAANSLNREFGPKLKEHMQ  278

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  279  YCVDHPEEISKLAKVKA  295



>ref|XP_006304190.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 ref|XP_006418097.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
 ref|XP_010484183.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 ref|XP_010457533.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 gb|EOA37088.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 gb|ESQ36450.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
Length=219

 Score =   233 bits (594),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_002892239.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68498.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   233 bits (594),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_011020670.1| PREDICTED: vesicle-associated membrane protein 721 isoform X2 
[Populus euphratica]
Length=192

 Score =   232 bits (592),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTGIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|AAC04496.1| putative synaptobrevin [Arabidopsis thaliana]
Length=220

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +L E+T+F GNF ++A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQN-LIYSFVARGTVILVEYTEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQ
Sbjct  60   ENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EISKLAKVKA
Sbjct  120  YCVDHPDEISKLAKVKA  136



>ref|XP_002304708.1| synptobrevin-related family protein [Populus trichocarpa]
 gb|EEE79687.1| synptobrevin-related family protein [Populus trichocarpa]
Length=219

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTGIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_006293513.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
 gb|EOA26411.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
Length=220

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQN-LIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA A SL++EFG KL++HMQ
Sbjct  60   VNGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQAKSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_011020669.1| PREDICTED: vesicle-associated membrane protein 721 isoform X1 
[Populus euphratica]
Length=219

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFKGNFTGIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009621355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNFNSIA QCLQKLP+SNN+FTYNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFNSIASQCLQKLPASNNRFTYNCDGHTFNFLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA A SL+KEFGPKL++HM+
Sbjct  60   ENGFTYCVVATESAGRQIPIAFLERIKDDFSKRYGGGKATTATAKSLNKEFGPKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEI+KLAKVKA
Sbjct  120  YCVEHPEEINKLAKVKA  136



>ref|XP_008371850.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_008371869.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_009357270.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
 ref|XP_009378895.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
Length=221

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ KALIYAFVARG  VLAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KALIYAFVARGTVVLAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNG+TYCVVA+ES+GRQVP+AFLER+KDDFV+KYG GKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGYTYCVVADESSGRQVPIAFLERVKDDFVAKYGAGKAATAAANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_004506588.1| PREDICTED: vesicle-associated membrane protein 721-like [Cicer 
arietinum]
Length=219

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  ++AEH+DF GNF +IAFQCLQKLPSSNN FTYNCDGHTF +LV
Sbjct  1    MGQQ-SLIYSFVARGTLIIAEHSDFTGNFTTIAFQCLQKLPSSNNNFTYNCDGHTFTFLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             +GFT+CVVA ES GRQ+P+AFLERIK+DF+++YGGGKA TA A SL+KEFGPKL++HMQ
Sbjct  60   HHGFTFCVVAVESVGRQIPIAFLERIKEDFITRYGGGKATTATAKSLNKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SK AKVKA
Sbjct  120  YCVDHPEEVSKFAKVKA  136



>gb|AFK40729.1| unknown [Lotus japonicus]
Length=219

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+TDFNGNF SIA QCLQKLP+SN KFTYNCDGHTF+YLV
Sbjct  1    MGQQ-SLIYSFVARGTLILAEYTDFNGNFTSIALQCLQKLPASNKKFTYNCDGHTFSYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES G+Q+PMAFLERIK+DF  KY GG+A+TA A SL+KEFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESFGQQIPMAFLERIKEDFTKKYAGGRASTAAAKSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEE++KLAKVKA
Sbjct  120  YCVEHPEEVNKLAKVKA  136



>ref|XP_004134008.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004157674.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN56755.1| hypothetical protein Csa_3G132570 [Cucumis sativus]
Length=219

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFTTIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAIEAAGRQIPIAFLERVKEDFNKRYGGGKAATAVAHSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCLDHPEEISKLAKVKA  136



>ref|XP_010524695.1| PREDICTED: putative vesicle-associated membrane protein 726 [Tarenaya 
hassleriana]
Length=219

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-LLIYSFVARGTVILAEYTEFTGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQ+P+AFLER+K++F  +YGGGKA+TA ANSL+KEFG KL++ MQ
Sbjct  60   DDGFTYCVVAVESIGRQLPIAFLERVKEEFTKRYGGGKASTATANSLNKEFGSKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_010469563.1| PREDICTED: vesicle-associated membrane protein 725-like [Camelina 
sativa]
Length=220

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHT NYLV
Sbjct  1    MGQQN-LIYSFVARGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTSNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQ
Sbjct  60   VNGFTYCVVAVESVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010475139.1| PREDICTED: vesicle-associated membrane protein 721-like [Camelina 
sativa]
Length=219

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGMVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_009132860.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDX84731.1| BnaA03g14990D [Brassica napus]
Length=220

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQN-LIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL++HMQ
Sbjct  60   VNGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|KFK42812.1| hypothetical protein AALP_AA1G041800 [Arabis alpina]
Length=219

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPS+NNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSTNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|NP_171967.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 sp|Q9ZTW3.1|VA721_ARATH RecName: Full=Vesicle-associated membrane protein 721; Short=AtVAMP721; 
AltName: Full=v-SNARE synaptobrevin 7B; Short=AtVAMP7B 
[Arabidopsis thaliana]
 gb|AAC98905.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 gb|AAL85003.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 gb|AAM91491.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 dbj|BAD42978.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43361.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43374.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43437.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43557.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43592.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43735.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43994.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44048.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44054.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44149.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44415.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44419.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44642.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27738.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=219

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PM+FLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>dbj|BAD43410.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
Length=219

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PM+FLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>emb|CDY19154.1| BnaA04g18940D [Brassica napus]
Length=220

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K LIY+FV RG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KNLIYSFVGRGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA E+ GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAVEAVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_003604990.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES87187.1| synaptobrevin-like protein [Medicago truncatula]
 gb|AFK36407.1| unknown [Medicago truncatula]
Length=219

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE++DF GNF +IA QCLQKLP+SNN+FTYNCDGHTF++LV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYSDFTGNFTTIALQCLQKLPASNNRFTYNCDGHTFSFLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGG+A TA A SL+KEFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESVGRQIPIAFLERIKDDFNKRYGGGRATTATAKSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEE+SKLAKVKA
Sbjct  120  YCVEHPEEVSKLAKVKA  136



>ref|XP_004296647.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQVP+A+LERIKDDF  +Y GGKA TA AN L++EFGPKL++HM+
Sbjct  60   ENGFTYCVVAAESAGRQVPIAYLERIKDDFNKRYAGGKAGTATANGLNREFGPKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEI+KLAKVKA
Sbjct  120  YCVEHPEEINKLAKVKA  136



>gb|KJB33092.1| hypothetical protein B456_006G056000 [Gossypium raimondii]
Length=219

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNFN+IA QCLQKLP+S+N+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFSGNFNTIAAQCLQKLPASSNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAA A A SL++EFG KL+ HM+
Sbjct  60   DNGFTYCVVATESAGRQIPIAFLERVKEDFSKRYGGGKAANAKAKSLNREFGSKLKAHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YCA+HPEEISKLAKVKA
Sbjct  120  YCAEHPEEISKLAKVKA  136



>ref|XP_010542985.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  160  KALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGF  339
            ++LIY+FVARG  +LAE+T+F GNF SIA QCL KLPSSNNKFTYNCDGHTFNYLV+NGF
Sbjct  4    QSLIYSFVARGTVILAEYTEFKGNFTSIAAQCLSKLPSSNNKFTYNCDGHTFNYLVENGF  63

Query  340  TYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  519
            TYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC D
Sbjct  64   TYCVVAVDSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMD  123

Query  520  HPEEISKLAKVKA  558
            HPEEISKL KVKA
Sbjct  124  HPEEISKLGKVKA  136



>ref|XP_008803805.1| PREDICTED: putative vesicle-associated membrane protein 726 [Phoenix 
dactylifera]
Length=220

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE T+F GNF SIA QCLQKLPSSNNKFTYNCD HTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILAEFTEFTGNFTSIASQCLQKLPSSNNKFTYNCDSHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEIS LAKVKA
Sbjct  120  YCVDHPEEISNLAKVKA  136



>ref|XP_004152023.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004169386.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN58350.1| hypothetical protein Csa_3G625650 [Cucumis sativus]
Length=219

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCL KLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIASQCLHKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQ+P+AFLER+ +DFV +YGGGKA TA ANSL+KEFG KL++HM+
Sbjct  60   DNGFTYCVVAVETAGRQIPIAFLERVNEDFVKRYGGGKAMTATANSLNKEFGSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEISKLAKVKA
Sbjct  120  YCVEHPEEISKLAKVKA  136



>ref|XP_010910152.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=220

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCD HTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPASNNKFTYNCDSHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA AN L++EFGPKL++HMQ
Sbjct  60   EDGFTYCVVAVEAAGRQIPIAFLERVKEDFKKRYGGGKAATASANGLNREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI KLAKVKA
Sbjct  120  YCVDHPEEIGKLAKVKA  136



>ref|NP_180826.2| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
 sp|O48850.2|VA725_ARATH RecName: Full=Vesicle-associated membrane protein 725; Short=AtVAMP725 
[Arabidopsis thaliana]
 dbj|BAC42934.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAP06822.1| putative synaptobrevin protein [Arabidopsis thaliana]
 gb|AEC08714.1| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
Length=285

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +1

Query  133  RNRSEMGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHT  312
            R    MGQQ  LIY+FVARG  +L E+T+F GNF ++A QCLQKLPSSNNKFTYNCDGHT
Sbjct  61   RVTRTMGQQN-LIYSFVARGTVILVEYTEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHT  119

Query  313  FNYLVDNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKL  492
            FNYLV+NGFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL
Sbjct  120  FNYLVENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKL  179

Query  493  RDHMQYCADHPEEISKLAKVKA  558
            ++HMQYC DHP+EISKLAKVKA
Sbjct  180  KEHMQYCVDHPDEISKLAKVKA  201



>ref|XP_003535217.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
 gb|KHN16316.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+++F+GNF +IA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTMILAEYSEFSGNFKTIASQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NG TYCVVA ES GRQ+P+AFLER KD+F  KYGGGKAATA ANSL++EFGPKL+  MQ
Sbjct  60   ENGVTYCVVAIESAGRQLPIAFLERTKDEFTQKYGGGKAATASANSLNREFGPKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_010038359.1| PREDICTED: vesicle-associated membrane protein 721-like [Eucalyptus 
grandis]
 gb|KCW50175.1| hypothetical protein EUGRSUZ_K03606 [Eucalyptus grandis]
Length=222

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNF S+A QCLQKLP+++NKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGPVLLAEYTEFSGNFTSVASQCLQKLPATSNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+G TYCVVA ES GRQ+PMAFLERIK+DF  +Y  GKAATA ANSL++EFGPKL++HMQ
Sbjct  60   DDGLTYCVVAVESVGRQIPMAFLERIKEDFTHRYDAGKAATASANSLNREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|AAA56991.1| formerly called HAT24; synaptobrevin-related protein [Arabidopsis 
thaliana]
Length=221

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
             HP+EISKLAKVKA
Sbjct  123  AHPDEISKLAKVKA  136



>gb|KJB71677.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71678.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71679.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
Length=219

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFTSIAGQCLQKLPTSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIK+DF  +YGGGKAATA A SL++EF  KL++HM+
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERIKEDFSRRYGGGKAATATAKSLNREFKSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEISKLAKVKA
Sbjct  120  YCVEHPEEISKLAKVKA  136



>gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea]
Length=220

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +L+E+T+F GNF  IA QCL KLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILSEYTEFTGNFTGIAAQCLHKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+RIK+DFV KY GGKAATA ANSL+KEFGPKL++ MQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRIKEDFVKKYSGGKAATAVANSLNKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010413913.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X2 [Camelina sativa]
Length=221

 Score =   231 bits (589),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSS+N+FTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGKVILVEFTDFKGNFTSIAAQCLQKLPSSHNEFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_009408466.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   231 bits (588),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFQGNFTSIAAQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA E+ GRQ+P+AFL+RIK+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGYTYCVVAVEALGRQIPIAFLDRIKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEIS+LAKVKA
Sbjct  120  YCVDHPEEISRLAKVKA  136



>gb|EYU17981.1| hypothetical protein MIMGU_mgv1a013452mg [Erythranthe guttata]
Length=220

 Score =   231 bits (588),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+F ARG  +LA++T+F+GNF  IA QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFAARGTVILADYTEFSGNFTGIAAQCLQKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFT+CVVA ES GRQ+P+A+LERIKDDF  KYGGGKAATA ANSL KEFGPKL++ MQ
Sbjct  60   EDGFTFCVVAVESVGRQIPIAYLERIKDDFTKKYGGGKAATAVANSLKKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SK+AKVKA
Sbjct  120  YCVDHPEEVSKMAKVKA  136



>ref|XP_006650747.1| PREDICTED: vesicle-associated membrane protein 721-like [Oryza 
brachyantha]
Length=220

 Score =   231 bits (588),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  +LAE+T+F GNF +IA QCL KLP+SNNKFTY CDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVILAEYTEFTGNFTTIASQCLMKLPASNNKFTYTCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQVP+AFL+R+KDDF  +YGGGKAATA  NSL+++FG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQVPIAFLDRVKDDFTKRYGGGKAATAATNSLNRDFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YCADHP+EISKLAKVKA
Sbjct  120  YCADHPDEISKLAKVKA  136



>ref|XP_007145403.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
 gb|ESW17397.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
Length=221

 Score =   231 bits (588),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNF SIA QCLQKLPS+NN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTMILAEYTEFSGNFTSIASQCLQKLPSTNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K++F  KYG GKAATA A SL++EFGPKL+  MQ
Sbjct  60   ENGFTYCVVAVESAGRQLPIAFLERVKEEFSKKYGAGKAATASAKSLNREFGPKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|KCW50174.1| hypothetical protein EUGRSUZ_K03606 [Eucalyptus grandis]
Length=208

 Score =   230 bits (587),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNF S+A QCLQKLP+++NKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGPVLLAEYTEFSGNFTSVASQCLQKLPATSNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+G TYCVVA ES GRQ+PMAFLERIK+DF  +Y  GKAATA ANSL++EFGPKL++HMQ
Sbjct  60   DDGLTYCVVAVESVGRQIPMAFLERIKEDFTHRYDAGKAATASANSLNREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009767969.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP+SNN+FTYNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTMILAEYTEFTGNFTSIASQCLQKLPASNNRFTYNCDGHTFNFLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA A SL+KEFGPKL++HM+
Sbjct  60   ENGFTYCVVATESAGRQIPIAFLERIKDDFSKRYGGGKATTATAKSLNKEFGPKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEI+KLAKVKA
Sbjct  120  YCVEHPEEINKLAKVKA  136



>ref|XP_008465086.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=219

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF +IA QCL KLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTTIASQCLHKLPATNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA E+ GRQ+P+AFLER+ +DFV +YGGGKA TA ANSL+KEFG KL++HM+
Sbjct  60   DNGFTYCVVAVEAAGRQIPIAFLERVNEDFVKRYGGGKAMTATANSLNKEFGSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEISKLAKVKA
Sbjct  120  YCVEHPEEISKLAKVKA  136



>ref|XP_009417150.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F+GNFNSIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFSGNFNSIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA ES GRQ+P+ FL+R+K+DF  +YGGGKAATA ANSLS+EFG KL++ MQ
Sbjct  60   EDGYTYCVVAVESVGRQIPIGFLDRVKEDFNKRYGGGKAATASANSLSREFGSKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DH EEISKLAKVKA
Sbjct  120  YCVDHSEEISKLAKVKA  136



>gb|KHG06809.1| hypothetical protein F383_08210 [Gossypium arboreum]
Length=219

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP+SNNKFTY CDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGIAAQCLQKLPASNNKFTYTCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA A SL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_011073775.1| PREDICTED: putative vesicle-associated membrane protein 726 [Sesamum 
indicum]
Length=219

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LA++T+F GNF S+A QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILADYTEFTGNFTSVAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+PMAFLER+KDDF  KY GGKA+ A +N L KEFGPKL++HM+
Sbjct  60   ENGFTYCVVAIESAGRQIPMAFLERVKDDFNKKYSGGKASAAKSNGLKKEFGPKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEIS+LAKVKA
Sbjct  120  YCTEHPEEISQLAKVKA  136



>emb|CDY15521.1| BnaA08g28050D [Brassica napus]
Length=219

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF ++A QCLQKLPSSNNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTTVAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQASSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>gb|KJB37798.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=219

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP+SNNKFTY CDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGIAAQCLQKLPASNNKFTYTCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA A SL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_004293741.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 129/137 (94%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K+LIYAFVARG  +LAE+T+F+GNFNSIAFQCLQKLP++NNKFTYNCD HTFNYLV
Sbjct  1    MGQ-KSLIYAFVARGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA+ES GRQVP+AFLER+KDDFV+KYGGGKAATA ANSL+KEFG KL++HMQ
Sbjct  60   DNGFTYCVVADESAGRQVPIAFLERVKDDFVAKYGGGKAATAAANSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009141263.1| PREDICTED: vesicle-associated membrane protein 725-like [Brassica 
rapa]
Length=220

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K LIY+FV RG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KNLIYSFVGRGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA E+ GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAVEAVGRQIPMAFLERVKEDFSKRYGGGKATTAKPNSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_002303031.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
 gb|EEE82304.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
Length=219

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LA++TDF+GNF  IA QCLQKLP++NNKFTY+CDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILADYTDFSGNFAGIAAQCLQKLPATNNKFTYSCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+A+LERIK+DF ++YGGGKAA A AN L KEFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANGLKKEFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            +C DHPEE+SKLAKVKA
Sbjct  120  FCMDHPEEVSKLAKVKA  136



>ref|XP_006360344.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=221

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNFN IA QCLQKLP+SNN+FTYNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFNIIASQCLQKLPASNNRFTYNCDGHTFNFLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSKEFGPKL++HM+
Sbjct  60   ENGFTYCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTAAPKSLSKEFGPKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC D+PEEI+KLAKVKA
Sbjct  120  YCVDNPEEINKLAKVKA  136



>ref|XP_004514024.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X1 [Cicer arietinum]
Length=221

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FV+RG  +LAE+T+F+GNF++IA QCLQKLPSSNN+FTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVSRGTIILAEYTEFSGNFSTIASQCLQKLPSSNNRFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+A+LER+K++F  KYGGGKAATA  +SL+KEFG KL+  MQ
Sbjct  60   DNGFTYCVVAVESAGRQIPIAYLERVKEEFSKKYGGGKAATATTHSLNKEFGSKLKQQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|XP_009143949.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDY12188.1| BnaC04g12180D [Brassica napus]
Length=220

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQN-LIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+ MAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL+ HMQ
Sbjct  60   ENGFTYCVVAVESAGRQITMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKGHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KL+KVKA
Sbjct  120  YCVDHPEEINKLSKVKA  136



>emb|CDY48531.1| BnaC04g43180D [Brassica napus]
Length=220

 Score =   228 bits (582),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ K LIY+FV RG  +L E+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQ-KNLIYSFVGRGTVILVEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA E+ GRQ+PMAFLERIK+DF ++YGGGKA  A  NSL+KEFG KL++HMQ
Sbjct  60   ENGFTYCVVAVEAVGRQIPMAFLERIKEDFSNRYGGGKATNAKPNSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|ABK22119.1| unknown [Picea sitchensis]
 gb|ABK25940.1| unknown [Picea sitchensis]
Length=222

 Score =   228 bits (582),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCD HTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVVLAEYTEFKGNFTTIAAQCLQKLPASNNKFTYNCDNHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GF YCVVA+ES GRQVPMAFLER+K+DF  +YGGG+A TA  NSL+++FG KL++HMQ
Sbjct  60   EDGFAYCVVADESVGRQVPMAFLERVKEDFKRRYGGGRADTAVGNSLNRDFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010674670.1| PREDICTED: vesicle-associated membrane protein 722 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   228 bits (581),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF SIA QCLQKLP++NNKFTYNCDGHTFN+LV
Sbjct  1    MGQQN-LIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNFLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             +GFTYCVVA ES GRQ+PMAFLER+KDDF  ++GGGKAATA A SL+K+FGPKL++HMQ
Sbjct  60   SDGFTYCVVAVESVGRQIPMAFLERVKDDFNKRFGGGKAATAQAKSLNKDFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE++KLAKV+A
Sbjct  120  YCVDHPEEMNKLAKVQA  136



>gb|KJB22568.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=220

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF  IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFTGNFTGIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVPMAFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQ
Sbjct  60   DNGFTYCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>gb|KJB22566.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=199

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF  IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFTGNFTGIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVPMAFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQ
Sbjct  60   DNGFTYCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>ref|XP_010547077.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Tarenaya hassleriana]
Length=219

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQ+P+AFLER+K++F  +YGGGKA TA ANSL+KEF  K+++ MQ
Sbjct  60   DDGFTYCVVAVESVGRQLPIAFLERVKEEFTKRYGGGKADTATANSLNKEFASKMKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHP+EI+KLAKVKA
Sbjct  120  YCVDHPDEINKLAKVKA  136



>ref|XP_009398406.1| PREDICTED: putative vesicle-associated membrane protein 726 [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLPSSNN+FTYN DGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFQGNFTGIAAQCLQKLPSSNNRFTYNGDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA ES GRQ+P+AFL+RIK+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGYTYCVVAVESVGRQIPIAFLDRIKEDFNKRYGGGKAATARANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>gb|KJB22567.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=226

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F GNF  IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFTGNFTGIASQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVPMAFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQ
Sbjct  60   DNGFTYCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCIDHPEEISKIAKVKA  136



>gb|KJB57021.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=216

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 6/133 (5%)
 Frame = +1

Query  160  KALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGF  339
            K+LIYAFV+RG  +LAE+T+F+GNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG+
Sbjct  4    KSLIYAFVSRGEVILAEYTEFSGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNGY  63

Query  340  TYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  519
                   E  GRQVP+AFLER+K+DFVSKYG GKAATAPANSL+KEFGPKL++HMQYC +
Sbjct  64   N------ELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCVE  117

Query  520  HPEEISKLAKVKA  558
            HPEEISKLAK+K+
Sbjct  118  HPEEISKLAKIKS  130



>gb|KFK31079.1| hypothetical protein AALP_AA6G065700 [Arabis alpina]
Length=220

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GN  SIA QCLQKLPSS++KFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNVTSIASQCLQKLPSSSDKFTYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GR++PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGREIPMAFLERVKEDFNQRYGGGKAATAQANSLNKEFGSKLKEHMQYCI  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>ref|XP_011091409.1| PREDICTED: vesicle-associated membrane protein 722-like [Sesamum 
indicum]
Length=220

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+F+ARG  +L E+T+F GNF SIA QCLQKLP+S+NKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFIARGTVILTEYTEFKGNFTSIASQCLQKLPASSNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLERIKD+F  KY GGK AT  ANSL KEFGPKLR+ MQ
Sbjct  60   ENGFTYCVVATESAGRQLPIAFLERIKDEFNKKYSGGKKATGGANSLKKEFGPKLREQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC+D+PEEI+KLAKVKA
Sbjct  120  YCSDNPEEINKLAKVKA  136



>gb|EYU31743.1| hypothetical protein MIMGU_mgv1a013482mg [Erythranthe guttata]
Length=219

 Score =   226 bits (577),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF +IA QCL KLP+S+NKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTMILAEYTEFKGNFTTIASQCLAKLPASSNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKA TA  N L KEFGPKL+D MQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAGTAGPNGLKKEFGPKLKDQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISK+AKVKA
Sbjct  120  YCVDHPEEISKIAKVKA  136



>ref|XP_004247839.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=221

 Score =   226 bits (577),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNFNSIA QCLQKLP+SNN+FTYNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFNSIASQCLQKLPASNNRFTYNCDGHTFNFLA  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSKEFGPK+++ M+
Sbjct  60   ESGFTYCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC D+PEEI+KLAKVKA
Sbjct  120  YCVDNPEEINKLAKVKA  136



>ref|XP_009757440.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+++F GNFNSIA QCLQKLP+SNNKF+YNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTIILAEYSEFTGNFNSIASQCLQKLPTSNNKFSYNCDGHTFNFLS  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GR++P+AFL+R+KDDF  +Y GGKAATA A SL++EFG KL++HM+
Sbjct  60   DNGFTYCVVATESAGREIPIAFLDRVKDDFSKRYAGGKAATASAKSLNREFGSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|XP_009608699.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+++F GNFNSIA QCLQKLP+SNNKF+YNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYSEFTGNFNSIASQCLQKLPASNNKFSYNCDGHTFNFLS  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GR++P+AFL+R+KDDF  +Y GGKAATA A SL++EFG KL++HM+
Sbjct  60   DNGFTYCVVATESAGREIPIAFLDRVKDDFSKRYAGGKAATASAKSLNREFGSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCVDHPEEISKLSKVKA  136



>ref|XP_007140572.1| hypothetical protein PHAVU_008G123900g [Phaseolus vulgaris]
 gb|ESW12566.1| hypothetical protein PHAVU_008G123900g [Phaseolus vulgaris]
Length=222

 Score =   226 bits (576),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            M +Q++LIY+FVARG  VLAEHTDFNGNF  +A  CL +LP+SN KFTYN D HTFNYL 
Sbjct  1    MSRQQSLIYSFVARGTVVLAEHTDFNGNFTKVALDCLLRLPASNAKFTYNADAHTFNYLT  60

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+ MAFLERIKDDF  +YGGGKA TA + SL+KEFGPKL++HMQ
Sbjct  61   DNGFTYCVVAVESIGRQLAMAFLERIKDDFSKRYGGGKATTATSKSLNKEFGPKLKEHMQ  120

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEE+SKLAKVKA
Sbjct  121  YCVEHPEEVSKLAKVKA  137



>ref|XP_007157801.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
 gb|ESW29795.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
Length=226

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIYAFV+RG  +LAE+T+F+GNFN+IAFQCLQKLP+SNNKFTYNCDGHTFNYLVDNG
Sbjct  7    QRSLIYAFVSRGTVILAEYTEFSGNFNTIAFQCLQKLPASNNKFTYNCDGHTFNYLVDNG  66

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA+ES GRQVP+AFLER+KDDF++KYGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  67   FTYCVVADESIGRQVPVAFLERVKDDFLAKYGGGKAATAAANSLNKEFGSKLKEHMQYCV  126

Query  517  DHPEEISKLAKVKA  558
            +HPEEISKLAKVKA
Sbjct  127  EHPEEISKLAKVKA  140



>gb|KJB42279.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=219

 Score =   226 bits (576),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F+GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFSGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQ
Sbjct  60   DNGFTYCVVAVESAGRQVPIAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SK+AKVKA
Sbjct  120  YCIDHPEEVSKIAKVKA  136



>ref|NP_001031469.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 dbj|BAH20114.1| AT2G33120 [Arabidopsis thaliana]
 gb|AEC08788.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=229

 Score =   226 bits (575),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 8/142 (6%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FT--------YCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKL  492
            F+        YCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL
Sbjct  63   FSESKYCSISYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKL  122

Query  493  RDHMQYCADHPEEISKLAKVKA  558
            ++HMQYC DHP+EISKLAKVKA
Sbjct  123  KEHMQYCMDHPDEISKLAKVKA  144



>ref|XP_009335953.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=220

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG+ VLAE+T+F GNF +IA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-YLIYSFVARGSMVLAEYTEFTGNFTTIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ++    +P+A+LERIKDDF  +YGGGKAATA AN L+ EFGPKL+DHM+
Sbjct  60   ENGFTYCVVAADAVANGLPIAYLERIKDDFNKRYGGGKAATAVANGLNSEFGPKLKDHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>gb|KHG06808.1| hypothetical protein F383_08210 [Gossypium arboreum]
Length=264

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  IA QCLQKLP+SNNKFTY CDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGIAAQCLQKLPASNNKFTYTCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA A SL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_009141288.1| PREDICTED: vesicle-associated membrane protein 722 [Brassica 
rapa]
Length=219

 Score =   225 bits (573),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L + TDF GNF SIA QCLQKLPSSNNK  YNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVDFTDFKGNFTSIAAQCLQKLPSSNNKVIYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GR++PMAFLER+K+DF ++YGGGKAATA  NSL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGREIPMAFLERVKEDFNTRYGGGKAATAQPNSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>gb|EPS61521.1| hypothetical protein M569_13274 [Genlisea aurea]
Length=220

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF ++A QCLQKLP++NNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTALAAQCLQKLPTANNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTY VVA ES GRQ+P+AFLERIKDDF+ KY GGKAATA ANSL+K+FGPKL++ MQ
Sbjct  60   EDGFTYGVVAVESLGRQIPIAFLERIKDDFIKKYSGGKAATAVANSLNKDFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            +C +HP+EISK++KVKA
Sbjct  120  FCVEHPDEISKISKVKA  136



>ref|XP_002297816.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
 gb|EEE82621.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
Length=219

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNF  IA QCL+KLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVLLAEYTEFKGNFTGIAAQCLEKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K+DF  +Y GGKAATA A SL+ EFG KL+ HMQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_002881263.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57522.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
Length=231

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 10/144 (7%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENG  62

Query  337  FT----------YCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGP  486
            F+          YCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG 
Sbjct  63   FSESKYCSIYAPYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGS  122

Query  487  KLRDHMQYCADHPEEISKLAKVKA  558
            KL++HMQYC DHP+EISKLAKVKA
Sbjct  123  KLKEHMQYCMDHPDEISKLAKVKA  146



>ref|XP_011034474.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
 ref|XP_011034475.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   223 bits (569),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +L E+T+F GNF  IA QCL+KLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-TLIYSFVARGTVILVEYTEFKGNFTGIAAQCLEKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            +NGFTYCVVA ES GRQ+P+AFLER+K+DF  +Y GGKAATA A SL+ EFG KL+ HMQ
Sbjct  60   ENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_003552141.1| PREDICTED: vesicle-associated membrane protein 725-like [Glycine 
max]
Length=214

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAEHTDF+GNF  +A QCLQ+LP+S+NKFTYN DGHTFNYL 
Sbjct  1    MGQQ-SLIYSFVARGTMILAEHTDFSGNFAEVALQCLQRLPASDNKFTYNADGHTFNYLT  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
             NGFTYCVVA ES GRQ+ MA+LERI +DF  +YGGGKA TA A SL+KEFG KL++HMQ
Sbjct  60   YNGFTYCVVAVESVGRQLAMAYLERIMEDFSKRYGGGKATTATAKSLNKEFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEE+SKLAKVKA
Sbjct  120  YCVEHPEEVSKLAKVKA  136



>emb|CDY37751.1| BnaA04g19170D [Brassica napus]
Length=219

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L + TDF GNF SIA QCLQKLPSSNNK  YNCDGHTFNYLV+NG
Sbjct  3    QQSLIYSFVARGTVILVDFTDFKGNFTSIAAQCLQKLPSSNNKVIYNCDGHTFNYLVENG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GR++PMAFLER+K+DF  +YGGGKAATA  NSL+KEFG KL+ HMQYC 
Sbjct  63   FTYCVVAVDSAGREIPMAFLERVKEDFNRRYGGGKAATAQPNSLNKEFGSKLKGHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKV+A
Sbjct  123  DHPDEISKLAKVRA  136



>dbj|BAJ88124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCL KLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIASQCLVKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES G+Q+P+AFL R+KDDF  +Y GGKAATA  +SL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGQQMPIAFLVRVKDDFSKRYAGGKAATAAPSSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKV+A
Sbjct  120  YCVDHPEEINKLAKVQA  136



>ref|XP_009111083.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=219

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            Q++LIY+FVARG  +L E TDF G   ++A QCLQKLPS NNKFTYNCDGHTFNYLV++G
Sbjct  3    QQSLIYSFVARGTVILVEFTDFKGTSPTVAAQCLQKLPSPNNKFTYNCDGHTFNYLVEDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQYC 
Sbjct  63   FTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQASSLNKEFGSKLKEHMQYCM  122

Query  517  DHPEEISKLAKVKA  558
            DHP+EISKLAKVKA
Sbjct  123  DHPDEISKLAKVKA  136



>gb|KCW63002.1| hypothetical protein EUGRSUZ_G00602 [Eucalyptus grandis]
Length=181

 Score =   219 bits (559),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MG++ +LIY+FVARG AVLAE+ +F G F  IA QCLQKLP S + FTY CDGHTF+YLV
Sbjct  1    MGRE-SLIYSFVARGTAVLAEYAEFGGKFAGIALQCLQKLPPSTDHFTYTCDGHTFSYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQ+PMAFLERIKD+F ++YGGGKAATA A+SL +EFGPKL++ MQ
Sbjct  60   DSGFTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKV A
Sbjct  120  YCMDHPEEISKLAKVTA  136



>ref|XP_008457256.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X4 [Cucumis melo]
Length=177

 Score =   219 bits (558),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIY+FVARG  +LAEH+DF GNF +IAFQCLQ+LP+SNN+FTY CDGHTFNYL+++G
Sbjct  3    QKSLIYSFVARGTVILAEHSDFTGNFTNIAFQCLQRLPASNNRFTYTCDGHTFNYLLNDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA E+ GRQVPMA LERIK++F   YGGGKA+ A A SL+KEFGPK++ HMQYC 
Sbjct  63   FTYCVVAVEAAGRQVPMACLERIKENFDRTYGGGKASVAVAKSLNKEFGPKMKGHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE SKL +VKA
Sbjct  123  DHPEESSKLMQVKA  136



>ref|XP_004138954.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004172045.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN61458.1| hypothetical protein Csa_2G129170 [Cucumis sativus]
Length=219

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIY+FVARG  +LA+++DF+GNF +IAFQCLQ+LP+SNN+FTY CDGHTFNYL++NG
Sbjct  3    QKSLIYSFVARGTVILADYSDFSGNFTNIAFQCLQRLPASNNRFTYTCDGHTFNYLLNNG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA E+ GRQVPMA LERIK+DF  +YGGGKA+ A A SL+KEFGPK++ HMQYC 
Sbjct  63   FTYCVVAVEAAGRQVPMACLERIKEDFDRRYGGGKASVAVAKSLNKEFGPKMKGHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE SKL +VKA
Sbjct  123  DHPEESSKLMQVKA  136



>gb|KCW63001.1| hypothetical protein EUGRSUZ_G00601 [Eucalyptus grandis]
Length=176

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ  +LIY+FVARG AVLAE+ +F G F  IA QCLQKLP S + FTY CDGHTF+YL+
Sbjct  1    MGQ--SLIYSFVARGTAVLAEYAEFGGKFTGIALQCLQKLPLSTDHFTYTCDGHTFSYLI  58

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+ FTYCVVA ES GRQ+PMAFLERIKD+F ++YGGGKAATA A+SL +EFGPKL++ MQ
Sbjct  59   DSSFTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMQ  118

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPE+ISKLA+VKA
Sbjct  119  YCADHPEDISKLAQVKA  135



>gb|EMT18448.1| Putative vesicle-associated membrane protein 726 [Aegilops tauschii]
Length=249

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCL KLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIASQCLVKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES G+Q+P+AFL R+KDDF  +Y GGKAATA  +SL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGQQMPIAFLVRVKDDFSKRYAGGKAATAAPSSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKV+A
Sbjct  120  YCVDHPEEINKLAKVQA  136



>ref|NP_001241434.1| uncharacterized protein LOC100804314 [Glycine max]
 gb|ACU24640.1| unknown [Glycine max]
 gb|KHN36363.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF S+A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A+SL++EFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAHSLNREFGPKLKEEMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010547078.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X2 [Tarenaya hassleriana]
Length=227

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 121/145 (83%), Gaps = 9/145 (6%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF SIA QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFT--------YCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFG  483
            D+GF+        YCVVA ES GRQ+P+AFLER+K++F  +YGGGKA TA ANSL+KEF 
Sbjct  60   DDGFSIVLSLSLSYCVVAVESVGRQLPIAFLERVKEEFTKRYGGGKADTATANSLNKEFA  119

Query  484  PKLRDHMQYCADHPEEISKLAKVKA  558
             K+++ MQYC DHP+EI+KLAKVKA
Sbjct  120  SKMKEQMQYCVDHPDEINKLAKVKA  144



>gb|EPS71680.1| hypothetical protein M569_03080, partial [Genlisea aurea]
Length=219

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ+ LIY+FVARG  +LA++T+F GNF S+A QCLQKLP+S+N+FTYNCDGHTFNY V
Sbjct  1    MGQQE-LIYSFVARGTVILADYTEFKGNFTSVAAQCLQKLPASSNRFTYNCDGHTFNYHV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVV  ES GRQ+P+AFLER+K+DF  +YGGGKAA A  N+L KE+GPKL +HMQ
Sbjct  60   DSGFTYCVVVVESAGRQLPIAFLERVKEDFNKRYGGGKAANAGPNALKKEYGPKLMEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEI+KLAKVKA
Sbjct  120  YCVDHPEEINKLAKVKA  136



>ref|NP_001148792.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACG32929.1| vesicle-associated membrane protein 725 [Zea mays]
Length=222

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL +EFGPKL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLKREFGPKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_003622969.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES79187.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF ++A QCLQKLPSSNNKF YNCD HTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTAVAAQCLQKLPSSNNKFNYNCDDHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+GFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKA  A A SL+KEFG KL++ MQ
Sbjct  60   DSGFTYCVVAVESAGRQIPIAFLERIKEDFSKKYAGGKAENAAAKSLNKEFGSKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC +HPEEISKL+KV+A
Sbjct  120  YCVEHPEEISKLSKVQA  136



>ref|XP_010065488.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
 gb|KCW62996.1| hypothetical protein EUGRSUZ_G00596 [Eucalyptus grandis]
Length=222

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ  +LIY+FVARG AVLAE+ +F G F  IA QCLQKLP S + FTY CDGHTF+YL+
Sbjct  1    MGQ--SLIYSFVARGTAVLAEYAEFGGKFAGIALQCLQKLPLSTDHFTYTCDGHTFSYLI  58

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+ FTYCVVA ES GRQ+PMAFLERIKD+F ++YGGGKAATA A+SL +EFGPKL++ M+
Sbjct  59   DSSFTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMR  118

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPEEISKLAKVKA
Sbjct  119  YCADHPEEISKLAKVKA  135



>ref|XP_008457255.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X3 [Cucumis melo]
Length=199

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIY+FVARG  +LAEH+DF GNF +IAFQCLQ+LP+SNN+FTY CDGHTFNYL+++G
Sbjct  3    QKSLIYSFVARGTVILAEHSDFTGNFTNIAFQCLQRLPASNNRFTYTCDGHTFNYLLNDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA E+ GRQVPMA LERIK++F   YGGGKA+ A A SL+KEFGPK++ HMQYC 
Sbjct  63   FTYCVVAVEAAGRQVPMACLERIKENFDRTYGGGKASVAVAKSLNKEFGPKMKGHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE SKL +VKA
Sbjct  123  DHPEESSKLMQVKA  136



>ref|XP_008457254.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X2 [Cucumis melo]
Length=219

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIY+FVARG  +LAEH+DF GNF +IAFQCLQ+LP+SNN+FTY CDGHTFNYL+++G
Sbjct  3    QKSLIYSFVARGTVILAEHSDFTGNFTNIAFQCLQRLPASNNRFTYTCDGHTFNYLLNDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA E+ GRQVPMA LERIK++F   YGGGKA+ A A SL+KEFGPK++ HMQYC 
Sbjct  63   FTYCVVAVEAAGRQVPMACLERIKENFDRTYGGGKASVAVAKSLNKEFGPKMKGHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE SKL +VKA
Sbjct  123  DHPEESSKLMQVKA  136



>ref|NP_001130551.1| uncharacterized protein LOC100191650 [Zea mays]
 gb|ACF78814.1| unknown [Zea mays]
 tpg|DAA42469.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=157

 Score =   216 bits (551),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_003532299.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
Length=221

 Score =   218 bits (556),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE+T+F GNF  +A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEYTEFTGNFTGVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A SL++EFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_010065492.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
 gb|KCW63000.1| hypothetical protein EUGRSUZ_G00601 [Eucalyptus grandis]
Length=222

 Score =   218 bits (555),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQ  +LIY+FVARG AVLAE+ +F G F  IA QCLQKLP S + FTY CDGHTF+YL+
Sbjct  1    MGQ--SLIYSFVARGTAVLAEYAEFGGKFTGIALQCLQKLPLSTDHFTYTCDGHTFSYLI  58

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            D+ FTYCVVA ES GRQ+PMAFLERIKD+F ++YGGGKAATA A+SL +EFGPKL++ MQ
Sbjct  59   DSSFTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMQ  118

Query  508  YCADHPEEISKLAKVKA  558
            YCADHPE+ISKLA+VKA
Sbjct  119  YCADHPEDISKLAQVKA  135



>tpg|DAA42470.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=176

 Score =   216 bits (551),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_008457253.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X1 [Cucumis melo]
Length=248

 Score =   219 bits (557),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  QKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLVDNG  336
            QK+LIY+FVARG  +LAEH+DF GNF +IAFQCLQ+LP+SNN+FTY CDGHTFNYL+++G
Sbjct  3    QKSLIYSFVARGTVILAEHSDFTGNFTNIAFQCLQRLPASNNRFTYTCDGHTFNYLLNDG  62

Query  337  FTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  516
            FTYCVVA E+ GRQVPMA LERIK++F   YGGGKA+ A A SL+KEFGPK++ HMQYC 
Sbjct  63   FTYCVVAVEAAGRQVPMACLERIKENFDRTYGGGKASVAVAKSLNKEFGPKMKGHMQYCV  122

Query  517  DHPEEISKLAKVKA  558
            DHPEE SKL +VKA
Sbjct  123  DHPEESSKLMQVKA  136



>ref|XP_009418833.1| PREDICTED: vesicle-associated membrane protein 721 [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  VLAE T+F+GNFNSIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVVLAEFTEFSGNFNSIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++G+TYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGYTYCVVAVESVGRQIPIAFLERVKEDFNKRYGGGKAATAAANSLTREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>tpg|DAA42471.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=189

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>gb|KJB42280.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=217

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 3/137 (2%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLA++T+F+GNF SIA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLADYTEFSGNFTSIASQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAA APANSLSKE  PKL++HMQ
Sbjct  60   DNGFTYCVVAVESAGRQVPIAFLERIKEDFTKRYGGGKAAAAPANSLSKE--PKLKEHMQ  117

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SK+AKVKA
Sbjct  118  YCIDHPEEVSKIAKVKA  134



>ref|XP_002459506.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 ref|XP_008667049.1| PREDICTED: uncharacterized protein LOC100191650 isoform X1 [Zea 
mays]
 gb|ACF84519.1| unknown [Zea mays]
 gb|ACF84742.1| unknown [Zea mays]
 gb|ACG28427.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACN28437.1| unknown [Zea mays]
 gb|EER96027.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 tpg|DAA42472.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=222

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|NP_001059109.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAD30158.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 emb|CAD70274.1| synaptobrevin 1 [Oryza sativa Japonica Group]
 dbj|BAF21023.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAG87612.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96866.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQ+P+AFL+R+K+DF  +YGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQIPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKLAKVKA
Sbjct  120  YCVDHPEEISKLAKVKA  136



>ref|XP_004955737.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=222

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ+ LIYAFVARG  VLAE+T+F GNF +IA QCLQKLP+SNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQQ-LIYAFVARGTVVLAEYTEFTGNFTTIAAQCLQKLPASNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            ++GFTYCVVA ES GRQVP+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQ
Sbjct  60   EDGFTYCVVAVESVGRQVPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_010326817.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=232

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 12/148 (8%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +LAE+T+F GNFNSIA QCLQKLP+SNN+FTYNCDGHTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTVILAEYTEFTGNFNSIASQCLQKLPASNNRFTYNCDGHTFNFLA  59

Query  328  DNGFT-----------YCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSK  474
            ++GF+           YCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSK
Sbjct  60   ESGFSDYTKFFAIIVAYCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSK  119

Query  475  EFGPKLRDHMQYCADHPEEISKLAKVKA  558
            EFGPK+++ M+YC D+PEEI+KLAKVKA
Sbjct  120  EFGPKMKEQMKYCVDNPEEINKLAKVKA  147



>ref|XP_007140571.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|AGV54239.1| vesicle-associated membrane protein [Phaseolus vulgaris]
 gb|ESW12565.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=221

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ +LIY+FVARG  +LAE T+F GNF  +A QCLQKLPSSNNKFTYNCDGHTFNYLV
Sbjct  1    MGQQ-SLIYSFVARGTVILAEFTEFTGNFTGVAAQCLQKLPSSNNKFTYNCDGHTFNYLV  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A SL++EFGPKL++ MQ
Sbjct  60   DNGFTYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQ  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEE+SKLAKVKA
Sbjct  120  YCVDHPEEVSKLAKVKA  136



>ref|XP_004253005.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=221

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +L E+++F GNF+SIA QCLQKLP S+NKF+YNCD HTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTIILVEYSEFTGNFSSIATQCLQKLPPSSNKFSYNCDDHTFNFLS  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GR++P+AFL+R+K+DF  KY GGKAATA A SL++EFG KL++HM+
Sbjct  60   DNGFTYCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCCDHPEEISKLSKVKA  136



>ref|XP_006349936.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Solanum tuberosum]
Length=221

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  148  MGQQKALIYAFVARGNAVLAEHTDFNGNFNSIAFQCLQKLPSSNNKFTYNCDGHTFNYLV  327
            MGQQ  LIY+FVARG  +L E+++F GNF+SIA QCLQKLP S+NKF+YNCD HTFN+L 
Sbjct  1    MGQQ-TLIYSFVARGTIILVEYSEFTGNFSSIATQCLQKLPPSSNKFSYNCDDHTFNFLS  59

Query  328  DNGFTYCVVAEESTGRQVPMAFLERIKDDFVSKYGGGKAATAPANSLSKEFGPKLRDHMQ  507
            DNGFTYCVVA ES GR++P+AFL+R+K+DF  KY GGKAATA A SL++EFG KL++HM+
Sbjct  60   DNGFTYCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMK  119

Query  508  YCADHPEEISKLAKVKA  558
            YC DHPEEISKL+KVKA
Sbjct  120  YCCDHPEEISKLSKVKA  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840