BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF013K17

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803991.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         219   1e-66   Nicotiana sylvestris
ref|XP_007149562.1|  hypothetical protein PHAVU_005G080700g             219   2e-66   Phaseolus vulgaris [French bean]
ref|XP_009605608.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         219   2e-66   Nicotiana tomentosiformis
emb|CDP06032.1|  unnamed protein product                                219   5e-66   Coffea canephora [robusta coffee]
ref|XP_003543198.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         218   5e-66   Glycine max [soybeans]
dbj|BAO57292.1|  gamma-glutamyl hydrolase                               217   9e-66   Ipomoea nil [qian niu]
ref|XP_003596307.1|  Gamma-glutamylhydrolase                            211   2e-65   
ref|NP_001234434.1|  gamma-glutamylhydrolase 1 precursor                216   3e-65   Solanum lycopersicum
ref|XP_006348322.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         215   6e-65   Solanum tuberosum [potatoes]
ref|XP_006442405.1|  hypothetical protein CICLE_v10020608mg             213   7e-65   
ref|XP_009769712.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         214   7e-65   Nicotiana sylvestris
ref|XP_006442406.1|  hypothetical protein CICLE_v10020608mg             214   1e-64   
ref|XP_009630845.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         214   2e-64   Nicotiana tomentosiformis
ref|XP_010064498.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         210   2e-64   
gb|AFK48386.1|  unknown                                                 213   2e-64   Lotus japonicus
ref|XP_006360033.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         213   4e-64   Solanum tuberosum [potatoes]
ref|XP_006442396.1|  hypothetical protein CICLE_v10021719mg             210   5e-64   
ref|XP_006442404.1|  hypothetical protein CICLE_v10020608mg             214   5e-64   Citrus clementina [clementine]
ref|XP_004489007.1|  PREDICTED: gamma-glutamyl hydrolase-like           211   2e-63   Cicer arietinum [garbanzo]
ref|XP_003596306.1|  Gamma-glutamylhydrolase                            211   2e-63   Medicago truncatula
ref|NP_001234440.1|  gamma-glutamylhydrolase 2                          210   3e-63   Solanum lycopersicum
ref|XP_011098203.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         212   4e-63   Sesamum indicum [beniseed]
gb|KDO42394.1|  hypothetical protein CISIN_1g039121mg                   206   9e-63   Citrus sinensis [apfelsine]
gb|KDP46038.1|  hypothetical protein JCGZ_13484                         210   2e-62   Jatropha curcas
ref|XP_006477853.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    209   2e-62   Citrus sinensis [apfelsine]
ref|XP_010060720.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         210   2e-62   Eucalyptus grandis [rose gum]
ref|NP_001234438.1|  gamma-glutamylhydrolase 3 precursor                207   3e-62   Solanum lycopersicum
ref|XP_006348321.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         207   5e-62   Solanum tuberosum [potatoes]
ref|XP_010060723.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    207   6e-62   
ref|XP_006370106.1|  hypothetical protein POPTR_0001s39540g             206   8e-62   
ref|XP_002524523.1|  Gamma-glutamyl hydrolase precursor, putative       208   1e-61   Ricinus communis
ref|XP_004489008.1|  PREDICTED: gamma-glutamyl hydrolase-like           206   1e-61   
ref|XP_003596308.1|  Gamma-glutamylhydrolase                            205   3e-61   
gb|KDO42397.1|  hypothetical protein CISIN_1g023716mg                   202   6e-61   Citrus sinensis [apfelsine]
gb|KDO42396.1|  hypothetical protein CISIN_1g023716mg                   202   8e-61   Citrus sinensis [apfelsine]
ref|XP_006494683.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    202   9e-61   Citrus sinensis [apfelsine]
gb|KDO42395.1|  hypothetical protein CISIN_1g023716mg                   202   1e-60   Citrus sinensis [apfelsine]
ref|XP_006494682.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    202   1e-60   Citrus sinensis [apfelsine]
ref|XP_006442394.1|  hypothetical protein CICLE_v10020872mg             203   1e-60   
ref|XP_010644101.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    204   1e-60   
gb|KEH38596.1|  gamma-glutamylhydrolase                                 203   2e-60   Medicago truncatula
ref|XP_002285525.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    204   2e-60   Vitis vinifera
ref|XP_011460803.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    204   4e-60   Fragaria vesca subsp. vesca
ref|XP_008386275.1|  PREDICTED: gamma-glutamyl hydrolase 2              204   4e-60   
ref|XP_006442395.1|  hypothetical protein CICLE_v10020872mg             202   4e-60   Citrus clementina [clementine]
ref|XP_010060722.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    203   5e-60   Eucalyptus grandis [rose gum]
ref|XP_006377741.1|  hypothetical protein POPTR_0011s10890g             204   5e-60   
gb|EPS62480.1|  hypothetical protein M569_12307                         202   6e-60   Genlisea aurea
ref|XP_004294089.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    203   6e-60   Fragaria vesca subsp. vesca
ref|XP_006477852.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    202   8e-60   Citrus sinensis [apfelsine]
gb|AFK48342.1|  unknown                                                 201   8e-60   Medicago truncatula
ref|XP_010675311.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         202   9e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK41094.1|  unknown                                                 201   1e-59   Medicago truncatula
ref|XP_011002760.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         203   1e-59   Populus euphratica
ref|XP_009342915.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    202   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_009342914.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    202   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_007021919.1|  Gamma-glutamyl hydrolase 1 isoform 4               199   2e-59   
emb|CBI20168.3|  unnamed protein product                                204   3e-59   Vitis vinifera
ref|XP_007021918.1|  Gamma-glutamyl hydrolase 1 isoform 3               198   4e-59   
ref|XP_009334021.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         200   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_008345165.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    201   5e-59   
ref|XP_010242158.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    198   1e-58   
gb|KJB13015.1|  hypothetical protein B456_002G051200                    200   1e-58   Gossypium raimondii
ref|XP_002318789.2|  hypothetical protein POPTR_0012s11220g             200   2e-58   
ref|XP_011044052.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         200   2e-58   Populus euphratica
ref|XP_008463749.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         199   2e-58   Cucumis melo [Oriental melon]
ref|XP_007021916.1|  Gamma-glutamyl hydrolase 1 isoform 1               199   3e-58   
gb|KHG06555.1|  Gamma-glutamyl hydrolase -like protein                  199   3e-58   Gossypium arboreum [tree cotton]
ref|XP_006302530.1|  hypothetical protein CARUB_v10020631mg             196   5e-58   
ref|XP_010242157.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    197   8e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008226384.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         197   1e-57   Prunus mume [ume]
ref|XP_006302531.1|  hypothetical protein CARUB_v10020631mg             195   2e-57   
ref|XP_007213890.1|  hypothetical protein PRUPE_ppa006962mg             196   2e-57   Prunus persica
ref|XP_008792313.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         196   3e-57   Phoenix dactylifera
ref|XP_010924708.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    195   3e-57   Elaeis guineensis
ref|XP_009128305.1|  PREDICTED: gamma-glutamyl hydrolase 1              194   6e-57   Brassica rapa
ref|XP_004146022.1|  PREDICTED: gamma-glutamyl hydrolase-like           194   1e-56   Cucumis sativus [cucumbers]
ref|XP_010106571.1|  Gamma-glutamyl hydrolase                           195   1e-56   Morus notabilis
emb|CDY14595.1|  BnaC02g25180D                                          193   1e-56   Brassica napus [oilseed rape]
ref|XP_002441386.1|  hypothetical protein SORBIDRAFT_09g025690          193   1e-56   Sorghum bicolor [broomcorn]
ref|XP_009106586.1|  PREDICTED: gamma-glutamyl hydrolase 2              193   2e-56   Brassica rapa
ref|XP_010429696.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         193   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002887750.1|  ATGGH1                                             193   2e-56   
ref|XP_010417472.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         193   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004166066.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    195   2e-56   
ref|NP_849900.1|  gamma-glutamyl hydrolase 1                            192   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472701.1|  PREDICTED: gamma-glutamyl hydrolase 1              192   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_011082781.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         192   3e-56   
ref|NP_177987.1|  gamma-glutamyl hydrolase 1                            192   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29531.1|  hypothetical protein MIMGU_mgv1a009742mg                192   4e-56   Erythranthe guttata [common monkey flower]
emb|CDX87442.1|  BnaA07g34310D                                          192   4e-56   
ref|NP_001056052.1|  Os05g0517500                                       192   4e-56   
ref|XP_010540146.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         193   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_006389965.1|  hypothetical protein EUTSA_v10018776mg             192   6e-56   Eutrema salsugineum [saltwater cress]
dbj|BAJ98663.1|  predicted protein                                      190   9e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001185429.1|  gamma-glutamyl hydrolase 2                         191   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAC83041.1|  Strong similarity to gb|AF067141 gamma-glutamyl h...    190   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565186.2|  gamma-glutamyl hydrolase 2                            191   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429695.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         191   2e-55   Camelina sativa [gold-of-pleasure]
emb|CDX88464.1|  BnaC06g39080D                                          190   2e-55   
dbj|BAJ93186.1|  predicted protein                                      190   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568092.2|  PREDICTED: gamma-glutamyl hydrolase 2-like         190   3e-55   Brachypodium distachyon [annual false brome]
ref|XP_002887752.1|  gamma-glutamyl hydrolase 2                         190   3e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_002862660.1|  gamma-glutamyl hydrolase 2                         190   3e-55   Arabidopsis lyrata subsp. lyrata
gb|ACU20290.1|  unknown                                                 186   6e-55   Glycine max [soybeans]
gb|KFK42250.1|  hypothetical protein AALP_AA2G230700                    189   7e-55   Arabis alpina [alpine rockcress]
ref|NP_001235549.1|  gamma-glutamyl hydrolase precursor                 189   8e-55   
ref|XP_006833066.1|  hypothetical protein AMTR_s00170p00050820          189   8e-55   
ref|XP_009406770.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    189   8e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006655488.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         186   4e-54   Oryza brachyantha
ref|XP_006593481.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     187   4e-54   
gb|KFK42251.1|  hypothetical protein AALP_AA2G230800                    187   4e-54   Arabis alpina [alpine rockcress]
gb|ACG46729.1|  gamma-glutamyl hydrolase precursor                      187   4e-54   Zea mays [maize]
ref|XP_002441385.1|  hypothetical protein SORBIDRAFT_09g025680          186   7e-54   
gb|KFK42249.1|  hypothetical protein AALP_AA2G230600                    185   1e-53   Arabis alpina [alpine rockcress]
ref|XP_006477850.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    185   1e-53   Citrus sinensis [apfelsine]
ref|XP_006477849.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    185   2e-53   Citrus sinensis [apfelsine]
ref|XP_006370105.1|  hypothetical protein POPTR_0001s39540g             181   3e-53   
ref|XP_010417473.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         185   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008354553.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         181   5e-53   
ref|XP_006301184.1|  hypothetical protein CARUB_v10021583mg             182   6e-53   
ref|XP_006477848.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    184   7e-53   Citrus sinensis [apfelsine]
ref|XP_010472700.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         184   9e-53   Camelina sativa [gold-of-pleasure]
gb|KHN36905.1|  Gamma-glutamyl hydrolase                                182   2e-52   Glycine soja [wild soybean]
gb|EYU26311.1|  hypothetical protein MIMGU_mgv1a022410mg                179   9e-51   Erythranthe guttata [common monkey flower]
ref|XP_004961495.1|  PREDICTED: gamma-glutamyl hydrolase-like           177   2e-50   Setaria italica
ref|XP_009406769.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    178   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406768.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    178   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248393.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    176   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010248391.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    176   9e-50   Nelumbo nucifera [Indian lotus]
gb|EYU26310.1|  hypothetical protein MIMGU_mgv1a022815mg                173   9e-49   Erythranthe guttata [common monkey flower]
gb|EYU26304.1|  hypothetical protein MIMGU_mgv1a019206mg                172   9e-49   Erythranthe guttata [common monkey flower]
ref|XP_002441384.1|  hypothetical protein SORBIDRAFT_09g025670          170   2e-47   
gb|KJB13019.1|  hypothetical protein B456_002G051600                    169   5e-47   Gossypium raimondii
ref|XP_004146090.1|  PREDICTED: gamma-glutamyl hydrolase-like           168   1e-46   
gb|KGN55060.1|  hypothetical protein Csa_4G627110                       167   1e-46   Cucumis sativus [cucumbers]
ref|NP_001142323.1|  uncharacterized protein LOC100274493 precursor     162   1e-46   
ref|XP_002862659.1|  gamma-glutamyl hydrolase 3                         166   3e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_002887751.1|  gamma-glutamyl hydrolase 3                         166   4e-46   Arabidopsis lyrata subsp. lyrata
gb|AAM65646.1|  gamma glutamyl hydrolase, putative                      165   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177988.1|  gamma-glutamyl hydrolase 3                            165   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AES66560.2|  gamma-glutamylhydrolase                                 162   8e-45   Medicago truncatula
gb|ABK22567.1|  unknown                                                 160   4e-44   Picea sitchensis
ref|XP_004151669.1|  PREDICTED: gamma-glutamyl hydrolase-like           156   5e-44   
ref|XP_004172076.1|  PREDICTED: gamma-glutamyl hydrolase-like           160   7e-44   
gb|KGN55059.1|  hypothetical protein Csa_4G627100                       159   2e-43   Cucumis sativus [cucumbers]
ref|XP_009106581.1|  PREDICTED: probable gamma-glutamyl hydrolase 3     157   1e-42   Brassica rapa
ref|XP_003596310.1|  Gamma-glutamyl hydrolase                           154   2e-42   
gb|AES66561.2|  class I glutamine amidotransferase                      154   3e-42   Medicago truncatula
ref|XP_007149561.1|  hypothetical protein PHAVU_005G080600g             154   2e-41   Phaseolus vulgaris [French bean]
gb|AAC33745.1|  gamma-glutamyl hydrolase                                148   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324181.1|  PREDICTED: gamma-glutamylhydrolase 3 isoform X1    147   2e-39   
ref|XP_008363668.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         140   2e-38   
gb|AAL15332.1|  At1g78660/T30F21_25                                     140   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007021917.1|  Gamma-glutamyl hydrolase 1 isoform 2               139   1e-35   
ref|XP_006389966.1|  hypothetical protein EUTSA_v10018738mg             136   1e-34   
emb|CDX87443.1|  BnaA07g34300D                                          134   2e-34   
ref|XP_006442389.1|  hypothetical protein CICLE_v10024365mg             129   4e-33   
ref|XP_002984712.1|  hypothetical protein SELMODRAFT_423816             131   5e-33   Selaginella moellendorffii
ref|XP_002978801.1|  hypothetical protein SELMODRAFT_177157             130   8e-33   Selaginella moellendorffii
gb|KDO36288.1|  hypothetical protein CISIN_1g028817mg                   124   3e-31   Citrus sinensis [apfelsine]
ref|XP_001772336.1|  predicted protein                                  126   3e-31   
gb|EYU26306.1|  hypothetical protein MIMGU_mgv1a019546mg                117   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_001782403.1|  predicted protein                                  116   1e-27   
dbj|GAM18533.1|  hypothetical protein SAMD00019534_017080               108   2e-24   Acytostelium subglobosum LB1
ref|XP_011409161.1|  PREDICTED: gamma-glutamyl hydrolase A-like         104   2e-24   
ref|XP_003294636.1|  hypothetical protein DICPUDRAFT_51633              103   5e-23   Dictyostelium purpureum
ref|XP_011395864.1|  Gamma-glutamyl hydrolase A                         103   1e-22   Auxenochlorella protothecoides
gb|EFA81874.1|  peptidase C26 family protein                            103   1e-22   Heterostelium album PN500
ref|XP_005830901.1|  hypothetical protein GUITHDRAFT_72685              100   6e-22   Guillardia theta CCMP2712
ref|XP_637673.1|  peptidase C26 family protein                        99.4    2e-21   Dictyostelium discoideum AX4
ref|XP_007251560.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  98.6    4e-21   
ref|XP_007421928.1|  PREDICTED: gamma-glutamyl hydrolase              98.2    5e-21   Python bivittatus
ref|XP_003287039.1|  hypothetical protein DICPUDRAFT_31892            97.8    7e-21   Dictyostelium purpureum
ref|XP_007251559.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  97.8    9e-21   
gb|KDD74766.1|  hypothetical protein H632_c1088p1                     97.1    2e-20   Helicosporidium sp. ATCC 50920
ref|XP_011304816.1|  PREDICTED: gamma-glutamyl hydrolase B-like i...  96.7    2e-20   Fopius arisanus
ref|XP_011304814.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  96.7    2e-20   Fopius arisanus
ref|XP_011304813.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  96.7    2e-20   Fopius arisanus
ref|XP_002946185.1|  hypothetical protein VOLCADRAFT_102798           96.3    3e-20   Volvox carteri f. nagariensis
ref|XP_006113705.1|  PREDICTED: gamma-glutamyl hydrolase              96.3    3e-20   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005469772.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  95.9    4e-20   Oreochromis niloticus
gb|EMT14979.1|  Gamma-glutamyl hydrolase                              95.1    4e-20   
ref|XP_006783068.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  95.5    5e-20   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004548914.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  95.1    6e-20   
ref|XP_001696183.1|  gamma-glutamyl hydrolase                         94.4    1e-19   Chlamydomonas reinhardtii
ref|XP_005652325.1|  class I glutamine amidotransferase-like protein  93.6    2e-19   Coccomyxa subellipsoidea C-169
gb|EJY84998.1|  peptidase C26 family protein                          93.2    3e-19   Oxytricha trifallax
ref|XP_010707289.1|  PREDICTED: gamma-glutamyl hydrolase              94.0    3e-19   Meleagris gallopavo [common turkey]
gb|EJY70467.1|  peptidase C26 family protein                          93.2    3e-19   Oxytricha trifallax
ref|NP_001104645.1|  uncharacterized protein LOC563836 precursor      93.2    3e-19   Danio rerio [leopard danio]
gb|EJY70465.1|  peptidase C26 family protein                          93.2    3e-19   Oxytricha trifallax
ref|XP_004350727.1|  peptidase C26 family protein                     92.8    4e-19   Cavenderia fasciculata
ref|XP_011406398.1|  PREDICTED: gamma-glutamyl hydrolase A-like       89.7    5e-19   
ref|NP_001025598.1|  gamma-glutamyl hydrolase precursor               92.4    5e-19   Xenopus tropicalis [western clawed frog]
gb|ETN66928.1|  gamma-glutamyl hydrolase                              92.8    5e-19   Anopheles darlingi [American malaria mosquito]
gb|KDR20013.1|  Gamma-glutamyl hydrolase                              92.4    5e-19   Zootermopsis nevadensis
gb|EJY70466.1|  GATase domain containing protein                      92.0    7e-19   Oxytricha trifallax
gb|EJY69422.1|  GATase domain containing protein                      92.0    8e-19   Oxytricha trifallax
ref|XP_003391262.1|  PREDICTED: gamma-glutamyl hydrolase A-like       91.7    8e-19   
gb|EJY84997.1|  GATase domain containing protein                      92.0    8e-19   Oxytricha trifallax
ref|XP_009075416.1|  PREDICTED: gamma-glutamyl hydrolase              91.7    8e-19   Acanthisitta chloris
ref|NP_001086160.1|  gamma-glutamyl hydrolase (conjugase, folylpo...  91.7    9e-19   Xenopus laevis [clawed frog]
ref|XP_006012487.1|  PREDICTED: gamma-glutamyl hydrolase-like         91.7    9e-19   Latimeria chalumnae
ref|XP_007021921.1|  Serine-threonine protein kinase, putative        94.4    1e-18   
ref|XP_419226.4|  PREDICTED: gamma-glutamyl hydrolase                 92.8    1e-18   Gallus gallus [bantam]
ref|XP_008171736.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...  91.7    1e-18   
ref|XP_009707401.1|  PREDICTED: gamma-glutamyl hydrolase              91.3    1e-18   Cariama cristata
ref|XP_002595632.1|  hypothetical protein BRAFLDRAFT_275357           91.3    1e-18   Branchiostoma floridae
ref|XP_005645555.1|  class I glutamine amidotransferase-like protein  91.3    1e-18   Coccomyxa subellipsoidea C-169
gb|KFP61510.1|  Gamma-glutamyl hydrolase                              91.3    1e-18   Cariama cristata
gb|KFQ12123.1|  Gamma-glutamyl hydrolase                              91.3    2e-18   Leptosomus discolor
ref|XP_009950167.1|  PREDICTED: gamma-glutamyl hydrolase              91.3    2e-18   Leptosomus discolor
ref|XP_005815172.1|  PREDICTED: gamma-glutamyl hydrolase-like         89.0    2e-18   
ref|XP_001626371.1|  predicted protein                                90.5    2e-18   Nematostella vectensis
ref|XP_005288158.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  90.9    2e-18   Chrysemys picta bellii
gb|KIY93948.1|  gamma-glutamyl hydrolase                              90.1    2e-18   Monoraphidium neglectum
ref|XP_005288157.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  91.3    3e-18   Chrysemys picta bellii
ref|XP_011304818.1|  PREDICTED: gamma-glutamyl hydrolase B-like i...  90.1    3e-18   Fopius arisanus
gb|KFP82604.1|  Gamma-glutamyl hydrolase                              90.1    3e-18   Acanthisitta chloris
ref|XP_005852047.1|  hypothetical protein CHLNCDRAFT_133025           90.5    4e-18   Chlorella variabilis
ref|XP_002679966.1|  predicted protein                                90.1    4e-18   Naegleria gruberi strain NEG-M
ref|XP_006631142.1|  PREDICTED: gamma-glutamyl hydrolase-like         90.1    4e-18   
ref|XP_008406524.1|  PREDICTED: gamma-glutamyl hydrolase-like         89.7    4e-18   Poecilia reticulata
ref|XP_010288197.1|  PREDICTED: gamma-glutamyl hydrolase              89.7    4e-18   Phaethon lepturus
gb|KDR20012.1|  Gamma-glutamyl hydrolase                              89.7    4e-18   Zootermopsis nevadensis
gb|KFQ39814.1|  Gamma-glutamyl hydrolase                              89.7    4e-18   Mesitornis unicolor
gb|KFQ77761.1|  Gamma-glutamyl hydrolase                              89.7    5e-18   Phaethon lepturus
ref|XP_005988287.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  89.7    5e-18   Latimeria chalumnae
ref|XP_007559766.1|  PREDICTED: gamma-glutamyl hydrolase-like         89.7    5e-18   Poecilia formosa
ref|XP_010189075.1|  PREDICTED: gamma-glutamyl hydrolase              89.7    5e-18   Mesitornis unicolor
gb|EJY68255.1|  Putative gamma-glutamyl hydrolase                     89.7    6e-18   Oxytricha trifallax
ref|XP_009829558.1|  hypothetical protein H257_06135                  89.7    6e-18   Aphanomyces astaci
ref|XP_004359252.1|  hypothetical protein DFA_01284                   92.0    6e-18   Cavenderia fasciculata
ref|XP_010863022.1|  PREDICTED: gamma-glutamyl hydrolase-like         89.4    6e-18   Esox lucius
ref|XP_008642427.1|  PREDICTED: gamma-glutamyl hydrolase              89.4    6e-18   Corvus brachyrhynchos
ref|XP_005988286.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  89.7    8e-18   Latimeria chalumnae
gb|KFW77964.1|  Gamma-glutamyl hydrolase                              89.0    9e-18   Manacus vitellinus
ref|XP_010874408.1|  PREDICTED: RING finger protein 122 isoform X1    88.6    1e-17   
ref|XP_002595630.1|  hypothetical protein BRAFLDRAFT_275351           88.6    1e-17   Branchiostoma floridae
ref|XP_005009586.1|  PREDICTED: gamma-glutamyl hydrolase              89.4    1e-17   
gb|KFV70089.1|  Gamma-glutamyl hydrolase                              88.2    1e-17   Picoides pubescens
ref|XP_008918537.1|  PREDICTED: gamma-glutamyl hydrolase              89.0    2e-17   
ref|XP_009902444.1|  PREDICTED: gamma-glutamyl hydrolase              88.2    2e-17   Picoides pubescens
ref|XP_004068950.1|  PREDICTED: gamma-glutamyl hydrolase-like         88.2    2e-17   Oryzias latipes [Japanese rice fish]
ref|XP_011406499.1|  PREDICTED: gamma-glutamyl hydrolase A-like       87.8    2e-17   
ref|XP_008862000.1|  hypothetical protein H310_00848                  88.2    2e-17   Aphanomyces invadans
ref|XP_008861998.1|  hypothetical protein H310_00846                  88.2    2e-17   Aphanomyces invadans
ref|XP_008280794.1|  PREDICTED: gamma-glutamyl hydrolase-like         87.4    3e-17   Stegastes partitus
gb|KFO99622.1|  Gamma-glutamyl hydrolase                              87.4    3e-17   Calypte anna
emb|CDQ95945.1|  unnamed protein product                              86.3    3e-17   Oncorhynchus mykiss
ref|XP_010741799.1|  PREDICTED: gamma-glutamyl hydrolase              87.4    3e-17   Larimichthys crocea [croceine croaker]
ref|XP_005152793.1|  PREDICTED: gamma-glutamyl hydrolase              87.0    4e-17   Melopsittacus undulatus
ref|XP_005423104.1|  PREDICTED: gamma-glutamyl hydrolase              87.0    4e-17   
ref|XP_007894923.1|  PREDICTED: gamma-glutamyl hydrolase              87.0    4e-17   Callorhinchus milii [Australian ghost shark]
ref|XP_001636982.1|  predicted protein                                87.0    4e-17   Nematostella vectensis
ref|XP_006261097.1|  PREDICTED: gamma-glutamyl hydrolase              87.0    5e-17   
ref|XP_006019197.1|  PREDICTED: gamma-glutamyl hydrolase              86.7    5e-17   
gb|EFN70834.1|  Gamma-glutamyl hydrolase                              87.0    5e-17   Camponotus floridanus
ref|XP_011460805.1|  PREDICTED: gamma-glutamyl hydrolase 2-like       84.7    5e-17   Fragaria vesca subsp. vesca
gb|KFQ80861.1|  Gamma-glutamyl hydrolase                              85.9    6e-17   Phoenicopterus ruber ruber
ref|XP_002671580.1|  predicted protein                                86.3    6e-17   Naegleria gruberi strain NEG-M
ref|XP_010403523.1|  PREDICTED: gamma-glutamyl hydrolase              86.3    7e-17   
ref|XP_011252591.1|  PREDICTED: chitobiosyldiphosphodolichol beta...  89.0    7e-17   Camponotus floridanus
ref|XP_003219641.1|  PREDICTED: gamma-glutamyl hydrolase              86.3    7e-17   Anolis carolinensis [Carolina anole]
ref|XP_008490429.1|  PREDICTED: gamma-glutamyl hydrolase              87.4    7e-17   Calypte anna
ref|XP_007231561.1|  PREDICTED: gamma-glutamyl hydrolase-like         86.3    7e-17   
ref|XP_004343749.1|  gamma-glutamyl hydrolase A                       86.3    8e-17   Capsaspora owczarzaki ATCC 30864
ref|NP_998487.1|  gamma-glutamyl hydrolase precursor                  86.3    8e-17   Danio rerio [leopard danio]
pdb|4L8W|D  Chain D, Crystal Structure Of Gamma Glutamyl Hydrolas...  85.9    8e-17   Danio rerio [leopard danio]
pdb|4L8F|C  Chain C, Crystal Structure Of Gamma-glutamyl Hydrolas...  85.9    9e-17   Danio rerio [leopard danio]
ref|XP_005479735.1|  PREDICTED: gamma-glutamyl hydrolase              85.9    1e-16   
ref|XP_009993891.1|  PREDICTED: gamma-glutamyl hydrolase              85.9    1e-16   Chaetura pelagica
ref|XP_003485074.1|  PREDICTED: gamma-glutamyl hydrolase-like         85.9    1e-16   
ref|XP_006860125.1|  PREDICTED: gamma-glutamyl hydrolase              85.9    1e-16   Chrysochloris asiatica
gb|KFU88050.1|  Gamma-glutamyl hydrolase                              85.5    1e-16   Chaetura pelagica
gb|KCW67540.1|  hypothetical protein EUGRSUZ_F01289                   84.0    1e-16   Eucalyptus grandis [rose gum]
ref|XP_009088479.1|  PREDICTED: gamma-glutamyl hydrolase              86.3    2e-16   
gb|KFW72792.1|  Gamma-glutamyl hydrolase                              84.7    2e-16   Pygoscelis adeliae
ref|XP_001636983.1|  predicted protein                                85.1    2e-16   
ref|XP_009330385.1|  PREDICTED: gamma-glutamyl hydrolase              84.7    2e-16   
ref|XP_005517480.1|  PREDICTED: gamma-glutamyl hydrolase              86.3    2e-16   
gb|KGL82032.1|  Gamma-glutamyl hydrolase                              84.7    2e-16   
ref|XP_010219839.1|  PREDICTED: gamma-glutamyl hydrolase              84.7    2e-16   
gb|KFV98034.1|  Gamma-glutamyl hydrolase                              84.7    2e-16   
ref|XP_009584845.1|  PREDICTED: gamma-glutamyl hydrolase              84.7    2e-16   
ref|XP_009864501.1|  PREDICTED: gamma-glutamyl hydrolase              84.7    3e-16   
ref|XP_006623115.1|  PREDICTED: chitobiosyldiphosphodolichol beta...  87.0    3e-16   
gb|KFP85763.1|  Gamma-glutamyl hydrolase                              84.3    3e-16   
gb|KFO85082.1|  Gamma-glutamyl hydrolase                              84.3    3e-16   
ref|XP_010139831.1|  PREDICTED: gamma-glutamyl hydrolase              84.3    3e-16   
ref|XP_003398804.1|  PREDICTED: gamma-glutamyl hydrolase A-like       84.7    3e-16   
ref|XP_636287.1|  peptidase C26 family protein                        84.7    3e-16   
ref|XP_005231600.1|  PREDICTED: gamma-glutamyl hydrolase              84.3    3e-16   
ref|XP_002197287.2|  PREDICTED: gamma-glutamyl hydrolase              85.5    3e-16   
gb|KFW90224.1|  Gamma-glutamyl hydrolase                              84.0    3e-16   
ref|XP_006623113.1|  PREDICTED: chitobiosyldiphosphodolichol beta...  86.7    3e-16   
ref|XP_008306468.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...  84.3    3e-16   
ref|XP_005943739.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  84.3    3e-16   
ref|XP_009501530.1|  PREDICTED: gamma-glutamyl hydrolase              84.0    3e-16   
gb|KFV06368.1|  Gamma-glutamyl hydrolase                              84.0    3e-16   
gb|KFQ20983.1|  Gamma-glutamyl hydrolase                              84.0    4e-16   
ref|XP_008945346.1|  PREDICTED: gamma-glutamyl hydrolase              84.0    4e-16   
gb|AAI34126.1|  LOC553228 protein                                     84.3    4e-16   
ref|XP_009460946.1|  PREDICTED: gamma-glutamyl hydrolase              84.0    4e-16   
ref|XP_005943740.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  84.3    4e-16   
dbj|BAN21547.1|  gamma-glutamyl hydrolase, putative                   84.0    4e-16   
ref|XP_006623112.1|  PREDICTED: chitobiosyldiphosphodolichol beta...  86.7    4e-16   
ref|XP_003968229.1|  PREDICTED: gamma-glutamyl hydrolase-like         84.0    4e-16   
ref|XP_009971297.1|  PREDICTED: gamma-glutamyl hydrolase              84.0    4e-16   
ref|XP_002595631.1|  hypothetical protein BRAFLDRAFT_200938           84.0    4e-16   
gb|KFQ95121.1|  Gamma-glutamyl hydrolase                              84.0    4e-16   
gb|KFV58816.1|  Gamma-glutamyl hydrolase                              84.0    4e-16   
gb|KFP55993.1|  Gamma-glutamyl hydrolase                              84.0    4e-16   
ref|XP_009632417.1|  PREDICTED: gamma-glutamyl hydrolase              84.0    4e-16   
gb|KFP45914.1|  Gamma-glutamyl hydrolase                              84.0    4e-16   
ref|XP_005443321.1|  PREDICTED: gamma-glutamyl hydrolase              84.0    5e-16   
gb|KFP27811.1|  Gamma-glutamyl hydrolase                              83.6    5e-16   
ref|XP_010198415.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
ref|XP_010127038.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
gb|KFP12067.1|  Gamma-glutamyl hydrolase                              83.6    5e-16   
ref|XP_008319045.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  84.3    5e-16   
ref|XP_010016975.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
ref|XP_004072343.2|  PREDICTED: gamma-glutamyl hydrolase-like         84.0    5e-16   
ref|XP_009924525.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
gb|KFQ53384.1|  Gamma-glutamyl hydrolase                              83.6    5e-16   
ref|XP_010298803.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
gb|KFQ09872.1|  Gamma-glutamyl hydrolase                              83.6    5e-16   
gb|KFO09908.1|  Gamma-glutamyl hydrolase                              83.6    5e-16   
ref|XP_010581262.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
ref|XP_009888091.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    5e-16   
gb|KGL97086.1|  Gamma-glutamyl hydrolase                              83.6    5e-16   
gb|KDO31557.1|  hypothetical protein SPRG_03486                       84.0    6e-16   
ref|XP_009811210.1|  PREDICTED: gamma-glutamyl hydrolase              83.2    6e-16   
gb|KFV43190.1|  Gamma-glutamyl hydrolase                              83.2    6e-16   
ref|XP_010984857.1|  PREDICTED: gamma-glutamyl hydrolase              83.6    6e-16   
gb|KFB47116.1|  AGAP006670-PA-like protein                            84.3    7e-16   
gb|KDO17663.1|  hypothetical protein SPRG_16945                       83.6    7e-16   
gb|KFM01460.1|  Gamma-glutamyl hydrolase                              83.2    7e-16   
gb|ELT93533.1|  hypothetical protein CAPTEDRAFT_104938                83.2    8e-16   
ref|XP_002504273.1|  predicted protein                                82.8    8e-16   
ref|XP_009283787.1|  PREDICTED: gamma-glutamyl hydrolase              83.2    8e-16   
gb|EFZ17480.1|  hypothetical protein SINV_12245                       83.6    8e-16   
ref|XP_009829556.1|  hypothetical protein H257_06133                  83.6    8e-16   
ref|XP_004081412.1|  PREDICTED: gamma-glutamyl hydrolase-like         83.2    8e-16   
ref|XP_008609246.1|  hypothetical protein SDRG_05311                  83.2    9e-16   
gb|AAH93328.1|  LOC553228 protein                                     83.2    9e-16   
gb|AAI24119.1|  LOC553228 protein                                     83.2    9e-16   
ref|XP_010968962.1|  PREDICTED: gamma-glutamyl hydrolase              83.2    9e-16   
ref|XP_011160978.1|  PREDICTED: gamma-glutamyl hydrolase-like         83.6    1e-15   
ref|XP_004372622.1|  PREDICTED: gamma-glutamyl hydrolase              83.2    1e-15   
gb|AAI54503.1|  LOC553228 protein                                     83.2    1e-15   
gb|ACI66462.1|  Gamma-glutamyl hydrolase precursor                    82.8    1e-15   
ref|XP_003505759.2|  PREDICTED: gamma-glutamyl hydrolase isoform X1   82.8    1e-15   
gb|AAH76459.1|  LOC553228 protein                                     83.2    1e-15   
ref|XP_008544457.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  83.2    1e-15   
ref|NP_001243151.1|  gamma-glutamyl hydrolase precursor               82.8    1e-15   
gb|KFO77933.1|  Gamma-glutamyl hydrolase                              82.8    1e-15   
ref|XP_007613199.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2   82.8    1e-15   
ref|XP_008861999.1|  hypothetical protein H310_00847                  83.2    1e-15   
gb|KFV00608.1|  Gamma-glutamyl hydrolase                              82.4    1e-15   
emb|CDW89591.1|  gamma-glutamyl hydrolase 1                           83.6    1e-15   
ref|XP_009936040.1|  PREDICTED: gamma-glutamyl hydrolase              82.8    1e-15   
gb|KFR13230.1|  Gamma-glutamyl hydrolase                              82.4    1e-15   
ref|XP_009561586.1|  PREDICTED: gamma-glutamyl hydrolase              82.8    1e-15   
ref|XP_008287386.1|  PREDICTED: gamma-glutamyl hydrolase-like         82.8    1e-15   
ref|XP_003759794.1|  PREDICTED: gamma-glutamyl hydrolase              82.8    1e-15   
ref|XP_010071123.1|  PREDICTED: gamma-glutamyl hydrolase              82.4    1e-15   
ref|XP_009979902.1|  PREDICTED: gamma-glutamyl hydrolase              82.4    1e-15   
ref|XP_008214312.1|  PREDICTED: gamma-glutamyl hydrolase A-like i...  82.8    1e-15   
emb|CDQ65392.1|  unnamed protein product                              82.4    2e-15   
gb|KFQ48775.1|  Gamma-glutamyl hydrolase                              81.3    2e-15   
gb|EMC87051.1|  Gamma-glutamyl hydrolase                              82.0    2e-15   
ref|XP_002156669.1|  PREDICTED: gamma-glutamyl hydrolase A-like       82.4    2e-15   
gb|KFW02734.1|  Gamma-glutamyl hydrolase                              82.0    2e-15   
ref|XP_001601392.2|  PREDICTED: gamma-glutamyl hydrolase A-like i...  82.4    2e-15   
ref|XP_009491367.1|  PREDICTED: gamma-glutamyl hydrolase              81.3    2e-15   
ref|XP_003294635.1|  hypothetical protein DICPUDRAFT_73725            82.0    2e-15   
ref|XP_316706.4|  AGAP006670-PA                                       83.2    2e-15   
ref|XP_003999883.1|  PREDICTED: gamma-glutamyl hydrolase              82.4    2e-15   
ref|XP_007937663.1|  PREDICTED: gamma-glutamyl hydrolase              82.4    2e-15   
gb|KFZ55994.1|  Gamma-glutamyl hydrolase                              82.0    2e-15   
ref|XP_010147217.1|  PREDICTED: gamma-glutamyl hydrolase              82.0    2e-15   
ref|XP_004912572.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  82.0    2e-15   
ref|XP_005042227.1|  PREDICTED: gamma-glutamyl hydrolase              82.0    2e-15   
ref|XP_005847461.1|  hypothetical protein CHLNCDRAFT_52559            82.8    2e-15   
ref|XP_002905277.1|  gamma-glutamyl hydrolase, putative               81.6    3e-15   
ref|XP_001513787.2|  PREDICTED: gamma-glutamyl hydrolase              81.6    3e-15   
ref|XP_002740732.1|  PREDICTED: gamma-glutamyl hydrolase-like         81.6    3e-15   
emb|CCI46683.1|  unnamed protein product                              81.6    3e-15   
ref|NP_037092.1|  gamma-glutamyl hydrolase precursor                  81.6    3e-15   
ref|XP_005730484.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  81.3    4e-15   
gb|KFZ45669.1|  Gamma-glutamyl hydrolase                              80.9    4e-15   
ref|XP_010175281.1|  PREDICTED: gamma-glutamyl hydrolase              80.9    4e-15   
ref|XP_004551881.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  81.3    4e-15   
ref|XP_004551882.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  81.3    4e-15   
ref|XP_005730485.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  81.3    4e-15   
emb|CDQ59361.1|  unnamed protein product                              80.9    5e-15   
gb|EFX77408.1|  hypothetical protein DAPPUDRAFT_305752                81.3    5e-15   
ref|XP_004551883.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.9    5e-15   
ref|XP_009671852.1|  PREDICTED: gamma-glutamyl hydrolase              80.9    5e-15   
ref|XP_001926738.1|  PREDICTED: gamma-glutamyl hydrolase              80.9    5e-15   
ref|XP_006799272.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.5    5e-15   
ref|XP_005449148.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.9    5e-15   
ref|XP_002710570.1|  PREDICTED: gamma-glutamyl hydrolase              80.9    6e-15   
gb|KFV80511.1|  Gamma-glutamyl hydrolase                              80.5    6e-15   
ref|XP_003439349.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.9    6e-15   
ref|XP_009521534.1|  hypothetical protein PHYSODRAFT_359609           80.9    6e-15   
ref|XP_787753.2|  PREDICTED: gamma-glutamyl hydrolase-like            80.9    6e-15   
ref|XP_006300958.1|  hypothetical protein CARUB_v10021346mg           80.1    7e-15   
gb|EHJ77729.1|  putative gamma-glutamyl hydrolase                     80.1    7e-15   
ref|XP_010775082.1|  PREDICTED: gamma-glutamyl hydrolase-like         80.5    7e-15   
ref|XP_006799271.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.5    7e-15   
ref|XP_011139565.1|  PREDICTED: gamma-glutamyl hydrolase A-like       80.9    9e-15   
gb|AAH87532.1|  LOC496099 protein                                     80.5    9e-15   
ref|XP_010751434.1|  PREDICTED: gamma-glutamyl hydrolase-like         79.3    9e-15   
emb|CDW77115.1|  gamma-glutamyl hydrolase a-like                      79.7    9e-15   
ref|XP_007231124.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.1    9e-15   
gb|ETI36148.1|  hypothetical protein F443_17672                       80.1    1e-14   
gb|AAI08439.1|  LOC496099 protein                                     80.1    1e-14   
ref|XP_005066278.1|  PREDICTED: gamma-glutamyl hydrolase              80.1    1e-14   
gb|ETL83038.1|  hypothetical protein L917_16928                       80.1    1e-14   
ref|XP_008896163.1|  hypothetical protein PPTG_04091                  80.1    1e-14   
ref|XP_007231126.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  80.1    1e-14   
ref|XP_005506577.1|  PREDICTED: gamma-glutamyl hydrolase              79.7    1e-14   
gb|ACO09704.1|  Gamma-glutamyl hydrolase precursor                    80.9    1e-14   
ref|XP_007557581.1|  PREDICTED: gamma-glutamyl hydrolase-like         80.1    1e-14   
ref|XP_004435789.1|  PREDICTED: gamma-glutamyl hydrolase              80.1    1e-14   
gb|EMS68709.1|  Gamma-glutamyl hydrolase                              80.1    1e-14   
gb|AEE63428.1|  unknown                                               80.1    1e-14   
gb|ERL92913.1|  hypothetical protein D910_10218                       80.1    1e-14   
ref|XP_007231125.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  79.7    1e-14   
ref|XP_011310326.1|  PREDICTED: gamma-glutamyl hydrolase-like         80.5    1e-14   
ref|XP_008186640.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  79.3    1e-14   
gb|ACI68420.1|  Gamma-glutamyl hydrolase precursor                    79.7    1e-14   
ref|XP_005361968.1|  PREDICTED: gamma-glutamyl hydrolase              79.7    1e-14   
ref|XP_008334216.1|  PREDICTED: gamma-glutamyl hydrolase-like         80.9    1e-14   
ref|XP_004011748.1|  PREDICTED: gamma-glutamyl hydrolase              79.7    2e-14   
emb|CDQ81962.1|  unnamed protein product                              79.7    2e-14   
ref|NP_001192053.1|  gamma-glutamyl hydrolase-like precursor          79.3    2e-14   
ref|XP_005182857.1|  PREDICTED: gamma-glutamyl hydrolase              80.5    2e-14   
ref|XP_006537682.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1   79.0    2e-14   
ref|XP_001621066.1|  hypothetical protein NEMVEDRAFT_v1g248720        79.3    2e-14   
ref|XP_005795110.1|  PREDICTED: gamma-glutamyl hydrolase-like         79.0    2e-14   
ref|XP_002740734.1|  PREDICTED: gamma-glutamyl hydrolase-like         79.0    2e-14   
ref|NP_034411.2|  gamma-glutamyl hydrolase precursor                  79.0    3e-14   
gb|AAI50899.1|  Gamma-glutamyl hydrolase                              79.0    3e-14   
ref|XP_008319046.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  79.0    3e-14   
gb|EGW11198.1|  Gamma-glutamyl hydrolase                              78.6    3e-14   
ref|XP_004931467.1|  PREDICTED: gamma-glutamyl hydrolase A-like       79.7    3e-14   
ref|XP_001440195.1|  hypothetical protein                             78.6    3e-14   
ref|XP_001030684.1|  glutamine aminotransferase class-I family pr...  79.0    3e-14   
ref|XP_010884125.1|  PREDICTED: gamma-glutamyl hydrolase-like         78.2    4e-14   
emb|CCA21597.1|  gammaglutamyl hydrolase putative                     78.2    4e-14   
ref|XP_004679905.1|  PREDICTED: gamma-glutamyl hydrolase              78.2    4e-14   
ref|XP_008319044.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  79.0    4e-14   
ref|XP_007455320.1|  PREDICTED: gamma-glutamyl hydrolase              78.2    5e-14   
ref|XP_006734306.1|  PREDICTED: gamma-glutamyl hydrolase              78.2    5e-14   
ref|XP_008704953.1|  PREDICTED: gamma-glutamyl hydrolase              78.2    6e-14   
ref|XP_011401628.1|  Gamma-glutamyl hydrolase A                       79.0    6e-14   
ref|XP_007168627.1|  PREDICTED: gamma-glutamyl hydrolase              77.8    6e-14   
ref|XP_004697814.1|  PREDICTED: gamma-glutamyl hydrolase              77.4    7e-14   
gb|KDO26475.1|  hypothetical protein SPRG_08278                       78.2    7e-14   
ref|XP_006634071.1|  PREDICTED: gamma-glutamyl hydrolase-like         77.8    7e-14   
ref|XP_008835806.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2   77.8    7e-14   
ref|XP_004588067.1|  PREDICTED: gamma-glutamyl hydrolase              77.8    8e-14   
ref|XP_006819111.1|  PREDICTED: gamma-glutamyl hydrolase-like         77.0    8e-14   
gb|AIG55950.1|  secreted protein                                      77.8    8e-14   
ref|XP_007085095.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...  77.0    9e-14   
gb|AAC70003.1|  gamma-glutamyl hydrolase precursor                    77.4    9e-14   
gb|KJE91422.1|  hypothetical protein CAOG_008619                      77.4    9e-14   
ref|XP_011270219.1|  hypothetical protein CAOG_08619                  77.8    1e-13   
ref|XP_006625568.1|  PREDICTED: gamma-glutamyl hydrolase-like         77.8    1e-13   
gb|KDO17147.1|  hypothetical protein SPRG_17396                       77.8    1e-13   
ref|XP_001767124.1|  predicted protein                                77.8    1e-13   
ref|XP_008589768.1|  PREDICTED: gamma-glutamyl hydrolase              77.4    1e-13   
ref|XP_002166069.2|  PREDICTED: gamma-glutamyl hydrolase A-like       77.4    1e-13   
ref|XP_001654804.1|  AAEL000271-PC                                    77.4    1e-13   
ref|XP_002929972.2|  PREDICTED: gamma-glutamyl hydrolase              76.3    1e-13   
ref|XP_001654803.1|  AAEL000271-PA                                    77.8    1e-13   
ref|XP_003408374.1|  PREDICTED: gamma-glutamyl hydrolase              77.0    1e-13   
ref|XP_002819168.1|  PREDICTED: gamma-glutamyl hydrolase              77.0    1e-13   
ref|XP_004327416.1|  PREDICTED: gamma-glutamyl hydrolase isoform 1    77.0    1e-13   
ref|XP_008416492.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  76.6    2e-13   
ref|XP_001013320.3|  glutamine amidotransferase class-I family pr...  77.0    2e-13   
ref|XP_004327417.1|  PREDICTED: gamma-glutamyl hydrolase isoform 2    76.6    2e-13   
ref|XP_005323027.1|  PREDICTED: gamma-glutamyl hydrolase              76.6    2e-13   
ref|XP_004275026.1|  PREDICTED: gamma-glutamyl hydrolase              76.6    2e-13   
ref|XP_001654802.1|  AAEL000271-PB                                    77.4    2e-13   
ref|XP_003747812.1|  PREDICTED: gamma-glutamyl hydrolase A-like       76.3    2e-13   
ref|XP_008416491.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...  76.6    2e-13   
gb|AIG55455.1|  secreted protein                                      76.6    2e-13   
ref|XP_004814095.1|  PREDICTED: gamma-glutamyl hydrolase              76.6    2e-13   
ref|XP_008214314.1|  PREDICTED: gamma-glutamyl hydrolase A-like i...  76.3    2e-13   
ref|XP_001700978.1|  gamma-glutamyl hydrolase                         77.4    2e-13   
ref|XP_004773000.1|  PREDICTED: gamma-glutamyl hydrolase              76.6    2e-13   
ref|XP_004335738.1|  gammaglutamyl hydrolase, putative                77.0    2e-13   
gb|KIZ06309.1|  gamma-glutamyl hydrolase                              77.0    2e-13   
ref|XP_005392230.1|  PREDICTED: gamma-glutamyl hydrolase              76.6    2e-13   
ref|XP_007892422.1|  PREDICTED: gamma-glutamyl hydrolase-like         76.6    2e-13   



>ref|XP_009803991.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Nicotiana sylvestris]
Length=337

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             GCP PDP LNYRPVIGI+SHPGDGASGRI N+T VSY+AAS VKFVESAGARVIPL+++
Sbjct  30   AGCPVPDPRLNYRPVIGIISHPGDGASGRIVNSTSVSYVAASYVKFVESAGARVIPLLFD  89

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            +  + L +KL+LVNGV+FPGG   KG+Y E +K I+KKVLEKND G++FPLLAINLGF+L
Sbjct  90   DSPQVLNQKLDLVNGVIFPGGWARKGKYFETVKAIFKKVLEKNDAGEHFPLLAINLGFEL  149

Query  510  LTIIVSEDNIILEKFSASXQASTLQVV  590
            L +IVS+DN ILEKFS S QAS L  V
Sbjct  150  LMMIVSKDNNILEKFSVSNQASKLHFV  176



>ref|XP_007149562.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris]
 gb|ESW21556.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris]
Length=342

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  CPAPDP+L Y+PVIGIVSHPGDGASGR+SN TGVSYIAAS VKFVE+AGARV+PLIY
Sbjct  39   TTSCPAPDPNLYYQPVIGIVSHPGDGASGRLSNETGVSYIAASYVKFVEAAGARVVPLIY  98

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L+KKL LVNGV+F GG  + G Y E + +I+KK+LEKND GD+FPL A+ LGF+
Sbjct  99   NEPPEKLLKKLELVNGVLFTGGWAKNGLYFETVTKIFKKILEKNDAGDHFPLYAVCLGFE  158

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            L+T+I+SEDN ILE+F+AS QAST+Q V
Sbjct  159  LITMIISEDNNILEEFTASNQASTIQFV  186



>ref|XP_009605608.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Nicotiana tomentosiformis]
Length=340

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             GCP PDP LNYRPVIGIVSHPGDGASGRI N+T VSYIAAS VKFVESAGARVIPL++ 
Sbjct  33   AGCPVPDPRLNYRPVIGIVSHPGDGASGRIVNSTSVSYIAASYVKFVESAGARVIPLLFE  92

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            +  + L +KLNLVNGV+FPGG  +KG+Y E +K I+KKVLEKND  ++FPLLAINLGF+L
Sbjct  93   DSPQVLNQKLNLVNGVIFPGGWAKKGKYFETIKAIFKKVLEKNDADEHFPLLAINLGFEL  152

Query  510  LTIIVSEDNIILEKFSASXQASTLQVV  590
            L +IVS+DN ILEKFS S QAS L  V
Sbjct  153  LMMIVSKDNNILEKFSVSNQASKLHFV  179



>emb|CDP06032.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  KLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  320
            +LS  CPAPDP LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPL
Sbjct  94   RLSPSCPAPDPKLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPL  153

Query  321  IYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            IYNEP E L  KL+LVNGV+F GG  + G Y + +  ++K+VLEKND GD+FPL+AI LG
Sbjct  154  IYNEPLEVLEMKLSLVNGVLFTGGWAKSGLYFDVVGTVFKRVLEKNDAGDHFPLVAICLG  213

Query  501  FQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            F+LLT+I+S+DN ILE+FSA+ QASTLQ V
Sbjct  214  FELLTMIISKDNDILEQFSAADQASTLQFV  243



>ref|XP_003543198.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Glycine max]
Length=342

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPDP+L Y+PVIGIVSHPGDGASGR+SNATG SYIAAS VKFVE+AGARV+PLIY EP
Sbjct  42   CPAPDPNLYYKPVIGIVSHPGDGASGRLSNATGASYIAASYVKFVEAAGARVVPLIYTEP  101

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L+KKL LVNGV+F GG  + G Y E + +I+KK+LEKND GD+FPL A  LGF+L+T
Sbjct  102  PEKLLKKLELVNGVLFTGGWAKSGLYFETVTKIFKKILEKNDAGDHFPLFATCLGFELIT  161

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+DN ILE+FSAS QASTLQ V
Sbjct  162  MIISQDNNILEEFSASNQASTLQFV  186



>dbj|BAO57292.1| gamma-glutamyl hydrolase [Ipomoea nil]
Length=343

 Score =   217 bits (553),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPD  LNYRPVIGIVSHPGDGA  R SNA+ VSYIAAS VKFVESAGARVIPLIYNEP
Sbjct  37   CPAPDGDLNYRPVIGIVSHPGDGAKSRFSNASDVSYIAASYVKFVESAGARVIPLIYNEP  96

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E LI+KLNLVNGV+F GGS +KG Y E +K I++KVLEKND GD+FPLLAI LGF+LLT
Sbjct  97   PEILIQKLNLVNGVLFTGGSSKKGLYFEVVKGIFQKVLEKNDAGDHFPLLAICLGFELLT  156

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+++DN ILE F+A+ QAS LQ V
Sbjct  157  MIITKDNNILEGFNAANQASKLQFV  181



>ref|XP_003596307.1| Gamma-glutamylhydrolase [Medicago truncatula]
Length=199

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPDP+L Y+PVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVE+AGARV+PLIY EP
Sbjct  43   CPAPDPNLYYQPVIGIVSHPGDGASGRLSNATDASYIAASYVKFVEAAGARVVPLIYTEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L+KKL LVNGV+F GG  + G Y E ++ I+KKVLEKND GD FPL A  LGF+L++
Sbjct  103  EEILLKKLELVNGVLFTGGWAKDGLYFETVRRIFKKVLEKNDAGDYFPLYATCLGFELIS  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE+FSA  QAS+LQ V
Sbjct  163  MIISEDNNILEEFSARNQASSLQFV  187



>ref|NP_001234434.1| gamma-glutamylhydrolase 1 precursor [Solanum lycopersicum]
 gb|ACC86848.1| gamma-glutamylhydrolase 1 [Solanum lycopersicum]
Length=340

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  117  SYLLNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVES  296
            S L N+   L   CPAPDP+LNYRP+IGIVSHPGDGA+GR+SNAT VSYIAAS VKF E 
Sbjct  21   SQLFNSYLTLPSSCPAPDPALNYRPIIGIVSHPGDGATGRLSNATNVSYIAASYVKFAEM  80

Query  297  AGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNF  476
            AGARVIPLIY EP + L +KLNLVNG++F GG  + G Y + +K I++KVLEKND G++F
Sbjct  81   AGARVIPLIYTEPPQVLNQKLNLVNGIIFTGGWAKDGLYFDVIKGIFQKVLEKNDAGEHF  140

Query  477  PLLAINLGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            PLLAI LG++LLT+I++ DN ILE+FSA+ QAST+Q V
Sbjct  141  PLLAICLGYELLTMIITNDNNILEEFSAASQASTVQFV  178



>ref|XP_006348322.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum]
Length=340

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +3

Query  108  TPFSYLLNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKF  287
            T  S L  +N  L   CPAPDP+LNYRP+IGIVSHPGDGA+GR+SNAT VSYIAAS VKF
Sbjct  18   TSQSQLFVSNQILPPSCPAPDPTLNYRPIIGIVSHPGDGATGRLSNATNVSYIAASYVKF  77

Query  288  VESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGG  467
             E AGARVIPLIY EP E L +KLNLVNG++F GG  + G Y + +K I++KVLEKND G
Sbjct  78   AEMAGARVIPLIYTEPPEVLNQKLNLVNGIIFTGGWAKDGLYFDVIKGIFQKVLEKNDAG  137

Query  468  DNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            ++FPLLAI LG++LLT+I++ DN ILE+FSA+ QAST+Q V
Sbjct  138  EHFPLLAICLGYELLTMIITNDNNILEEFSAASQASTVQFV  178



>ref|XP_006442405.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55645.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=291

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  78   FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  137

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            +NEP E L +KL LVNG+++PGG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  138  FNEPEEILFEKLELVNGILYPGGWAKNGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  197

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +LL++IVSED  ILE F  + QASTLQ V
Sbjct  198  ELLSMIVSEDRNILETFDGANQASTLQFV  226



>ref|XP_009769712.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Nicotiana sylvestris]
 gb|AIE54277.1| gamma-glutamylhydrolase 2 [Nicotiana tabacum]
Length=342

 Score =   214 bits (546),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CP PDP+LNYRPVIGIVSHPGDGASGR++N T VSYIAAS VKF E AGARVIPLIY E
Sbjct  35   SCPGPDPTLNYRPVIGIVSHPGDGASGRLNNGTDVSYIAASYVKFAEMAGARVIPLIYTE  94

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E L +KLNLVNGV+F GG  + G Y E +K I++KVLEKND G++FPLLAI LGF+LL
Sbjct  95   PPEILNQKLNLVNGVIFTGGRVKDGLYFEVVKGIFQKVLEKNDAGEHFPLLAICLGFELL  154

Query  513  TIIVSEDNIILEKFSASXQASTLQVV  590
            T+I+S+DN ILE+FSA+ QAST+Q V
Sbjct  155  TMIISKDNNILEEFSAANQASTVQFV  180



>ref|XP_006442406.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55646.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=328

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  78   FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  137

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            +NEP E L +KL LVNG+++PGG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  138  FNEPEEILFEKLELVNGILYPGGWAKNGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  197

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +LL++IVSED  ILE F  + QASTLQ V
Sbjct  198  ELLSMIVSEDRNILETFDGANQASTLQFV  226



>ref|XP_009630845.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Nicotiana tomentosiformis]
Length=341

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CP PDP+LNYRPVIGIVSHPGDGASGR++N T VSYIAAS VKF E AGARVIPLIY+E
Sbjct  34   SCPGPDPTLNYRPVIGIVSHPGDGASGRLNNGTDVSYIAASYVKFAEMAGARVIPLIYSE  93

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E L +KLNLVNGV+F GG  + G Y E +K I++KVLEKND G++FPLLAI LGF+LL
Sbjct  94   PPEILNQKLNLVNGVIFTGGRVKDGLYFEVVKGIFQKVLEKNDAGEHFPLLAICLGFELL  153

Query  513  TIIVSEDNIILEKFSASXQASTLQVV  590
            T+I+S+DN ILE+FSA+ QAST+Q +
Sbjct  154  TMIISKDNNILEEFSAANQASTVQFM  179



>ref|XP_010064498.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Eucalyptus grandis]
Length=220

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  CPAPDP LN+RPVIGI+SHPGDGASGR+SNA+  S+I AS VKFVESAGARVIPLIY
Sbjct  37   AADCPAPDPKLNFRPVIGILSHPGDGASGRLSNASDASFIPASYVKFVESAGARVIPLIY  96

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L++KLN+VNGV+F GG    G Y E ++ I+KKVL KND GD+FPL A  LGFQ
Sbjct  97   NEPQEVLLEKLNMVNGVLFTGGWASTGLYYETVEAIFKKVLAKNDAGDHFPLYATCLGFQ  156

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            LLT+IVS+D  ILE+F+A+ QASTLQ +
Sbjct  157  LLTMIVSKDKGILEEFNAAHQASTLQFM  184



>gb|AFK48386.1| unknown [Lotus japonicus]
Length=342

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAP+P+L Y+PVIGIV+HPGDGA+GR+SN TG SYIAAS VKFVE+AGARV+PLIYNEP
Sbjct  42   CPAPNPNLYYQPVIGIVTHPGDGATGRLSNTTGASYIAASYVKFVEAAGARVVPLIYNEP  101

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
            TE L KKL LVNGV+F GG  + G Y E +  I+KK LEKND GD+FP+ AI LGF+L+T
Sbjct  102  TEKLFKKLELVNGVLFTGGWAKSGLYFETIGRIFKKALEKNDAGDHFPIYAICLGFELIT  161

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVS+DN ILE+F AS QASTLQ V
Sbjct  162  MIVSKDNNILEEFCASNQASTLQFV  186



>ref|XP_006360033.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum]
Length=344

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CPA DP+LNYRPVIGIVSHPGDGASGR++NA+ VSYIAAS VKF E AGARVIP+IY E
Sbjct  36   SCPATDPALNYRPVIGIVSHPGDGASGRLNNASDVSYIAASYVKFAEMAGARVIPIIYTE  95

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E + +KLNLVNG++F GG  +KG Y E +K I++KVLEKND G++FPLLAI LGF+LL
Sbjct  96   PPEIINQKLNLVNGIIFTGGWSKKGLYFEVVKGIFEKVLEKNDAGEHFPLLAICLGFELL  155

Query  513  TIIVSEDNIILEKFSASXQASTLQVV  590
            T+I+S+DN ILE+FSAS QAST+Q V
Sbjct  156  TMIISKDNNILEEFSASHQASTVQFV  181



>ref|XP_006442396.1| hypothetical protein CICLE_v10021719mg [Citrus clementina]
 gb|ESR55636.1| hypothetical protein CICLE_v10021719mg [Citrus clementina]
Length=265

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  52   FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  111

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            +NEP E L +KL LVNG+++ GG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  112  FNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  171

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +LL++IVSED  ILE F  + QASTLQ V
Sbjct  172  ELLSMIVSEDRNILETFDGANQASTLQFV  200



>ref|XP_006442404.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 ref|XP_006442407.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55644.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55647.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=380

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  78   FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  137

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            +NEP E L +KL LVNG+++PGG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  138  FNEPEEILFEKLELVNGILYPGGWAKNGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  197

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +LL++IVSED  ILE F  + QASTLQ V
Sbjct  198  ELLSMIVSEDRNILETFDGANQASTLQFV  226



>ref|XP_004489007.1| PREDICTED: gamma-glutamyl hydrolase-like [Cicer arietinum]
Length=343

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
              CPAP+P+L YRPVIGI+SHPGDGASGR++NAT +SYIAAS VKFVE+AGARV+PLI+ 
Sbjct  43   ASCPAPNPNLYYRPVIGILSHPGDGASGRLNNATDISYIAASYVKFVEAAGARVVPLIFT  102

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            EPTE L+KKL LVNGV+F GG  + G Y E +K I+KK LEKND GD+FPL  + LGF+L
Sbjct  103  EPTEKLLKKLELVNGVLFTGGWAKDGLYFETVKRIFKKALEKNDAGDHFPLYGVCLGFEL  162

Query  510  LTIIVSEDNIILEKFSASXQASTLQVV  590
            +T+I+SEDN ILE+FS   QAS+LQ+V
Sbjct  163  ITMIISEDNNILEEFSGKNQASSLQIV  189



>ref|XP_003596306.1| Gamma-glutamylhydrolase [Medicago truncatula]
 gb|AES66557.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=341

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPDP+L Y+PVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVE+AGARV+PLIY EP
Sbjct  43   CPAPDPNLYYQPVIGIVSHPGDGASGRLSNATDASYIAASYVKFVEAAGARVVPLIYTEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L+KKL LVNGV+F GG  + G Y E ++ I+KKVLEKND GD FPL A  LGF+L++
Sbjct  103  EEILLKKLELVNGVLFTGGWAKDGLYFETVRRIFKKVLEKNDAGDYFPLYATCLGFELIS  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE+FSA  QAS+LQ V
Sbjct  163  MIISEDNNILEEFSARNQASSLQFV  187



>ref|NP_001234440.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum]
 gb|ACC86850.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum]
Length=344

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CPA DP+LNYRPVIGIVSHPGDGASGR++NA+ VSYIAAS VKF E AGARVIP+IY E
Sbjct  36   SCPATDPALNYRPVIGIVSHPGDGASGRLNNASDVSYIAASYVKFAEMAGARVIPIIYTE  95

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E + +KLNLVNG++F GG  +KG Y E +K I++KVLEKND G++FPLLAI LGF+LL
Sbjct  96   PPEIINQKLNLVNGIIFTGGWSKKGLYFEVVKGIFEKVLEKNDAGEHFPLLAICLGFELL  155

Query  513  TIIVSEDNIILEKFSASXQASTLQVV  590
            T+I+S+DN ILE+FSA  QAST+Q V
Sbjct  156  TMIISKDNNILEEFSALHQASTVQFV  181



>ref|XP_011098203.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Sesamum indicum]
Length=390

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP+ DP+LN+RPVIGI+SHPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  92   CPSGDPNLNFRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPLIYNEP  151

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KLNLVNGV+F GG  + G Y E ++ I+K +L KND GD+FPLLAI LGF+LLT
Sbjct  152  PQILNEKLNLVNGVIFTGGWAKSGLYFEVVESIFKNILRKNDAGDHFPLLAICLGFELLT  211

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVSEDN ILE+FSA+ QASTLQ V
Sbjct  212  MIVSEDNNILEQFSAADQASTLQFV  236



>gb|KDO42394.1| hypothetical protein CISIN_1g039121mg, partial [Citrus sinensis]
Length=232

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
                CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYI+AS VKF ES GARVIPLI
Sbjct  43   FCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLI  102

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            +NEP E L +KL LVNG+++ GG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  103  FNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  162

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +LL++IVSED  ILE F  + QASTLQ V
Sbjct  163  ELLSMIVSEDRNILETFDRANQASTLQFV  191



>gb|KDP46038.1| hypothetical protein JCGZ_13484 [Jatropha curcas]
Length=385

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPDP LNYRPVIGI+SHPGDGAS R++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  85   CPAPDPKLNYRPVIGILSHPGDGASRRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  144

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y + +K I+K+VL KND G +FPL AI LGF+LLT
Sbjct  145  PEVLFEKLNLVNGVLFTGGRVKTGLYYDIVKAIFKRVLAKNDAGYHFPLYAICLGFELLT  204

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+DN ILE F+A+ QASTLQ +
Sbjct  205  MIISKDNNILESFNATDQASTLQFM  229



>ref|XP_006477853.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=354

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  52   FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  111

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            +NEP E L +KL LVNG+++ GG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  112  FNEPEEILFEKLELVNGILYTGGWAKNGLYYDIVEKIFKKILEKNDVGDHFPVYAICLGF  171

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +LL++IVSED  ILE F  + QASTLQ V
Sbjct  172  ELLSMIVSEDRNILETFDGANQASTLQFV  200



>ref|XP_010060720.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Eucalyptus grandis]
 gb|KCW67545.1| hypothetical protein EUGRSUZ_F01299 [Eucalyptus grandis]
Length=394

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  147  SGG----CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVI  314
            SGG    CPA DP LN+RPVIGI+SHPGDGASGR++NA+  SYIAAS VKFVESAGARVI
Sbjct  89   SGGVVPSCPAADPKLNFRPVIGILSHPGDGASGRLNNASNASYIAASYVKFVESAGARVI  148

Query  315  PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  494
            PLIYNEP E L++KLN+VNGV+F GG  + G Y E ++ I+KKVL KND GD+FPL AI 
Sbjct  149  PLIYNEPREVLLEKLNMVNGVLFTGGWAKTGLYYETVEAIFKKVLAKNDAGDHFPLYAIC  208

Query  495  LGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            LGF+LLT+IVS+D  ILE+F+A+ QASTLQ +
Sbjct  209  LGFELLTMIVSKDKSILEEFNAADQASTLQFM  240



>ref|NP_001234438.1| gamma-glutamylhydrolase 3 precursor [Solanum lycopersicum]
 gb|ACC86849.1| gamma-glutamylhydrolase 3 [Solanum lycopersicum]
Length=337

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             GCP PD +LNYRPVIGI+SHPGDG SGRI+N+TGVSYIAAS VK VES GARVIPL+++
Sbjct  30   AGCPLPDHNLNYRPVIGIISHPGDGDSGRINNSTGVSYIAASYVKLVESGGARVIPLLFD  89

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            +  + L +KLNLVNGV+FPGG  +KG Y E +K I+ KVLEKND G++FPLLAIN GF+L
Sbjct  90   DSPQLLNQKLNLVNGVIFPGGWAKKGHYFETIKAIFGKVLEKNDAGEHFPLLAINHGFEL  149

Query  510  LTIIVSEDNIILEKFSASXQASTLQVV  590
            L +IVS+DN ILEKFS S QA+ L  V
Sbjct  150  LMMIVSKDNNILEKFSVSNQATKLHFV  176



>ref|XP_006348321.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Solanum tuberosum]
Length=335

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             GCP PD +LNYRPVIGI+SHPG G SGRI+N+TGVSYIAAS VK VES GARVIPL+++
Sbjct  30   AGCPLPDHNLNYRPVIGIISHPGHGDSGRINNSTGVSYIAASYVKLVESGGARVIPLLFD  89

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            +  + L +KLNLVNGV+FPGG  +KG Y E +K I++KVLEKND G++FPLLAIN GF+L
Sbjct  90   DSPQLLNQKLNLVNGVIFPGGWAKKGHYFETIKAIFRKVLEKNDAGEHFPLLAINHGFEL  149

Query  510  LTIIVSEDNIILEKFSASXQASTLQVV  590
            L +IVS+DN ILEKFS S QA+ L  V
Sbjct  150  LMMIVSKDNNILEKFSVSNQATKLHFV  176



>ref|XP_010060723.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Eucalyptus 
grandis]
Length=360

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  CPAPDP LN+RPVIGI+SHPGDGASGR+SNA+  S+I AS VKFVESAGA VIPLIY
Sbjct  59   AADCPAPDPKLNFRPVIGILSHPGDGASGRLSNASDASFIPASYVKFVESAGATVIPLIY  118

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L++KLN+VNGV+F GG    G Y E ++ I+KKVL KND GD+FPL A  LGFQ
Sbjct  119  NEPREVLLEKLNMVNGVLFTGGWASTGLYYETVEAIFKKVLAKNDAGDHFPLYATCLGFQ  178

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            LLT+IVS+D  ILE+F+A+ QASTLQ +
Sbjct  179  LLTMIVSKDKGILEEFNAAHQASTLQFM  206



>ref|XP_006370106.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
 gb|ERP66675.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
Length=322

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPD +LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGAR+IPLIYNEP
Sbjct  87   CPAPDTNLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARIIPLIYNEP  146

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y +  K I+K+VL +ND G +FP+ AI LGF++LT
Sbjct  147  REILFEKLNLVNGVLFTGGWAKTGLYFDTAKAIFKEVLARNDAGFHFPVYAICLGFEILT  206

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE ++A+ QASTLQ +
Sbjct  207  MIISEDNQILETYNATDQASTLQFM  231



>ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]
 gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]
Length=388

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP LNYRPVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  88   CLAPDPKLNYRPVIGIVSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIYNEP  147

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KLNLVNGV+F GG  + G Y + +K I+KKVL+KND G +FPL AI LGF+LLT
Sbjct  148  PDILFEKLNLVNGVLFTGGWAKNGLYYDIVKAIFKKVLDKNDAGYHFPLYAICLGFELLT  207

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  208  MIISKDRNILESFNAADQASTLQFM  232



>ref|XP_004489008.1| PREDICTED: gamma-glutamyl hydrolase-like [Cicer arietinum]
Length=327

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAP+P+L Y+PVIGI+SHPGD ASGR+SNAT  S+I AS VKFVE+AGARVIPLIYNEP
Sbjct  39   CPAPNPNLYYQPVIGILSHPGDSASGRLSNATSASFIIASYVKFVEAAGARVIPLIYNEP  98

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
            T+ L+KKL+LVNGV+F GGS   G Y E +  I+KK LEKND GDNFPL AI LGF+L+T
Sbjct  99   TDKLLKKLDLVNGVLFTGGSVNSGLYFETVGRIFKKALEKNDAGDNFPLYAICLGFELIT  158

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S D  ILE+F A  QASTLQ V
Sbjct  159  MIISGDKNILEEFKAQDQASTLQFV  183



>ref|XP_003596308.1| Gamma-glutamylhydrolase [Medicago truncatula]
 gb|AES66559.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=340

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPD SL YRPVIGIVSHPGDGASGR+SNATG +YIAAS VKFVE+ GARV+PLIY EP
Sbjct  42   CPAPDASLYYRPVIGIVSHPGDGASGRLSNATGANYIAASYVKFVEAGGARVVPLIYTEP  101

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L KKL LVNGV+F GG  ++G Y E +K I+K  LEKND GD FP+  + LGF+L++
Sbjct  102  WEILRKKLELVNGVLFTGGWAKEGLYFETVKRIFKIALEKNDAGDYFPVYGVCLGFELIS  161

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVSEDN ILE+FSA  QAS+LQ V
Sbjct  162  MIVSEDNDILEEFSARSQASSLQFV  186



>gb|KDO42397.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=250

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  170  MIISKDKNILESFNAADQASTLQFM  194



>gb|KDO42396.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=263

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  170  MIISKDKNILESFNAADQASTLQFM  194



>ref|XP_006494683.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006494685.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=263

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  170  MIISKDKNILESFNAADQASTLQFM  194



>gb|KDO42395.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=278

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  170  MIISKDKNILESFNAADQASTLQFM  194



>ref|XP_006494682.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494684.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=278

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  170  MIISKDKNILESFNAADQASTLQFM  194



>ref|XP_006442394.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
 gb|ESR55634.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
Length=321

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y E +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYEIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+ +D  ILE F+A+ QASTLQ +
Sbjct  170  MIIGKDKNILESFNAADQASTLQFI  194



>ref|XP_010644101.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Vitis vinifera]
Length=374

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  KLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  320
            + S  CPAPDP LN+RPV+GI++HPGDGASGR++N T  SYIAAS VKFVESAGARVIPL
Sbjct  81   RSSPSCPAPDPKLNFRPVVGILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPL  140

Query  321  IYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            IYNEP E L +KLNLVNGV+F GG  + G Y   + EI+KK LEKND GD+FP+LA  LG
Sbjct  141  IYNEPLEILHEKLNLVNGVIFTGGWAKSGLYYTTVGEIFKKSLEKNDVGDHFPVLATCLG  200

Query  501  FQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            F+LLT+I+S+D  ILE+FSA+ QASTL  +
Sbjct  201  FELLTMIISKDIKILEEFSAADQASTLNFM  230



>gb|KEH38596.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=340

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  CPAPD SL Y+PVIGI+SHPGDGASGR+SNAT  SY+AAS VKFVE+ GARV+PLIY
Sbjct  39   SVNCPAPDSSLYYQPVIGILSHPGDGASGRLSNATDASYLAASYVKFVEAGGARVVPLIY  98

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
             EP E L+KKL LVNGV+F GG    G Y E +  I+KKVLEKND GD FPL A  LGF+
Sbjct  99   TEPWEILLKKLELVNGVLFTGGVANDGLYFEIVGRIFKKVLEKNDAGDYFPLYATCLGFE  158

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            L+T+IVSEDN ILE F+A  QAS+LQ V
Sbjct  159  LITMIVSEDNDILEDFAAENQASSLQFV  186



>ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Vitis vinifera]
Length=384

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  KLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  320
            + S  CPAPDP LN+RPV+GI++HPGDGASGR++N T  SYIAAS VKFVESAGARVIPL
Sbjct  81   RSSPSCPAPDPKLNFRPVVGILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPL  140

Query  321  IYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            IYNEP E L +KLNLVNGV+F GG  + G Y   + EI+KK LEKND GD+FP+LA  LG
Sbjct  141  IYNEPLEILHEKLNLVNGVIFTGGWAKSGLYYTTVGEIFKKSLEKNDVGDHFPVLATCLG  200

Query  501  FQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            F+LLT+I+S+D  ILE+FSA+ QASTL  +
Sbjct  201  FELLTMIISKDIKILEEFSAADQASTLNFM  230



>ref|XP_011460803.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=397

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C   DP LNYRPVIGI+SHPGDGASGR+SN TG SYIAAS VKFVESAGARVIPLIY
Sbjct  80   SPRCTPLDPKLNYRPVIGILSHPGDGASGRLSNVTGTSYIAASYVKFVESAGARVIPLIY  139

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP++ L +KLNLVNGV+F GG  + G Y +  ++I+K +LE+ND GD+FPL AI LGF+
Sbjct  140  NEPSDVLFQKLNLVNGVLFTGGWAKSGRYYDVAEKIFKMILERNDAGDHFPLYAICLGFE  199

Query  507  LLTIIVSEDNIILEKFSASXQASTLQ  584
            LLT+I+S++  ILE FSA+  ASTLQ
Sbjct  200  LLTMIISKNKKILESFSAADMASTLQ  225



>ref|XP_008386275.1| PREDICTED: gamma-glutamyl hydrolase 2 [Malus domestica]
Length=387

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C APDP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIPLIY
Sbjct  79   STKCAAPDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGARVIPLIY  138

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP + L +KL+LVNGV+F GG  ++G Y + ++ I++K++EKND GD+FPL AI LGF+
Sbjct  139  NEPRDILFQKLDLVNGVLFTGGWAKRGLYYDVVERIFQKIIEKNDAGDHFPLYAICLGFE  198

Query  507  LLTIIVSEDNIILEKFSASXQASTLQ  584
            LLT+I+S++  ILE FSA   ASTLQ
Sbjct  199  LLTMIISKNKKILESFSAVDVASTLQ  224



>ref|XP_006442395.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
 gb|ESR55635.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
Length=352

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y E +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYEIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+ +D  ILE F+A+ QASTLQ +
Sbjct  170  MIIGKDKNILESFNAADQASTLQFI  194



>ref|XP_010060722.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Eucalyptus 
grandis]
Length=373

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPA DP LN+RPVIGI+SHPGDGASGR++NA+  S IAAS VKFVESAGARVIPLIYNEP
Sbjct  75   CPAADPKLNFRPVIGILSHPGDGASGRLNNASNASNIAASYVKFVESAGARVIPLIYNEP  134

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L++KL+LVNGV+F GG  + G Y E  + I+KKVL KND GD+FPL AI LGF+LLT
Sbjct  135  QEVLLEKLDLVNGVLFTGGWAKTGLYYETAEAIFKKVLAKNDAGDHFPLYAICLGFELLT  194

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVS+D  ILE+F+A+ +ASTLQ +
Sbjct  195  MIVSKDKSILEEFNAADEASTLQFM  219



>ref|XP_006377741.1| hypothetical protein POPTR_0011s10890g [Populus trichocarpa]
 gb|ERP55538.1| hypothetical protein POPTR_0011s10890g [Populus trichocarpa]
Length=412

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APD  LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  92   CSAPDIKLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  151

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y + +K I+K++L KND G +FP+ AI LGF++LT
Sbjct  152  REILFEKLNLVNGVLFTGGWAKTGLYFDTVKAIFKEILAKNDAGFHFPVYAICLGFEILT  211

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE F+A+ QASTLQ +
Sbjct  212  MIISEDNQILETFNAADQASTLQFM  236



>gb|EPS62480.1| hypothetical protein M569_12307, partial [Genlisea aurea]
Length=351

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C A +P LNYRPVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  58   CQAAEPGLNYRPVIGIVSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIYNEP  117

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E    KLNLVNGV+F GGS + G Y + ++ ++K +L++N+ GD+FPLLAI LGF+LLT
Sbjct  118  PE----KLNLVNGVIFTGGSVKTGPYFDIVESVFKTILQRNEAGDHFPLLAICLGFELLT  173

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVSEDN ILE FSA  Q S LQ V
Sbjct  174  MIVSEDNEILENFSAVDQVSALQFV  198



>ref|XP_004294089.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C   DP LNYRPVIGI+SHPGDGASGR+SN TG SYIAAS VKFVESAGARVIPLIY
Sbjct  80   SPRCTPLDPKLNYRPVIGILSHPGDGASGRLSNVTGTSYIAASYVKFVESAGARVIPLIY  139

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP++ L +KLNLVNGV+F GG  + G Y +  ++I+K +LE+ND GD+FPL AI LGF+
Sbjct  140  NEPSDVLFQKLNLVNGVLFTGGWAKSGRYYDVAEKIFKMILERNDAGDHFPLYAICLGFE  199

Query  507  LLTIIVSEDNIILEKFSASXQASTLQ  584
            LLT+I+S++  ILE FSA+  ASTLQ
Sbjct  200  LLTMIISKNKKILESFSAADMASTLQ  225



>ref|XP_006477852.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=348

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50   CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110  EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE F+A+ QASTLQ +
Sbjct  170  MIISKDKNILESFNAADQASTLQFM  194



>gb|AFK48342.1| unknown [Medicago truncatula]
Length=340

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPD SL YRPVIGIVSHPGDGASGR+SNATG +YIAAS VKFVE+ GARV+PLI+ EP
Sbjct  42   CPAPDASLYYRPVIGIVSHPGDGASGRLSNATGANYIAASYVKFVEAGGARVVPLIHTEP  101

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L KKL LVNGV+F GG  ++G Y E +K I+K  LEK+D GD FP+  + LGF+L++
Sbjct  102  WEILRKKLELVNGVLFTGGWAKEGLYFETVKRIFKIALEKSDAGDYFPVYGVCLGFELIS  161

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVSEDN ILE+FSA  QAS+LQ V
Sbjct  162  MIVSEDNDILEEFSARSQASSLQFV  186



>ref|XP_010675311.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=376

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APD +LN+RPVIGI+SHPGDGASGR+ N T VSYIA+S VKFVESAGARVIPLIY +P
Sbjct  78   CSAPDSTLNFRPVIGILSHPGDGASGRLKNGTNVSYIASSYVKFVESAGARVIPLIYTDP  137

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
               L+ KL LVNGV+F GG  ++G Y E ++EI+K+VLEKND G  FP  AI LGF+LLT
Sbjct  138  LHILLDKLELVNGVLFTGGWAKRGLYFEVVREIFKRVLEKNDAGQFFPCYAICLGFELLT  197

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+DN ILE FSAS Q STLQ V
Sbjct  198  MIISKDNNILESFSASYQPSTLQFV  222



>gb|AFK41094.1| unknown [Medicago truncatula]
Length=340

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  CPAPD SL Y+PVIGI+SHPGDGASGR+SNAT  SY+AAS VKFVE+ GARV+PLIY
Sbjct  39   SVNCPAPDSSLYYQPVIGILSHPGDGASGRLSNATDASYLAASYVKFVEAGGARVVPLIY  98

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
             EP E L+KKL LVNGV+F GG    G Y E +  I+KKVLEKND GD FPL A  LGF+
Sbjct  99   TEPWEILLKKLELVNGVLFTGGVANDGLYFEIVGRIFKKVLEKNDAGDYFPLYATCLGFE  158

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            L+T+IVSEDN  LE F+A  QAS+LQ V
Sbjct  159  LITMIVSEDNDTLEDFAAENQASSLQFV  186



>ref|XP_011002760.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Populus euphratica]
Length=407

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPA D +LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  87   CPASDTNLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  146

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y +  K I+K+VL +ND G +FP+ AI LGF++LT
Sbjct  147  REILFEKLNLVNGVLFTGGWAKTGLYFDTAKAIFKEVLARNDAGFHFPVYAICLGFEILT  206

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE ++A+ QASTLQ +
Sbjct  207  MIISEDNQILETYNATDQASTLQFM  231



>ref|XP_009342915.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  126  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  305
            L T+   S  C APDP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  72   LGTSDSSSARCTAPDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  131

Query  306  RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  485
            RVIPLIYNEP + L +KL+LVNGV+F GG  ++G Y + ++ I++K++EKND GD+FPL 
Sbjct  132  RVIPLIYNEPRDILFQKLDLVNGVLFTGGWAKRGLYYDVVERIFQKIIEKNDAGDHFPLY  191

Query  486  AINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
            AI LGF+LLT+I+S++  ILE FSA    STLQ
Sbjct  192  AICLGFELLTMIISKNKKILESFSAVDVPSTLQ  224



>ref|XP_009342914.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=387

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  126  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  305
            L T+   S  C APDP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  72   LGTSDSSSARCTAPDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  131

Query  306  RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  485
            RVIPLIYNEP + L +KL+LVNGV+F GG  ++G Y + ++ I++K++EKND GD+FPL 
Sbjct  132  RVIPLIYNEPRDILFQKLDLVNGVLFTGGWAKRGLYYDVVERIFQKIIEKNDAGDHFPLY  191

Query  486  AINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
            AI LGF+LLT+I+S++  ILE FSA    STLQ
Sbjct  192  AICLGFELLTMIISKNKKILESFSAVDVPSTLQ  224



>ref|XP_007021919.1| Gamma-glutamyl hydrolase 1 isoform 4 [Theobroma cacao]
 gb|EOY13444.1| Gamma-glutamyl hydrolase 1 isoform 4 [Theobroma cacao]
Length=291

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81   ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L +KL LVNGV+F GG  + G Y E  ++I+KKVLEKND  D+FPL AI LGF+
Sbjct  141  NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFKKVLEKNDARDHFPLYAICLGFE  200

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            LLT+I+SED  ILE FSA+ QAS+LQ V
Sbjct  201  LLTMIISEDRNILESFSAADQASSLQFV  228



>emb|CBI20168.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  KLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  320
            + S  CPAPDP LN+RPV+GI++HPGDGASGR++N T  SYIAAS VKFVESAGARVIPL
Sbjct  211  RSSPSCPAPDPKLNFRPVVGILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPL  270

Query  321  IYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            IYNEP E L +KLNLVNGV+F GG  + G Y   + EI+KK LEKND GD+FP+LA  LG
Sbjct  271  IYNEPLEILHEKLNLVNGVIFTGGWAKSGLYYTTVGEIFKKSLEKNDVGDHFPVLATCLG  330

Query  501  FQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            F+LLT+I+S+D  ILE+FSA+ QASTL  +
Sbjct  331  FELLTMIISKDIKILEEFSAADQASTLNFM  360



>ref|XP_007021918.1| Gamma-glutamyl hydrolase 1 isoform 3 [Theobroma cacao]
 gb|EOY13443.1| Gamma-glutamyl hydrolase 1 isoform 3 [Theobroma cacao]
Length=292

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81   ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L +KL LVNGV+F GG  + G Y E  ++I+KKVLEKND  D+FPL AI LGF+
Sbjct  141  NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFKKVLEKNDARDHFPLYAICLGFE  200

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            LLT+I+SED  ILE FSA+ QAS+LQ V
Sbjct  201  LLTMIISEDRNILESFSAADQASSLQFV  228



>ref|XP_009334021.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Pyrus x bretschneideri]
Length=347

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = +3

Query  126  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  305
            L T+   S  C APDP +NYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  32   LGTSDSSSSKCTAPDPKINYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  91

Query  306  RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  485
            RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+KK++EKND GD+FPL 
Sbjct  92   RVIPLIYNEPPDILFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKKIIEKNDAGDHFPLY  151

Query  486  AINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
            A  LGF+LLT+I+S++  ILE FSA   ASTLQ
Sbjct  152  ATCLGFELLTMIISKNKNILETFSAVDAASTLQ  184



>ref|XP_008345165.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 2-like 
[Malus domestica]
Length=382

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +3

Query  126  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  305
            L T+   S  C APDP +NYRPVIGI+SHPGDGASGR+SNA   SYIAAS VKFVESAGA
Sbjct  67   LRTSDSSSSKCTAPDPKINYRPVIGILSHPGDGASGRLSNAXTASYIAASYVKFVESAGA  126

Query  306  RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  485
            RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+KK++EKND GD+FPL 
Sbjct  127  RVIPLIYNEPPDVLFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKKIIEKNDAGDHFPLY  186

Query  486  AINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
            A  LGF+LLT+I+S++  ILE FSA   ASTLQ
Sbjct  187  ATCLGFELLTMIISKNKKILETFSAVDVASTLQ  219



>ref|XP_010242158.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Nelumbo 
nucifera]
Length=313

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  159  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  338
            P  D +L +RPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  87   PTSDAALYFRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPA  146

Query  339  ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
            E L +KL+LVNGV+F GG  ++G Y E ++ I+K VLEKND GD+FPL AI LGF+LL++
Sbjct  147  EILAEKLSLVNGVLFTGGKTKRGLYYEIVERIFKHVLEKNDSGDHFPLFAICLGFELLSM  206

Query  519  IVSEDNIILEKFSASXQASTLQ  584
            I+S+D+ ILE+F+A  QASTLQ
Sbjct  207  IISKDDGILERFNALDQASTLQ  228



>gb|KJB13015.1| hypothetical protein B456_002G051200 [Gossypium raimondii]
Length=386

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIYNEP
Sbjct  82   CANADPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIYNEP  141

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  + G Y +  K+I+KKV+EKND GD+FPL AI LGF+LLT
Sbjct  142  EEILFQKLELVNGVLFTGGWSKYGLYYDIAKKIFKKVIEKNDRGDHFPLYAICLGFELLT  201

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVSED  ILE FSAS QAS+LQ V
Sbjct  202  MIVSEDKNILEPFSASNQASSLQFV  226



>ref|XP_002318789.2| hypothetical protein POPTR_0012s11220g [Populus trichocarpa]
 gb|EEE97009.2| hypothetical protein POPTR_0012s11220g [Populus trichocarpa]
Length=411

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APD  LNYRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  91   CSAPDIKLNYRPVIGILSHPGDGASGRLNNETNASYIAASYVKFVESAGARVIPLIYNEP  150

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y + +K I+K++L KND G +FP+ AI LGF++LT
Sbjct  151  REILFEKLNLVNGVLFTGGWAKTGLYFDTVKAIFKEILAKNDAGFHFPVYAICLGFEILT  210

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE F+ + QASTLQ +
Sbjct  211  MIISEDNQILETFNGADQASTLQFM  235



>ref|XP_011044052.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Populus euphratica]
Length=408

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APD  LN+RPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  88   CSAPDIKLNFRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  147

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y + +K ++K++L KND G +FP+ AI LGF++LT
Sbjct  148  REILFEKLNLVNGVLFTGGWAKTGLYFDTVKAVFKEILAKNDAGFHFPVYAICLGFEILT  207

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SEDN ILE F+ + QASTLQ +
Sbjct  208  MIISEDNQILETFNGADQASTLQFM  232



>ref|XP_008463749.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Cucumis melo]
Length=364

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP+LNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIY
Sbjct  63   SPSCTAMDPTLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIY  122

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E + +KL+LVNGV+F GG  +KG Y    ++I+KK+LE+ND GD FPL  + LGF+
Sbjct  123  NEPLEVIFEKLSLVNGVLFTGGWAKKGLYYLVAEKIFKKMLERNDAGDRFPLYGVCLGFE  182

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            +L++I+S++  ILE F+AS  ASTLQ V
Sbjct  183  ILSMIISKNRNILEPFNASYMASTLQFV  210



>ref|XP_007021916.1| Gamma-glutamyl hydrolase 1 isoform 1 [Theobroma cacao]
 gb|EOY13441.1| Gamma-glutamyl hydrolase 1 isoform 1 [Theobroma cacao]
Length=388

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81   ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L +KL LVNGV+F GG  + G Y E  ++I+KKVLEKND  D+FPL AI LGF+
Sbjct  141  NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFKKVLEKNDARDHFPLYAICLGFE  200

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            LLT+I+SED  ILE FSA+ QAS+LQ V
Sbjct  201  LLTMIISEDRNILESFSAADQASSLQFV  228



>gb|KHG06555.1| Gamma-glutamyl hydrolase -like protein [Gossypium arboreum]
Length=385

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGAR+IPLIYNEP
Sbjct  81   CANADPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARIIPLIYNEP  140

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  + G Y +  K+I+KKV+EKND GD+FPL AI LGF+LLT
Sbjct  141  EEILFQKLELVNGVLFTGGWSKYGLYYDIAKKIFKKVIEKNDRGDHFPLYAICLGFELLT  200

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SED  ILE FSAS QAS+LQ V
Sbjct  201  MIISEDKNILEPFSASNQASSLQFV  225



>ref|XP_006302530.1| hypothetical protein CARUB_v10020631mg [Capsella rubella]
 gb|EOA35428.1| hypothetical protein CARUB_v10020631mg [Capsella rubella]
Length=302

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  45   CSAPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  104

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  105  EELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFELMS  164

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   AS+LQ V
Sbjct  165  IIISQNRDILERFDAEDNASSLQFV  189



>ref|XP_010242157.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Nelumbo 
nucifera]
Length=384

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  159  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  338
            P  D +L +RPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  87   PTSDAALYFRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPA  146

Query  339  ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
            E L +KL+LVNGV+F GG  ++G Y E ++ I+K VLEKND GD+FPL AI LGF+LL++
Sbjct  147  EILAEKLSLVNGVLFTGGKTKRGLYYEIVERIFKHVLEKNDSGDHFPLFAICLGFELLSM  206

Query  519  IVSEDNIILEKFSASXQASTLQ  584
            I+S+D+ ILE+F+A  QASTLQ
Sbjct  207  IISKDDGILERFNALDQASTLQ  228



>ref|XP_008226384.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Prunus mume]
Length=388

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIPLIY
Sbjct  80   STRCTALDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGARVIPLIY  139

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP   L +KLNLVNGV+F GG  + G Y + ++ I++K++EKND GD+FPL A  LGF+
Sbjct  140  NEPPYVLFQKLNLVNGVLFTGGWAKSGLYYDIVERIFQKIIEKNDAGDHFPLYATCLGFE  199

Query  507  LLTIIVSEDNIILEKFSASXQASTLQ  584
            LLT+I+S++  ILE FSA   ASTLQ
Sbjct  200  LLTMIISKNKEILESFSAENMASTLQ  225



>ref|XP_006302531.1| hypothetical protein CARUB_v10020631mg, partial [Capsella rubella]
 gb|EOA35429.1| hypothetical protein CARUB_v10020631mg, partial [Capsella rubella]
Length=331

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  27   CSAPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  86

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  87   EELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFELMS  146

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   AS+LQ V
Sbjct  147  IIISQNRDILERFDAEDNASSLQFV  171



>ref|XP_007213890.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica]
 gb|EMJ15089.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica]
Length=388

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIPLIY
Sbjct  80   STRCTALDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGARVIPLIY  139

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP + L +KLNLVNGV+F GG  + G Y + ++ I++K++EKND GD+FPL A  LGF+
Sbjct  140  NEPPDVLFQKLNLVNGVLFTGGWAKSGLYYDIVERIFQKIIEKNDAGDHFPLYATCLGFE  199

Query  507  LLTIIVSEDNIILEKFSASXQASTL  581
            LLT+I+S++  ILE FSA   ASTL
Sbjct  200  LLTMIISKNKKILESFSAENMASTL  224



>ref|XP_008792313.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Phoenix dactylifera]
Length=394

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP+PDPSL YRPVIGIV+HPGDGASGR+SNAT  S I AS VKFVESAGAR+IPLIYNEP
Sbjct  96   CPSPDPSLYYRPVIGIVTHPGDGASGRLSNATNASNIPASYVKFVESAGARIIPLIYNEP  155

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E ++ KL+LVNGV+F GG  ++G Y E +K+I++  L++ND GD+FPL  I LGF+L++
Sbjct  156  WEVILDKLSLVNGVLFTGGWCKRGLYFETVKKIFQITLDRNDAGDHFPLFGICLGFELIS  215

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
            +I+++DN   E+FS   QASTL+
Sbjct  216  MIITKDNNFCERFSGEDQASTLE  238



>ref|XP_010924708.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 2-like 
[Elaeis guineensis]
Length=363

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP+PD SL YRPVIGIV+HPGDGASGR+SNAT  S I AS VKFVESAGARVIPLIYNEP
Sbjct  65   CPSPDLSLYYRPVIGIVTHPGDGASGRLSNATNASNIPASYVKFVESAGARVIPLIYNEP  124

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E ++ KL+LVNGV++ GG  +KG Y E +K+I++  L++ND GD+FPL  I LGF+LL+
Sbjct  125  WEVILDKLSLVNGVLYTGGWCKKGLYFETVKKIFQITLDRNDAGDHFPLFGICLGFELLS  184

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
            +I+++DN   E+FS   QASTLQ
Sbjct  185  MIITQDNNFCERFSGENQASTLQ  207



>ref|XP_009128305.1| PREDICTED: gamma-glutamyl hydrolase 1 [Brassica rapa]
 emb|CDY26875.1| BnaA02g19000D [Brassica napus]
Length=344

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  40   CSSPDPKLNYRPVIGILSHPGDGASGRLTNDTTSTYIAASYVKFAEAGGARVIPLIYNEP  99

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L KKL LVNGV+F GG  +K EY + + +I+KK LE+ND G++FP+  I LGF+L++
Sbjct  100  EDVLFKKLELVNGVIFTGGWAKKYEYFDMVTKIFKKALERNDAGEHFPIYGICLGFELMS  159

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            IIVS+D  IL++F A   AS+LQ V
Sbjct  160  IIVSQDRGILQRFDAEDNASSLQFV  184



>ref|XP_004146022.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
 gb|KGN55057.1| hypothetical protein Csa_4G626100 [Cucumis sativus]
Length=375

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP LNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIY
Sbjct  74   SPSCTAMDPRLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIY  133

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
             EP E + +KL+LVNGV+F GG  ++G Y    ++I++K+LE+ND GD FPL  + LGF+
Sbjct  134  TEPLEVIFEKLSLVNGVLFTGGWAKEGLYYSVAQKIFEKILERNDAGDRFPLYGVCLGFE  193

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            +L++I+S++  ILE F+AS  ASTLQ V
Sbjct  194  ILSMIISKNRNILEPFNASYMASTLQFV  221



>ref|XP_010106571.1| Gamma-glutamyl hydrolase [Morus notabilis]
 gb|EXC10782.1| Gamma-glutamyl hydrolase [Morus notabilis]
Length=401

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPA DP LNYRPVIGIVSHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIP+IYNEP
Sbjct  99   CPASDPKLNYRPVIGIVSHPGDGASGRLSNASSASYIAASYVKFVESAGARVIPIIYNEP  158

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E + +KLNLVNGV+F GG  + G Y E ++ I+KKVLE+ND G+ FPL AI LGF++LT
Sbjct  159  PEIIFQKLNLVNGVLFTGGWAKTGPYYEIVERIFKKVLERNDAGEYFPLYAICLGFEILT  218

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
            +I+S+DN ILE FSAS  ASTLQ
Sbjct  219  MIISKDNKILESFSASDMASTLQ  241



>emb|CDY14595.1| BnaC02g25180D [Brassica napus]
Length=344

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP+LN+RPVIGI+SHPGDGASGR+SN T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  40   CSSPDPNLNHRPVIGILSHPGDGASGRLSNDTTSTYIAASYVKFAEAGGARVIPLIYNEP  99

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L KKL LVNGV+F GG  +K EY + + +I+KK LE+ND G++FP+  I LGF+L++
Sbjct  100  EDVLFKKLELVNGVIFTGGWAKKYEYFDMVTKIFKKTLERNDAGEHFPIYGICLGFELMS  159

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            IIVS+D  IL++F A   AS+LQ V
Sbjct  160  IIVSQDRGILQRFDAEDNASSLQFV  184



>ref|XP_002441386.1| hypothetical protein SORBIDRAFT_09g025690 [Sorghum bicolor]
 gb|EES19816.1| hypothetical protein SORBIDRAFT_09g025690 [Sorghum bicolor]
Length=342

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             C  PDP+L  RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AGARVIPL+YNE
Sbjct  44   ACAPPDPALYDRPVIGIVSHPGDGAGGRISNTTATSYIGASYVKFVEAAGARVIPLVYNE  103

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E L++KL+L+NGV+F GGS ++G Y E +K++++ VL+KND G+ FPL A  LGF+L+
Sbjct  104  PEERLLEKLSLLNGVLFTGGSEKQGVYFETIKKVFQYVLDKNDAGEPFPLFAQCLGFELI  163

Query  513  TIIVSEDNIILEKFSASXQASTLQ  584
            ++IVS+DN ILE F A  QASTLQ
Sbjct  164  SMIVSKDNNILETFDAQNQASTLQ  187



>ref|XP_009106586.1| PREDICTED: gamma-glutamyl hydrolase 2 [Brassica rapa]
Length=344

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDPSLNY+PVIGI+SHPGDGA+GR++N T  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  40   CSAPDPSLNYKPVIGILSHPGDGATGRLNNDTNASYIAASYVKLAEAGGARVIPLIYNEP  99

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L KKL LVNGV+F GG  +KG Y + +K+I+ + LE+NDGG++FP+ AI LGF+LLT
Sbjct  100  EELLFKKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLT  159

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ V
Sbjct  160  MIISQNTDIFEKVDAKNAASSLQFV  184



>ref|XP_010429696.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Camelina sativa]
Length=347

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP+LNYRP+IGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIY
Sbjct  40   SSVCSAQDPNLNYRPIIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIY  99

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L +KL LVNGV+F GG  +K EY + +K+I+KK LE+ND G++FP+  I LGF+
Sbjct  100  NEPEELLFQKLELVNGVIFTGGWAKKYEYFDTVKKIFKKALERNDAGEHFPVYGICLGFE  159

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            L++II+S++  ILE+F A   AS+LQ V
Sbjct  160  LMSIIISQNRDILERFDAEDNASSLQFV  187



>ref|XP_002887750.1| ATGGH1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64009.1| ATGGH1 [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  40   CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  99

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K +Y E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  100  EELLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFNKALERNDAGEHFPVYGICLGFELMS  159

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   ASTLQ V
Sbjct  160  IIISQNRDILERFDAEDNASTLQFV  184



>ref|XP_010417472.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Camelina sativa]
Length=347

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIY
Sbjct  40   SSVCSAQDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIY  99

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+
Sbjct  100  NEPEELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFE  159

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            L++II+S++  ILE+F A   AS+LQ V
Sbjct  160  LMSIIISQNRDILERFDAEDNASSLQFV  187



>ref|XP_004166066.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase-like 
[Cucumis sativus]
Length=433

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DP LNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIY
Sbjct  132  SPSCTAMDPRLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIY  191

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
             EP E + +KL+LVNGV+F GG  ++G Y    ++I++K+LE+ND GD FPL  + LGF+
Sbjct  192  TEPLEVIFEKLSLVNGVLFTGGWAKEGLYYSVAQKIFEKILERNDAGDRFPLYGVCLGFE  251

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            +L++I+S++  ILE F+AS  ASTLQ V
Sbjct  252  ILSMIISKNRNILEPFNASYMASTLQFV  279



>ref|NP_849900.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 gb|ABD59075.1| At1g78660 [Arabidopsis thaliana]
 dbj|BAH19882.1| AT1G78660 [Arabidopsis thaliana]
 gb|AEE36134.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
Length=347

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  43   CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K +Y E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  103  EEVLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMS  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   AS+LQ V
Sbjct  163  IIISQNRDILERFDAEDNASSLQFV  187



>ref|XP_010472701.1| PREDICTED: gamma-glutamyl hydrolase 1 [Camelina sativa]
Length=347

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C A DP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  43   CSAQDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  103  EELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFELMS  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   AS+LQ V
Sbjct  163  IIISQNRDILERFDAEDNASSLQFV  187



>ref|XP_011082781.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Sesamum indicum]
Length=326

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  159  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  338
            P PDP +NYRP+IGI+SHPGDGASGR++NAT  SYIAAS VKFVES GARVIPLIYNEP 
Sbjct  39   PPPDPKVNYRPIIGILSHPGDGASGRLNNATNASYIAASYVKFVESGGARVIPLIYNEPP  98

Query  339  ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
            E L KKL LVNGV+ PGGS ++G + E ++ I+K VL KND GD FPLLAI LGF+LL +
Sbjct  99   EILHKKLKLVNGVLLPGGSTKRGVHFEIVESIFKSVLLKNDAGDRFPLLAICLGFELLAM  158

Query  519  IVSEDNIILEKFSASXQASTLQ  584
            IV++D  ILE+F++    S L 
Sbjct  159  IVAKDRSILEEFNSKDDPSPLH  180



>ref|NP_177987.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 ref|NP_974172.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 sp|Q9SYL6.1|GGH1_ARATH RecName: Full=Gamma-glutamyl hydrolase 1; Short=AtGGH1; AltName: 
Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD30570.1|AC007260_1 putative gamma-glutamyl hydrolase [Arabidopsis thaliana]
 gb|AEE36133.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 gb|AEE36135.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
Length=348

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  44   CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  103

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K +Y E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  104  EEVLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMS  163

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   AS+LQ V
Sbjct  164  IIISQNRDILERFDAEDNASSLQFV  188



>gb|EYU29531.1| hypothetical protein MIMGU_mgv1a009742mg [Erythranthe guttata]
Length=333

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            LNY P+IGI+SHPGDGASGR++N+T  SYIAAS VKFVES GARVIPLIYNEP E L KK
Sbjct  39   LNYHPIIGIISHPGDGASGRLNNSTKASYIAASYVKFVESGGARVIPLIYNEPPEILNKK  98

Query  357  LNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDN  536
            LNLVNGV+FPGGS ++G + E ++ I+K V++KNDGGD+FPLLA+ LGF+LL +IVS+D 
Sbjct  99   LNLVNGVLFPGGSIKRGHFFEVVESIFKNVVKKNDGGDHFPLLAVCLGFELLAMIVSKDK  158

Query  537  IILEKFSASXQASTL  581
             ILE+FSA    STL
Sbjct  159  NILEEFSAIDYPSTL  173



>emb|CDX87442.1| BnaA07g34310D [Brassica napus]
Length=344

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDPSLNY+PVIGI++HPGDGA+GR++N T  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  40   CSAPDPSLNYKPVIGILTHPGDGATGRLNNDTNASYIAASYVKLAEAGGARVIPLIYNEP  99

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L KKL LVNGV+F GG  +KG Y + +K+I+ + LE+NDGG++FP+ AI LGF+LLT
Sbjct  100  EELLFKKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLT  159

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ V
Sbjct  160  MIISQNTDIFEKVDAKNAASSLQFV  184



>ref|NP_001056052.1| Os05g0517500 [Oryza sativa Japonica Group]
 gb|AAT01320.1| putative gamma-glutamyl hydrolase [Oryza sativa Japonica Group]
 dbj|BAF17966.1| Os05g0517500 [Oryza sativa Japonica Group]
 dbj|BAG89432.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79535.1| hypothetical protein OsI_20640 [Oryza sativa Indica Group]
 gb|EEE64372.1| hypothetical protein OsJ_19214 [Oryza sativa Japonica Group]
Length=337

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +3

Query  153  GCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             C AP DP+   RPVIGIVSHPGDGA GR+SN T  SYIAAS VKFVESAGARV+PLIYN
Sbjct  37   ACAAPTDPAAYDRPVIGIVSHPGDGAGGRVSNGTAASYIAASYVKFVESAGARVVPLIYN  96

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            EP E L++KL+LVNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF+L
Sbjct  97   EPEERLLEKLSLVNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGIPFPLFAQCLGFEL  156

Query  510  LTIIVSEDNIILEKFSASXQASTLQ  584
            +++IVS+DN ILE FSA+ QASTLQ
Sbjct  157  VSMIVSKDNNILESFSATNQASTLQ  181



>ref|XP_010540146.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Tarenaya hassleriana]
Length=405

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CP+ +P+LNY+PVIGI+SHPGDGASGR++NAT  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  101  CPSLNPNLNYQPVIGILSHPGDGASGRLNNATNASYIAASYVKLAEAGGARVIPLIYNEP  160

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  ++G Y E +K+I+ K LE+ND G++FP+ AI LGF+LL+
Sbjct  161  EEVLFQKLELVNGVIFTGGWAKRGLYYETVKKIFNKALERNDAGEHFPVYAICLGFELLS  220

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S+D  ILE+F+A   ASTLQ V
Sbjct  221  MIISQDRNILEEFAAEDAASTLQFV  245



>ref|XP_006389965.1| hypothetical protein EUTSA_v10018776mg [Eutrema salsugineum]
 gb|ESQ27251.1| hypothetical protein EUTSA_v10018776mg [Eutrema salsugineum]
Length=355

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNY+PVIGI+SHPGDGASGR++NAT  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  51   CSAPDPNLNYKPVIGILSHPGDGASGRLNNATNASYIAASYVKLAEAGGARVIPLIYNEP  110

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL+LVNGV+F GG  ++G Y + +K+I+ K LE+ND G++FP+ AI LGF+LLT
Sbjct  111  EEFLFQKLDLVNGVIFTGGWAKQGLYYDIVKKIFNKALERNDAGEHFPVYAICLGFELLT  170

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  ILEK  A   AS+LQ V
Sbjct  171  MIISQNTDILEKVDAKNSASSLQFV  195



>dbj|BAJ98663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   190 bits (483),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = +3

Query  147  SGGCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
            +G C AP DP++  RPVIGIV+HPGDGA+GRI+N T  SYI AS VKFVE+ GARVIPLI
Sbjct  34   AGACAAPADPAVYDRPVIGIVTHPGDGAAGRINNGTSTSYIGASYVKFVEAGGARVIPLI  93

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            YNEP E L++KL+LVNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF
Sbjct  94   YNEPDERLLQKLSLVNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGF  153

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQ  584
            +L+++IVS+DN ILE F AS QASTLQ
Sbjct  154  ELVSMIVSKDNNILESFHASDQASTLQ  180



>ref|NP_001185429.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
 gb|AEE36138.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
Length=333

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLI+NEP
Sbjct  43   CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103  EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ V
Sbjct  163  MIISQNRDIFEKMDARNSASSLQFV  187



>gb|AAC83041.1| Strong similarity to gb|AF067141 gamma-glutamyl hydrolase from 
Arabidopsis thaliana. ESTs gb|R83955, gb|T45062, gb|T22220, 
gb|AA586207, gb|AI099851 and gb|AI00672 come from this gene 
[Arabidopsis thaliana]
Length=327

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLI+NEP
Sbjct  23   CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEP  82

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  83   EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  142

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ V
Sbjct  143  MIISQNRDIFEKMDARNSASSLQFV  167



>ref|NP_565186.2| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
 sp|O65355.2|GGH2_ARATH RecName: Full=Gamma-glutamyl hydrolase 2; Short=AtGGH2; AltName: 
Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49804.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana]
 gb|AAM20068.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana]
 gb|AEE36137.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
Length=347

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLI+NEP
Sbjct  43   CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103  EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ V
Sbjct  163  MIISQNRDIFEKMDARNSASSLQFV  187



>ref|XP_010429695.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=355

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR++NAT  SYI +S VKF E+ GARVIPLIYNEP
Sbjct  51   CSAPDPNLNYRPVIGILSHPGDGASGRLNNATNASYITSSYVKFAEAGGARVIPLIYNEP  110

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  111  EELLFQKLELVNGVILTGGWAKEGLYFEIVKKIFHKVLERNDAGEHFPLYAICLGFELLT  170

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I +K  A   AS+LQ +
Sbjct  171  MIISQNRDIFKKVDARNCASSLQFI  195



>emb|CDX88464.1| BnaC06g39080D [Brassica napus]
Length=344

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDPSLNY+PVIGI++HPGDGA+GR++N T  SYIAAS VK  E+ GARV+PLIYNEP
Sbjct  40   CSAPDPSLNYKPVIGILTHPGDGATGRLNNDTNASYIAASYVKLAEAGGARVVPLIYNEP  99

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +KG Y + +K+I+ + LE+NDGG++FP+ AI LGF+LLT
Sbjct  100  EELLFQKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLT  159

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ V
Sbjct  160  MIISQNTDIFEKVDAKNAASSLQFV  184



>dbj|BAJ93186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = +3

Query  147  SGGCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
            +G C AP DP++  RPVIGIV+HPGDGA+GRI+N T  SYI AS VKFVE+ GARVIPLI
Sbjct  34   AGACAAPADPAVYDRPVIGIVTHPGDGAAGRINNGTSTSYIGASYVKFVEAGGARVIPLI  93

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            YNEP E L++KL+LVNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF
Sbjct  94   YNEPDERLLQKLSLVNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGF  153

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQ  584
            +L+++IVS+DN ILE F AS QASTLQ
Sbjct  154  ELVSMIVSKDNNILESFHASDQASTLQ  180



>ref|XP_003568092.2| PREDICTED: gamma-glutamyl hydrolase 2-like [Brachypodium distachyon]
Length=352

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +3

Query  153  GCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             C AP DP++  RPVIGIVSHPGDGASG+ISN T  SYIAAS VKF+ESAGARVIPLIYN
Sbjct  52   ACAAPPDPAVYDRPVIGIVSHPGDGASGKISNGTATSYIAASYVKFIESAGARVIPLIYN  111

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            EP E L++KL+LVNGV+F GGS + G Y E +K++++ V++KND G   PL A  LGF+L
Sbjct  112  EPEERLLEKLSLVNGVLFTGGSQKSGIYFETIKKVFQYVVDKNDAGVILPLFAQCLGFEL  171

Query  510  LTIIVSEDNIILEKFSASXQASTLQ  584
            +++IVS+DN ILE FSAS QASTLQ
Sbjct  172  ISMIVSKDNNILESFSASNQASTLQ  196



>ref|XP_002887752.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64011.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLIYN+P
Sbjct  43   CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIYNDP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103  EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ +
Sbjct  163  MIISQNRDIFEKMDARNSASSLQFL  187



>ref|XP_002862660.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38918.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
Length=347

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLIYN+P
Sbjct  43   CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIYNDP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103  EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ +
Sbjct  163  MIISQNRDIFEKMDARNSASSLQFL  187



>gb|ACU20290.1| unknown [Glycine max]
Length=246

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DPSLNY+PVIGI++HPGDGASGR SNATGVSYIAAS VKFVES GARVIPLIY
Sbjct  40   SVSCIATDPSLNYKPVIGILTHPGDGASGRPSNATGVSYIAASYVKFVESGGARVIPLIY  99

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NE  E L KKL+LVNGV+F GG    G YL+ L  I+KK LEKND GD+FP++A NLG  
Sbjct  100  NESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALEKNDAGDHFPVIAFNLGGN  159

Query  507  LLTIIVSEDNIILEKFSASXQASTL  581
            L+  IVSE   ILE F+AS   S+L
Sbjct  160  LVIRIVSEQTDILEPFTASSLPSSL  184



>gb|KFK42250.1| hypothetical protein AALP_AA2G230700 [Arabis alpina]
Length=336

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
            LS  C +PDP+LNYRPVIGI+SHPGDGASGR+SN T  +YIAAS VKF E+ GARVIPLI
Sbjct  34   LSPVCSSPDPNLNYRPVIGILSHPGDGASGRLSNDTSATYIAASYVKFAEAGGARVIPLI  93

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
            Y EP E L KKL LVNGV+F GG  ++G Y + +K+I+ K LE+NDGG++FP+  I LGF
Sbjct  94   YTEPEEVLFKKLELVNGVIFTGGWAKEGLYYDIVKKIFNKALERNDGGEHFPVYGICLGF  153

Query  504  QLLTIIVSEDNIILEKFSASXQASTLQ  584
            +L+++IVS++  ILE F +   AS+LQ
Sbjct  154  ELISMIVSQNRDILENFDSENSASSLQ  180



>ref|NP_001235549.1| gamma-glutamyl hydrolase precursor [Glycine max]
 sp|P93164.1|GGH_SOYBN RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; 
AltName: Full=GH; AltName: Full=Gamma-Glu-X carboxypeptidase; 
Flags: Precursor [Glycine max]
 gb|AAB26960.1| gamma glutamyl hydrolase [Glycine max]
Length=342

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DPSLNY+PVIGI++HPGDGASGR+SNATGVSYIAAS VKFVES GARVIPLIY
Sbjct  40   SVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIY  99

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NE  E L KKL+LVNGV+F GG    G YL+ L  I+KK LE+ND GD+FP++A NLG  
Sbjct  100  NESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALERNDAGDHFPVIAFNLGGN  159

Query  507  LLTIIVSEDNIILEKFSASXQASTL  581
            L+  IVSE   ILE F+AS   S+L
Sbjct  160  LVIRIVSEQTDILEPFTASSLPSSL  184



>ref|XP_006833066.1| hypothetical protein AMTR_s00170p00050820, partial [Amborella 
trichopoda]
 gb|ERM98344.1| hypothetical protein AMTR_s00170p00050820, partial [Amborella 
trichopoda]
Length=372

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CPAPDP+L Y+PVIGI++HPGDGASGR+ N + VSYIAAS VKF E+AGARVIPLIYNE
Sbjct  83   SCPAPDPALYYQPVIGILTHPGDGASGRLMNGSHVSYIAASYVKFCEAAGARVIPLIYNE  142

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
              E L++KLNLVNG++  GG  ++G Y + ++ I+K VLE+ND GD+FPL+AI L F+L+
Sbjct  143  RREVLLEKLNLVNGMLLTGGWCKRGLYYDTVEMIFKHVLERNDAGDHFPLVAICLNFELI  202

Query  513  TIIVSEDNIILEKFSASXQASTLQ  584
            +IIVS+D  I E++SA    STLQ
Sbjct  203  SIIVSQDRSIFERYSALDLPSTLQ  226



>ref|XP_009406770.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  CP+ DPSL Y PVIGIV+HPGDGASGR+SN T  S I AS VKFVESAGARVIPLIY
Sbjct  54   ASSCPSTDPSLYYLPVIGIVTHPGDGASGRLSNVTSASNIPASYVKFVESAGARVIPLIY  113

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP ETL+ KL+LVNGV+F GG  +KG Y E + ++++  LE+ND GD+FPL AI LGF+
Sbjct  114  NEPEETLLDKLSLVNGVLFTGGWAKKGLYFETITKLFQVTLERNDAGDHFPLFAICLGFE  173

Query  507  LLTIIVSEDNIILEKFSASXQASTL  581
            L+++I+S D  I E+F    QASTL
Sbjct  174  LVSMIISNDCDICERFKGENQASTL  198



>ref|XP_006655488.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Oryza brachyantha]
Length=320

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +3

Query  186  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  365
            RPVIG+VSHPGDGA GRISN T  SYIAAS VKFVESAGARV+PL+YNEP E L++KLNL
Sbjct  32   RPVIGVVSHPGDGAGGRISNGTATSYIAASYVKFVESAGARVVPLVYNEPEERLLEKLNL  91

Query  366  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIIL  545
            VNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF+L+++I+S+DN IL
Sbjct  92   VNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGIPFPLFAQCLGFELVSMIISKDNNIL  151

Query  546  EKFSASXQASTLQ  584
            E FSA  QASTLQ
Sbjct  152  ETFSAENQASTLQ  164



>ref|XP_006593481.1| PREDICTED: gamma-glutamyl hydrolase isoform X1 [Glycine max]
Length=342

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  C A DPSLNY+PVIGI++HPGDGASGR+SNATGVSYIAAS VKFVES GARVIPLIY
Sbjct  40   SVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIY  99

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NE  E L KKL+LVNGV+F GG    G YL+ L   ++K LEKND GD+FP++A NLG  
Sbjct  100  NESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGTFFQKALEKNDAGDHFPVIAFNLGGN  159

Query  507  LLTIIVSEDNIILEKFSASXQASTL  581
            L+  IVSE   ILE F+AS   S+L
Sbjct  160  LVIRIVSEQTDILEPFTASSLPSSL  184



>gb|KFK42251.1| hypothetical protein AALP_AA2G230800 [Arabis alpina]
Length=352

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APDP++NY+PVIGI+SHPGDGASGR+SN T  +YIAAS VKF ES GARVIPLIYNEP
Sbjct  48   CSAPDPNMNYKPVIGILSHPGDGASGRLSNDTSSTYIAASYVKFAESGGARVIPLIYNEP  107

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG   +G Y + +K+I+ + LE+ND G++FP+ AI LGF+LLT
Sbjct  108  EELLFQKLELVNGVIFTGGWAMEGLYYDIVKKIFNRALERNDDGEHFPVYAICLGFELLT  167

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  ILE   A   A++LQ V
Sbjct  168  MIISQNRDILEHVDAKNSATSLQFV  192



>gb|ACG46729.1| gamma-glutamyl hydrolase precursor [Zea mays]
Length=342

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C  PDP++  RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AGARVIPL+YNEP
Sbjct  45   CAPPDPAVYDRPVIGIVSHPGDGAGGRISNTTATSYIGASYVKFVEAAGARVIPLVYNEP  104

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L++KL+L+NGV+F GGS ++G Y + +K +++ VL+KND G+ FPL A  LGF+L++
Sbjct  105  EDRLLEKLSLLNGVLFTGGSEKEGVYFDTIKRVFQYVLDKNDAGEPFPLFAQCLGFELVS  164

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
            +IVS+DN ILE F A  QASTLQ
Sbjct  165  MIVSKDNNILEAFDALDQASTLQ  187



>ref|XP_002441385.1| hypothetical protein SORBIDRAFT_09g025680 [Sorghum bicolor]
 gb|EES19815.1| hypothetical protein SORBIDRAFT_09g025680 [Sorghum bicolor]
Length=344

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  186  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  365
            RPVIGIVSHPGDGA GRISN T  SYIAAS VKFVE+ GARVIP+IYNEP E L++KL+L
Sbjct  59   RPVIGIVSHPGDGAGGRISNTTATSYIAASYVKFVEAGGARVIPIIYNEPEEQLLEKLSL  118

Query  366  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIIL  545
            VNGV+F GGS ++G Y E +K++++ VL+KND G+ FPL A  LGF+L+++IVS+DN IL
Sbjct  119  VNGVLFTGGSAKQGLYFETIKKVFQYVLDKNDAGEQFPLFAQCLGFELVSMIVSKDNNIL  178

Query  546  EKFSASXQASTLQ  584
            EKF A  QASTLQ
Sbjct  179  EKFDALNQASTLQ  191



>gb|KFK42249.1| hypothetical protein AALP_AA2G230600 [Arabis alpina]
Length=326

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C + DP+LNY+P+IGI+SHPGDGASGR++N +  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  22   CSSQDPNLNYKPIIGILSHPGDGASGRLTNDSSSTYIAASYVKFAEAGGARVIPLIYNEP  81

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+F GG  +K EY + +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  82   EELLFQKLELVNGVIFTGGWAKKYEYFDIVKKIFNKALERNDAGEHFPVYGICLGFELMS  141

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            II+S++  ILE+F A   AS+LQ V
Sbjct  142  IIISQNRDILERFDAEDNASSLQFV  166



>ref|XP_006477850.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X3 [Citrus 
sinensis]
Length=302

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75   ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  342  TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             L +KL LVNGV+  GG  +KG Y + +++I+KK+LEKND G+ FPL AI LGF+L+++I
Sbjct  135  ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKKILEKNDAGEYFPLYAICLGFELISMI  194

Query  522  VSEDNIILEKFSASXQASTLQVV  590
            +S+D  ILE+F+ + QASTL+ +
Sbjct  195  ISKDRNILERFNGADQASTLKFI  217



>ref|XP_006477849.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=339

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75   ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  342  TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             L +KL LVNGV+  GG  +KG Y + +++I+KK+LEKND G+ FPL AI LGF+L+++I
Sbjct  135  ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKKILEKNDAGEYFPLYAICLGFELISMI  194

Query  522  VSEDNIILEKFSASXQASTLQVV  590
            +S+D  ILE+F+ + QASTL+ +
Sbjct  195  ISKDRNILERFNGADQASTLKFI  217



>ref|XP_006370105.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
 gb|ERP66674.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
Length=239

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            CPAPD +LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGAR+IPLIYNEP
Sbjct  87   CPAPDTNLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARIIPLIYNEP  146

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KLNLVNGV+F GG  + G Y +  K I+K+VL +ND G +FP+ AI LGF++LT
Sbjct  147  REILFEKLNLVNGVLFTGGWAKTGLYFDTAKAIFKEVLARNDAGFHFPVYAICLGFEILT  206

Query  516  IIVSE  530
            +I+SE
Sbjct  207  MIISE  211



>ref|XP_010417473.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=368

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APD +LNYRPVIGI+SHPGDGASGR++NAT  S IAAS VK  E+ GARVIPLIYNEP
Sbjct  64   CSAPDLNLNYRPVIGILSHPGDGASGRLNNATNASNIAASYVKLAETGGARVIPLIYNEP  123

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  124  EELLFQKLELVNGVILTGGWAKQGLYFEIVKKIFYKVLERNDAGEHFPLYAICLGFELLT  183

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ +
Sbjct  184  MIISQNRDIFEKVDARNCASSLQFI  208



>ref|XP_008354553.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Malus domestica]
Length=236

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +3

Query  126  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  305
            L T+   S  C APDP  NYRPVIGI+SHPGDGASGR SNA+  SYIAAS V FVESAGA
Sbjct  70   LGTSDSSSSKCTAPDPKXNYRPVIGILSHPGDGASGRXSNASTASYIAASYVXFVESAGA  129

Query  306  RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  485
            RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+KK++EKND GD+FPL 
Sbjct  130  RVIPLIYNEPPDILFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKKIIEKNDXGDHFPLY  189

Query  486  AINLGFQLLTIIVSEDNII  542
            AI LGF+LL +I+S+ N +
Sbjct  190  AICLGFELLAMIISKVNYL  208



>ref|XP_006301184.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella]
 gb|EOA34082.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella]
Length=276

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C A DP+LNYRPVIGI+SHPGDGASGR++NAT  S + AS VK  E+ GARVIPLIYNEP
Sbjct  49   CSASDPNLNYRPVIGILSHPGDGASGRLNNATNASNVVASYVKLAEAGGARVIPLIYNEP  108

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  109  EELLFQKLELVNGVLLTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPLYAICLGFELLT  168

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+S++  I EK  A   AS+LQ +
Sbjct  169  MIISQNRDIFEKVDARNCASSLQFI  193



>ref|XP_006477848.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=371

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75   ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  342  TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             L +KL LVNGV+  GG  +KG Y + +++I+KK+LEKND G+ FPL AI LGF+L+++I
Sbjct  135  ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKKILEKNDAGEYFPLYAICLGFELISMI  194

Query  522  VSEDNIILEKFSASXQASTLQVV  590
            +S+D  ILE+F+ + QASTL+ +
Sbjct  195  ISKDRNILERFNGADQASTLKFI  217



>ref|XP_010472700.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=368

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C APD +LNYRPVIGI+SHPGDGASGR++NAT  S IAAS VK  E+ GARVIPLIYNEP
Sbjct  64   CSAPDLNLNYRPVIGILSHPGDGASGRLNNATNASNIAASYVKLAEAGGARVIPLIYNEP  123

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  124  EELLFQKLELVNGVILTGGWAKEGLYFEIVKKIFYKVLERNDAGEHFPLYAICLGFELLT  183

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +IVS++  I EK  A   AS+LQ +
Sbjct  184  MIVSQNRGIFEKVDARNCASSLQFI  208



>gb|KHN36905.1| Gamma-glutamyl hydrolase [Glycine soja]
Length=346

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGD----GASGRISNATGVSYIAASNVKFVESAGARVI  314
            S  C A DP+LNY+PVIGI++HPGD    GASGR+SNATGVSYIAAS VKFVES GARVI
Sbjct  40   SVSCTATDPNLNYKPVIGILTHPGDAPDDGASGRLSNATGVSYIAASYVKFVESGGARVI  99

Query  315  PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  494
            PLIYNE  E L KKL+LVNGV+F GG    G YL+ L  I+KK LEKND GD+FP++A N
Sbjct  100  PLIYNESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALEKNDAGDHFPVIAFN  159

Query  495  LGFQLLTIIVSEDNIILEKFSASXQASTL  581
            LG  L+  IVSE   ILE F+AS   S+L
Sbjct  160  LGGNLVIRIVSEQTDILEPFTASSLPSSL  188



>gb|EYU26311.1| hypothetical protein MIMGU_mgv1a022410mg [Erythranthe guttata]
Length=393

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  338
            P P P L + PVIGI+SHPG+G SG  + AT  SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  99   PRPIPKLKFTPVIGILSHPGNGGSGSSNKATKASYIAASYVKFVESAGARVIPLIYNEPL  158

Query  339  ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
            + + +KLNLVNGV+F GG+ + G Y + +K I+K VL +ND G+ FPLLAI LGF+L+T+
Sbjct  159  KVINEKLNLVNGVIFTGGTAKSGVYFDVVKSIFKSVLRRNDAGEQFPLLAICLGFELITM  218

Query  519  IVSEDNIILEKFSASXQASTLQVV  590
            IVSE   ILE F A   ASTL+++
Sbjct  219  IVSEKKNILETFDAKNHASTLKIM  242



>ref|XP_004961495.1| PREDICTED: gamma-glutamyl hydrolase-like [Setaria italica]
Length=346

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +3

Query  186  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  365
            RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AGARVIPL+YNEP E L++KL+L
Sbjct  59   RPVIGIVSHPGDGAGGRISNGTATSYIGASYVKFVEAAGARVIPLVYNEPEERLLEKLSL  118

Query  366  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIIL  545
            VNGV+F GGS ++G Y E +K+ ++  L++ND G+ FP+ A  LGF+L+++IVS+DN IL
Sbjct  119  VNGVLFTGGSEKQGVYFETIKKSFQYALDRNDAGEPFPVFAQCLGFELVSMIVSKDNNIL  178

Query  546  EKFSASXQASTLQ  584
            E F A  QASTLQ
Sbjct  179  EMFDAQNQASTLQ  191



>ref|XP_009406769.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 113/166 (68%), Gaps = 21/166 (13%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  CP+ DPSL Y PVIGIV+HPGDGASGR+SN T  S I AS VKFVESAGARVIPLIY
Sbjct  54   ASSCPSTDPSLYYLPVIGIVTHPGDGASGRLSNVTSASNIPASYVKFVESAGARVIPLIY  113

Query  327  NEPTETL---------------------IKKLNLVNGVVFPGGSFEKGEYLEALKEIYKK  443
            NEP ETL                     ++KL+LVNGV+F GG  +KG Y E + ++++ 
Sbjct  114  NEPEETLLDVGPFLLSFLLPNSVSQSKKLRKLSLVNGVLFTGGWAKKGLYFETITKLFQV  173

Query  444  VLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTL  581
             LE+ND GD+FPL AI LGF+L+++I+S D  I E+F    QASTL
Sbjct  174  TLERNDAGDHFPLFAICLGFELVSMIISNDCDICERFKGENQASTL  219



>ref|XP_009406768.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 113/166 (68%), Gaps = 21/166 (13%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  CP+ DPSL Y PVIGIV+HPGDGASGR+SN T  S I AS VKFVESAGARVIPLIY
Sbjct  54   ASSCPSTDPSLYYLPVIGIVTHPGDGASGRLSNVTSASNIPASYVKFVESAGARVIPLIY  113

Query  327  NEPTETL---------------------IKKLNLVNGVVFPGGSFEKGEYLEALKEIYKK  443
            NEP ETL                     ++KL+LVNGV+F GG  +KG Y E + ++++ 
Sbjct  114  NEPEETLLDVGPFLLSFLLPNSVSQSKKLRKLSLVNGVLFTGGWAKKGLYFETITKLFQV  173

Query  444  VLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTL  581
             LE+ND GD+FPL AI LGF+L+++I+S D  I E+F    QASTL
Sbjct  174  TLERNDAGDHFPLFAICLGFELVSMIISNDCDICERFKGENQASTL  219



>ref|XP_010248393.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Nelumbo 
nucifera]
Length=292

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  135  NWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVI  314
            +W+ S  C APDP+L +RPVIGI++HP  GAS    NA+  S I AS VKFVESAGARVI
Sbjct  43   SWR-SSSCQAPDPALYFRPVIGILTHPAHGASNG-PNASNASLITASYVKFVESAGARVI  100

Query  315  PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  494
            PLIYNEP E L +KL+LVNGV+ PGG  + G + E +++++K  LEKND GD+FP+ AI 
Sbjct  101  PLIYNEPPEILAEKLSLVNGVLLPGGWAKTGLFYEIVEKVFKHALEKNDSGDHFPVFAIC  160

Query  495  LGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
            L F+LLT+I+S+D  ILE+F+A  QASTLQ
Sbjct  161  LSFELLTMIISKDVNILERFNALNQASTLQ  190



>ref|XP_010248391.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Nelumbo 
nucifera]
Length=346

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  135  NWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVI  314
            +W+ S  C APDP+L +RPVIGI++HP  GAS    NA+  S I AS VKFVESAGARVI
Sbjct  43   SWR-SSSCQAPDPALYFRPVIGILTHPAHGASNG-PNASNASLITASYVKFVESAGARVI  100

Query  315  PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  494
            PLIYNEP E L +KL+LVNGV+ PGG  + G + E +++++K  LEKND GD+FP+ AI 
Sbjct  101  PLIYNEPPEILAEKLSLVNGVLLPGGWAKTGLFYEIVEKVFKHALEKNDSGDHFPVFAIC  160

Query  495  LGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
            L F+LLT+I+S+D  ILE+F+A  QASTLQ
Sbjct  161  LSFELLTMIISKDVNILERFNALNQASTLQ  190



>gb|EYU26310.1| hypothetical protein MIMGU_mgv1a022815mg [Erythranthe guttata]
Length=333

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  189  PVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLV  368
            PVIGI+SHPGDG SG+ +NA   SYIAAS VKFVESAGARVIPLIYNEP+E   +KLNLV
Sbjct  57   PVIGILSHPGDGNSGKFNNAPSASYIAASYVKFVESAGARVIPLIYNEPSELRKEKLNLV  116

Query  369  NGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILE  548
            NGV+F GG  +K  Y + ++ I++ VL KN+ G++FPLLAI LGF+LL ++VSE+  ILE
Sbjct  117  NGVIFTGGRSKKTSYFDVVESIFEYVLRKNNAGNHFPLLAICLGFELLAMVVSENKNILE  176

Query  549  KFSASXQASTLQ  584
            KF A  QASTL+
Sbjct  177  KFDAKNQASTLK  188



>gb|EYU26304.1| hypothetical protein MIMGU_mgv1a019206mg, partial [Erythranthe 
guttata]
Length=330

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  338
            P  +P L   PVIGI+SHPGDG SG+ +NA   SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  78   PRANPELKLGPVIGILSHPGDGNSGKFNNAPSASYIAASYVKFVESAGARVIPLIYNEPL  137

Query  339  ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
            + + +KLNLVNGV+F GGS ++  Y   +K I++ V   ND G +FPLLAI LGF+LLT+
Sbjct  138  KVINEKLNLVNGVIFTGGSSKRTSYFNVVKSIFENVRRMNDAGHHFPLLAICLGFELLTM  197

Query  519  IVSEDNIILEKFSASXQASTL  581
            +VSE   ILEKF A  QA+TL
Sbjct  198  VVSEKKNILEKFDALNQATTL  218



>ref|XP_002441384.1| hypothetical protein SORBIDRAFT_09g025670 [Sorghum bicolor]
 gb|EES19814.1| hypothetical protein SORBIDRAFT_09g025670 [Sorghum bicolor]
Length=388

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +3

Query  168  DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            DP++N RPVIGIV+HPGDG   R ++  G SYIAAS V+FV+SAGARVIPL+Y+EP E L
Sbjct  97   DPAVNDRPVIGIVTHPGDGTYERRTHGPG-SYIAASYVRFVQSAGARVIPLLYDEPEERL  155

Query  348  IKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            ++KL LVNGV+F GGS + G Y E +K +++ VL++ND GD FPL A  LGF+L+++IVS
Sbjct  156  LEKLGLVNGVLFTGGSQKNGSYFETIKRVFQYVLDRNDAGDPFPLHAECLGFELISMIVS  215

Query  528  EDNIILEKFSASXQASTLQ  584
            +DN ILE F A  Q STLQ
Sbjct  216  KDNNILESFHALNQTSTLQ  234



>gb|KJB13019.1| hypothetical protein B456_002G051600 [Gossypium raimondii]
Length=379

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   DP L YRPVIGI+SHP  GASG      G SYI AS VKFVE+AG RVIPLIYNEP
Sbjct  82   CANADPKLYYRPVIGILSHPVGGASG------GRSYIVASYVKFVEAAGGRVIPLIYNEP  135

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L + L LVNGV+ PGG  + G Y +  ++I+KKV+EKND GD+FPL AI LGF+LLT
Sbjct  136  EEILFQ-LELVNGVLLPGGRSKSGLYYDIAEKIFKKVIEKNDRGDHFPLYAICLGFELLT  194

Query  516  IIVSEDNIILEKFSASXQASTLQVV  590
            +I+SED  ILE+FSA  +AS+LQ V
Sbjct  195  MIISEDKKILERFSALNRASSLQFV  219



>ref|XP_004146090.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
Length=362

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   +PSL YRPVIGI+SHPGDGASGR SNAT  SYI AS VKFVESAGARVIPLIYN+P
Sbjct  74   CTKVNPSLYYRPVIGILSHPGDGASGRYSNATTASYIPASYVKFVESAGARVIPLIYNDP  133

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +K+ LVNGV+F GG    G Y    ++I++++L +N+ GD  PL  I+LGFQ+++
Sbjct  134  PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFQQILSRNEAGDYVPLYGISLGFQIIS  193

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
             +VS+ N I+E F+A+   S L+
Sbjct  194  AMVSQRNDIIETFNATRFPSALK  216



>gb|KGN55060.1| hypothetical protein Csa_4G627110 [Cucumis sativus]
Length=348

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   +PSL YRPVIGI+SHPGDGASGR SNAT  SYI AS VKFVESAGARVIPLIYN+P
Sbjct  74   CTKVNPSLYYRPVIGILSHPGDGASGRYSNATTASYIPASYVKFVESAGARVIPLIYNDP  133

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +K+ LVNGV+F GG    G Y    ++I++++L +N+ GD  PL  I+LGFQ+++
Sbjct  134  PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFQQILSRNEAGDYVPLYGISLGFQIIS  193

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
             +VS+ N I+E F+A+   S L+
Sbjct  194  AMVSQRNDIIETFNATRFPSALK  216



>ref|NP_001142323.1| uncharacterized protein LOC100274493 precursor [Zea mays]
 gb|ACF88187.1| unknown [Zea mays]
Length=171

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C  PDP++  RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AG+RVIPL+YNEP
Sbjct  45   CAPPDPAVYDRPVIGIVSHPGDGAGGRISNTTATSYIGASYVKFVEAAGSRVIPLVYNEP  104

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             + L++KL+L+NGV+F GGS ++G Y + +K +++ VL+KND G+ FPL A  LGF+L++
Sbjct  105  EDRLLEKLSLLNGVLFTGGSEKEGVYFDTIKRVFQYVLDKNDAGEPFPLFAQCLGFELVS  164

Query  516  IIVSE  530
            +IVS+
Sbjct  165  MIVSK  169



>ref|XP_002862659.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38917.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 116/154 (75%), Gaps = 6/154 (4%)
 Frame = +3

Query  141  KLSGGCPAPDPSLNYRPVIGIVSHPGDGA--SGRIS----NATGVSYIAASNVKFVESAG  302
            + S  C +PDP+LNY+PVIGI++HPG+G   +GR S     +T +SYIAAS VK  E+ G
Sbjct  41   RSSHVCSSPDPNLNYKPVIGILTHPGEGRWDAGRHSLSYAYSTNISYIAASYVKLAETGG  100

Query  303  ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPL  482
            ARVIPLIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KVLEKND G++FP+
Sbjct  101  ARVIPLIYNEPEELLFQKLELVNGVIFTGGWAKTGLYYDIVEKIFNKVLEKNDAGEHFPV  160

Query  483  LAINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
             A+ LGF++L++I+S++  ILE+F++   AS+LQ
Sbjct  161  YAMCLGFEILSMIISQNRDILERFNSVNYASSLQ  194



>ref|XP_002887751.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64010.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = +3

Query  141  KLSGGCPAPDPSLNYRPVIGIVSHPGDGA--SGRIS----NATGVSYIAASNVKFVESAG  302
            + S  C +PDP+LNY+PVIGI++HPG+G   +GR S     +T +SYIAAS VK  E+ G
Sbjct  41   RSSHVCSSPDPNLNYKPVIGILTHPGEGRWDAGRHSLSYAYSTNISYIAASYVKLAETGG  100

Query  303  ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPL  482
            ARVIPLIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KVLEKND G++FP+
Sbjct  101  ARVIPLIYNEPEELLFQKLELVNGVIFTGGWAKTGLYYDIVEKIFNKVLEKNDAGEHFPV  160

Query  483  LAINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
             A+ LGF++L++I+S++  ILE+F +   AS+LQ
Sbjct  161  YAMCLGFEILSMIISQNRDILERFDSVNYASSLQ  194



>gb|AAM65646.1| gamma glutamyl hydrolase, putative [Arabidopsis thaliana]
Length=352

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDG-ASGRISN------ATGVSYIAASNVKFVESAG  302
            LS  C A DP+LNY+PVIGI++HPG+G    R+ +      AT +SYIAAS VK  E+ G
Sbjct  43   LSPVCSAADPNLNYKPVIGILTHPGEGRWDARLHSLKNYAYATNISYIAASYVKLAETGG  102

Query  303  ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPL  482
            ARVIPLIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KV+EKND G++FP+
Sbjct  103  ARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKTGLYYDVVEKIFNKVMEKNDAGEHFPV  162

Query  483  LAINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
             A+ LGF++L++I+S++  ILE+F++   AS+LQ
Sbjct  163  YAMCLGFEILSMIISQNRDILERFNSVNYASSLQ  196



>ref|NP_177988.1| gamma-glutamyl hydrolase 3 [Arabidopsis thaliana]
 sp|Q9ZV85.1|GGH3_ARATH RecName: Full=Probable gamma-glutamyl hydrolase 3; Short=AtGGH3; 
AltName: Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK63854.1|AF389281_1 At1g78670/F9K20_29 [Arabidopsis thaliana]
 gb|AAC83042.1| Similar to gb|AF067141 gamma-glutamyl hydrolase from Arabidopsis 
thaliana. ESTs gb|T46595 and gb|AI09918 come from this gene 
[Arabidopsis thaliana]
 gb|AAN18123.1| At1g78670/F9K20_29 [Arabidopsis thaliana]
 gb|AEE36136.1| gamma-glutamyl hydrolase 3 [Arabidopsis thaliana]
Length=352

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDG-ASGRISN------ATGVSYIAASNVKFVESAG  302
            LS  C A DP+LNY+PVIGI++HPG+G    R+ +      AT +SYIAAS VK  E+ G
Sbjct  43   LSPVCSAADPNLNYKPVIGILTHPGEGRWDARLHSLKNYAYATNISYIAASYVKLAETGG  102

Query  303  ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPL  482
            ARVIPLIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KV+EKND G++FP+
Sbjct  103  ARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKTGLYYDVVEKIFNKVMEKNDAGEHFPV  162

Query  483  LAINLGFQLLTIIVSEDNIILEKFSASXQASTLQ  584
             A+ LGF++L++I+S++  ILE+F++   AS+LQ
Sbjct  163  YAMCLGFEILSMIISQNRDILERFNSVNYASSLQ  196



>gb|AES66560.2| gamma-glutamylhydrolase [Medicago truncatula]
Length=311

 Score =   162 bits (409),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 98/148 (66%), Gaps = 29/148 (20%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S  CPAPD SL Y+PVIGI+SHPGDGASGR+SNAT  SY+AAS VKFVE+ GARV+PLIY
Sbjct  39   SVNCPAPDSSLYYQPVIGILSHPGDGASGRLSNATDASYLAASYVKFVEAGGARVVPLIY  98

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
             EP E L+                             KKVLEKND GD FPL A  LGF+
Sbjct  99   TEPWEILL-----------------------------KKVLEKNDAGDYFPLYATCLGFE  129

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
            L+T+IVSEDN ILE F+A  QAS+LQ V
Sbjct  130  LITMIVSEDNDILEDFAAENQASSLQFV  157



>gb|ABK22567.1| unknown [Picea sitchensis]
Length=334

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 113/163 (69%), Gaps = 7/163 (4%)
 Frame = +3

Query  114  FSYLLNTNWKLSGGCPAPDP----SLN---YRPVIGIVSHPGDGASGRISNATGVSYIAA  272
            F ++LN    L    P+ D     +LN   YRP+IGIV+HPGDGA G++S A   SYIAA
Sbjct  15   FIHVLNAQQSLRLRLPSEDAKAEKTLNSEFYRPLIGIVTHPGDGAHGKLSTAPNASYIAA  74

Query  273  SNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLE  452
            S VKFVES GARV+P IYNEP E L +K   VNG++F GGS + G Y + ++ ++++ LE
Sbjct  75   SYVKFVESGGARVVPFIYNEPPEVLEQKFRAVNGLLFTGGSAKYGPYHQTVENLFQRALE  134

Query  453  KNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTL  581
            +ND G+ FP+ A+ LGF++L++IVS+D  ILE+F A+   STL
Sbjct  135  ENDNGEYFPVYAVCLGFEILSMIVSKDLNILERFDAANHPSTL  177



>ref|XP_004151669.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
Length=187

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   +P L+YRPVIGI+SHPGDGASGR +NA+  SYI AS VKF+ESAGARVIPLIYN+P
Sbjct  57   CTKVNPLLHYRPVIGILSHPGDGASGRHTNASNASYIPASYVKFIESAGARVIPLIYNDP  116

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +K+ LVNGV+F GG    G Y    ++I+K++L +N+ GD+ PL  I+LGFQ+++
Sbjct  117  PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFKQILSRNEDGDHVPLYGISLGFQIIS  176

Query  516  IIVSEDNIIL  545
             +VS+  +I+
Sbjct  177  AMVSQRYVII  186



>ref|XP_004172076.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
Length=320

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   +PSL YRPVIGI+SHPGDGASGR SNAT  SYI AS VKFVESAGARVIPLIYN+P
Sbjct  74   CTKVNPSLYYRPVIGILSHPGDGASGRYSNATTASYIPASYVKFVESAGARVIPLIYNDP  133

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +K+ LVNGV+F GG    G Y    ++I++++L +N+ GD  PL  I+LGFQ+++
Sbjct  134  PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFQQILSRNEAGDYVPLYGISLGFQIIS  193

Query  516  IIVSEDNIILEKFSASXQASTL  581
             +VS+  I  E F    + S  
Sbjct  194  AMVSQYGISPETFEQDERLSDF  215



>gb|KGN55059.1| hypothetical protein Csa_4G627100 [Cucumis sativus]
Length=355

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C   +P L+YRPVIGI+SHPGDGASGR +NA+  SYI AS VKF+ESAGARVIPLIYN+P
Sbjct  57   CTKVNPLLHYRPVIGILSHPGDGASGRHTNASNASYIPASYVKFIESAGARVIPLIYNDP  116

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
             E L +K+ LVNGV+F GG    G Y    ++I+K++L +N+ GD+ PL  I+LGFQ+++
Sbjct  117  PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFKQILSRNEDGDHVPLYGISLGFQIIS  176

Query  516  IIVSEDNIILEKFSASXQASTLQ  584
             +VS+   I+  F+AS   S L+
Sbjct  177  AMVSQRYGIIVPFNASRFPSALK  199



>ref|XP_009106581.1| PREDICTED: probable gamma-glutamyl hydrolase 3 [Brassica rapa]
Length=343

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNAT------GVSYIAASNVKFVESAGARVIP  317
            C APD +LN +P+IGI++HPG G      + +       VSYIAAS VKF E+ GARVIP
Sbjct  39   CSAPDRNLNDKPIIGILTHPGVGTFDAPRDHSLSYYEKNVSYIAASYVKFAETGGARVIP  98

Query  318  LIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  497
            LIYNEP E L +KL LVNGV+F GG  ++G Y + +++I+ KVLEKND G++FP+ A+ L
Sbjct  99   LIYNEPQERLFQKLELVNGVIFTGGWAKEGLYFDIVQKIFGKVLEKNDAGEHFPVYAMCL  158

Query  498  GFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            GF++L++I+S+   ILE+F++   AS+LQ +
Sbjct  159  GFEILSMIISQSRDILERFNSVYYASSLQFI  189



>ref|XP_003596310.1| Gamma-glutamyl hydrolase [Medicago truncatula]
Length=247

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 98/146 (67%), Gaps = 25/146 (17%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CP P+P+L Y+PVIGI+SHPGDG SGR SNATG S+I AS VKFVE+AGARV+PLIYNE
Sbjct  23   SCPPPNPNLYYQPVIGILSHPGDGTSGRHSNATGASFIHASYVKFVEAAGARVVPLIYNE  82

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E ++K                       + E  K  L KND GD+FPL AI LGF+L+
Sbjct  83   PEEKILK-----------------------VSE--KATLPKNDAGDHFPLYAICLGFELI  117

Query  513  TIIVSEDNIILEKFSASXQASTLQVV  590
            ++I+SED  ILE+F A  QASTLQ V
Sbjct  118  SVIISEDKNILEEFKAKNQASTLQFV  143



>gb|AES66561.2| class I glutamine amidotransferase [Medicago truncatula]
Length=261

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 98/146 (67%), Gaps = 25/146 (17%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
             CP P+P+L Y+PVIGI+SHPGDG SGR SNATG S+I AS VKFVE+AGARV+PLIYNE
Sbjct  23   SCPPPNPNLYYQPVIGILSHPGDGTSGRHSNATGASFIHASYVKFVEAAGARVVPLIYNE  82

Query  333  PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  512
            P E ++K                       + E  K  L KND GD+FPL AI LGF+L+
Sbjct  83   PEEKILK-----------------------VSE--KATLPKNDAGDHFPLYAICLGFELI  117

Query  513  TIIVSEDNIILEKFSASXQASTLQVV  590
            ++I+SED  ILE+F A  QASTLQ V
Sbjct  118  SVIISEDKNILEEFKAKNQASTLQFV  143



>ref|XP_007149561.1| hypothetical protein PHAVU_005G080600g [Phaseolus vulgaris]
 gb|ESW21555.1| hypothetical protein PHAVU_005G080600g [Phaseolus vulgaris]
Length=346

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            LN RPVIGI+SHPGDG+SGR+SN + VSYIAAS VKFVES GARVIPL+YNE  + L KK
Sbjct  54   LNQRPVIGILSHPGDGSSGRLSNVSDVSYIAASYVKFVESGGARVIPLLYNESPQNLNKK  113

Query  357  LNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDN  536
            L+LVNGV+F GG    G YL+ L+ ++KK LE+ND GD+FP+L +NLG  LL  IV++  
Sbjct  114  LDLVNGVLFTGGWATSGPYLQTLQYVFKKALERNDAGDHFPVLGLNLGGNLLIKIVADQG  173

Query  537  IILEKFSASXQASTLQV  587
             +LE F+AS   S LQ+
Sbjct  174  DVLETFNASSLLSYLQL  190



>gb|AAC33745.1| gamma-glutamyl hydrolase [Arabidopsis thaliana]
Length=326

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  210  HPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPG  389
            HPG+GASGR+SNA     IAAS VK  ES GARVIPLI+NEP E L +KL LVNGV+  G
Sbjct  40   HPGNGASGRLSNAIDAPSIAASYVKLAESGGARVIPLIFNEPGEILFQKLELVNGVILTG  99

Query  390  GSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQ  569
            G  ++G Y E +K+I  KVLE+ND G++FP+ AI LGF+LLT+I+S++  I EK  A   
Sbjct  100  GWAKEGLYFEIVKKILNKVLERNDAGEHFPIYAICLGFELLTMIISQNRDIFEKMDARNS  159

Query  570  ASTLQVV  590
            AS+LQ V
Sbjct  160  ASSLQFV  166



>ref|XP_010324181.1| PREDICTED: gamma-glutamylhydrolase 3 isoform X1 [Solanum lycopersicum]
Length=307

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 93/147 (63%), Gaps = 30/147 (20%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
             GCP PD +LNYRPVIGI+SHPGDG SGRI+N+TGVSYIAAS VK VES GARVIPL+++
Sbjct  30   AGCPLPDHNLNYRPVIGIISHPGDGDSGRINNSTGVSYIAASYVKLVESGGARVIPLLFD  89

Query  330  EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            +  + L +KLNLVNGV+FPGG  +KG Y E +K I+                        
Sbjct  90   DSPQLLNQKLNLVNGVIFPGGWAKKGHYFETIKAIFG-----------------------  126

Query  510  LTIIVSEDNIILEKFSASXQASTLQVV  590
                   DN ILEKFS S QA+ L  V
Sbjct  127  -------DNNILEKFSVSNQATKLHFV  146



>ref|XP_008363668.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Malus domestica]
Length=138

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +3

Query  126  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  305
            L T+   S  C APDP +NYRPVIGI+SHPGDGASGR+SNA   SYIAAS VKFVESAGA
Sbjct  32   LRTSDSSSSKCTAPDPKINYRPVIGILSHPGDGASGRLSNAXTASYIAASYVKFVESAGA  91

Query  306  RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKV  446
            RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+K +
Sbjct  92   RVIPLIYNEPPDXLFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKVI  138



>gb|AAL15332.1| At1g78660/T30F21_25 [Arabidopsis thaliana]
Length=165

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  44   CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  103

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEK  455
             E L +KL LVNGV+F GG  +K +Y E +K+I+ K   +
Sbjct  104  EEVLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKAWRE  143



>ref|XP_007021917.1| Gamma-glutamyl hydrolase 1 isoform 2 [Theobroma cacao]
 gb|EOY13442.1| Gamma-glutamyl hydrolase 1 isoform 2 [Theobroma cacao]
Length=358

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 90/148 (61%), Gaps = 30/148 (20%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81   ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  327  NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
            NEP E L +KL LVNGV+F GG  + G Y E  ++I+K                      
Sbjct  141  NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFK----------------------  178

Query  507  LLTIIVSEDNIILEKFSASXQASTLQVV  590
                    D  ILE FSA+ QAS+LQ V
Sbjct  179  --------DRNILESFSAADQASSLQFV  198



>ref|XP_006389966.1| hypothetical protein EUTSA_v10018738mg [Eutrema salsugineum]
 gb|ESQ27252.1| hypothetical protein EUTSA_v10018738mg [Eutrema salsugineum]
Length=371

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 99/171 (58%), Gaps = 28/171 (16%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  43   CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  102

Query  336  TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIY--------------------------  437
               L +KL LVNGV+F GG  +K +Y + +K+I+                          
Sbjct  103  ERLLFQKLELVNGVIFTGGWAKKYQYFDIVKKIFNVLFGFVLPGTFSVYNTIPIFFMLLH  162

Query  438  KKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            +K+  +      F  +A      L  + +  D  ILE+F A   AS+LQ V
Sbjct  163  RKLWREMMLESIFQYMAFASDSSLCQLSLVRD--ILERFDAEDNASSLQFV  211



>emb|CDX87443.1| BnaA07g34300D [Brassica napus]
Length=294

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  255  VSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEI  434
            VSYIAAS VKF E+ GARVIPLIYNEP E L +KL LVNGV+F GG  ++G Y + +++I
Sbjct  29   VSYIAASYVKFAETGGARVIPLIYNEPQERLFQKLELVNGVIFTGGWAKEGLYFDIVQKI  88

Query  435  YKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            + KVLEKND G++FP+ A+ LGF++L++I+S+   ILE+F++   AS+LQ +
Sbjct  89   FGKVLEKNDAGEHFPVYAMCLGFEILSMIISQSRDILERFNSVYYASSLQFI  140



>ref|XP_006442389.1| hypothetical protein CICLE_v10024365mg [Citrus clementina]
 gb|ESR55629.1| hypothetical protein CICLE_v10024365mg [Citrus clementina]
Length=208

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75   ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  342  TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYK--KVLEKNDGGDN  473
             L  KL LVNGV+  GG  +KG Y + +++I+K   +LE+ +G D 
Sbjct  135  ILFGKLKLVNGVLLTGGWAKKGLYFQIVEKIFKDRNILERFNGADQ  180



>ref|XP_002984712.1| hypothetical protein SELMODRAFT_423816 [Selaginella moellendorffii]
 gb|EFJ14357.1| hypothetical protein SELMODRAFT_423816 [Selaginella moellendorffii]
Length=330

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (63%), Gaps = 10/152 (7%)
 Frame = +3

Query  165  PDPSLNYRPVIGIVSHPGDGASGRISNA--------TGVSYIAASNVKFVESAGARVIPL  320
            P+ S   RP+IGI++ PGDG      N         + +SYIAAS VKFVE+ GAR +PL
Sbjct  24   PEESREKRPLIGILTQPGDGDDRSYINRLEPGDPRRSNISYIAASYVKFVEAGGARAVPL  83

Query  321  IYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  494
            +YNEP ETL KK +L+NG++F GG  S + G Y  A + ++K+ LE ND GD FP+    
Sbjct  84   LYNEPWETLAKKFSLINGILFAGGSASLQDGPYYRASEFLFKRALEANDKGDYFPVFGTC  143

Query  495  LGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            LG +LL +IVS ++ IL+ ++A   A  L  V
Sbjct  144  LGLELLAVIVSGNHSILDDYNAHKAAGELNFV  175



>ref|XP_002978801.1| hypothetical protein SELMODRAFT_177157 [Selaginella moellendorffii]
 gb|EFJ20248.1| hypothetical protein SELMODRAFT_177157 [Selaginella moellendorffii]
Length=330

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (63%), Gaps = 10/152 (7%)
 Frame = +3

Query  165  PDPSLNYRPVIGIVSHPGDGASGRISNA--------TGVSYIAASNVKFVESAGARVIPL  320
            P+ S   RP+IGI++ PGDG      N         + +SYIAAS VKFVE+ GAR +PL
Sbjct  24   PEESREKRPLIGILTQPGDGDGRSYINRLEPGDPRRSNISYIAASYVKFVEAGGARAVPL  83

Query  321  IYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  494
            +YNEP ETL KK +L+NG++F GG  S + G Y  A + ++K+ LE ND GD FP+    
Sbjct  84   LYNEPWETLAKKFSLINGILFAGGSASLQDGPYYRAGEFLFKRALEANDKGDYFPVFGTC  143

Query  495  LGFQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            LG +LL +IVS ++ IL+ ++A   A  L  V
Sbjct  144  LGLELLAVIVSGNHSILDDYNAHKAAGELNFV  175



>gb|KDO36288.1| hypothetical protein CISIN_1g028817mg [Citrus sinensis]
Length=203

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75   ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  342  TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYK  440
             L +KL LVNGV+  GG  +KG Y + +++I+K
Sbjct  135  ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFK  167



>ref|XP_001772336.1| predicted protein [Physcomitrella patens]
 gb|EDQ62807.1| predicted protein [Physcomitrella patens]
Length=304

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 92/142 (65%), Gaps = 7/142 (5%)
 Frame = +3

Query  186  RPVIGIVSHPGDGASGRISNA-----TGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            RP+IG++S PGDG   ++++         SYIAAS VKFVE  GAR +PLI+NEP ETL 
Sbjct  7    RPLIGVLSQPGDGEEYQLTSRPLPPDYNTSYIAASYVKFVEMGGARAVPLIWNEPEETLR  66

Query  351  KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            KK   +NGV+FPGG  S +   +    ++++   +E ND GD+FP+  + LGF+LL+IIV
Sbjct  67   KKFASINGVLFPGGGASLKDTPFYRVAEKLFNWAIEANDRGDHFPVYGVCLGFELLSIIV  126

Query  525  SEDNIILEKFSASXQASTLQVV  590
            S+++ ILE+F A      L  V
Sbjct  127  SKNHYILERFEAENNPGPLLFV  148



>gb|EYU26306.1| hypothetical protein MIMGU_mgv1a019546mg [Erythranthe guttata]
Length=231

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 24/150 (16%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
            +S  C       N+ PVIGI           + NAT  SYIAA         GARVIPLI
Sbjct  2    ISLRCRPAVLKFNFGPVIGI-----------LGNATDASYIAA---------GARVIPLI  41

Query  324  YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYK-KVLEKNDGGDNFPLLAINLG  500
            YNEP E   +KLNLVNGV+F   S   G Y + +K I++  V  KND G +FPLLAI LG
Sbjct  42   YNEPLELRNEKLNLVNGVIFTAKS---GVYFDVVKSIFEINVRRKNDAGHHFPLLAICLG  98

Query  501  FQLLTIIVSEDNIILEKFSASXQASTLQVV  590
            F+LLT+IVSED  I++KF+A   AS  +V+
Sbjct  99   FELLTMIVSEDENIMDKFNAKNHASNFKVM  128



>ref|XP_001782403.1| predicted protein [Physcomitrella patens]
 gb|EDQ52797.1| predicted protein, partial [Physcomitrella patens]
Length=294

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 14/149 (9%)
 Frame = +3

Query  186  RPVIGIVSHPGDGASGRISNATGV----------SYIAASNVKFVESAGARVIPLIYNEP  335
            RP+IGI+S PGDG    +++  G+          SYIAAS VKFVE  GAR +PLI+NEP
Sbjct  1    RPLIGILSQPGDGMGYSLTSTGGLEKPVPPGYSTSYIAASYVKFVEMGGARAVPLIWNEP  60

Query  336  TETLIKKLNLVNGVVFPGG--SFEKGEYLEALKE-IYKKVLEKNDGGDNFPLLAINLGFQ  506
             ETL KK + +NG++FPGG  S +   +       + +  +E ND GD+FP+  + LGF+
Sbjct  61   EETLRKKFSAINGILFPGGGTSLKDSPFFRLCHGVVVQWAIEANDRGDHFPIYGVCLGFE  120

Query  507  LLTIIVSEDNI-ILEKFSASXQASTLQVV  590
            LL++IVS+ N  ILE F A      L  V
Sbjct  121  LLSVIVSKQNHDILEPFHAENNPGPLLFV  149



>dbj|GAM18533.1| hypothetical protein SAMD00019534_017080, partial [Acytostelium 
subglobosum LB1]
Length=327

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 83/138 (60%), Gaps = 7/138 (5%)
 Frame = +3

Query  156  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  335
            C  P  + N RP+IGI+S P DG       A G  YIAAS VKF+ESAGARV+P++Y+  
Sbjct  20   CVTPINAQNLRPIIGILSQPTDGDMA----ALGDQYIAASYVKFIESAGARVVPILYDMS  75

Query  336  TETLIKKLNLVNGVVFPGGSFEKGE---YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
             + L   L+ +NGV+FPGG  +      Y + LK I+  V+E ND G+ FPL    +GFQ
Sbjct  76   QDDLKTLLSQLNGVLFPGGGVDLANSPTYYDNLKLIWSFVIESNDNGNPFPLWGTCMGFQ  135

Query  507  LLTIIVSEDNIILEKFSA  560
             L ++ +++  IL  F +
Sbjct  136  ELCMLAADNLNILSPFDS  153



>ref|XP_011409161.1| PREDICTED: gamma-glutamyl hydrolase A-like, partial [Amphimedon 
queenslandica]
Length=151

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            SLN RP+IGIVS          +   G SYIAAS VK++ESAGARV+P+I N   + L  
Sbjct  19   SLNLRPIIGIVSE---------TTTEGHSYIAASYVKYIESAGARVVPIINNITQDELKD  69

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
                +NGV+FPGG  S  +  YLE  K I++   + ND GD FPL    LGFQLL ++ S
Sbjct  70   LFGSINGVLFPGGGSSLVESAYLEVAKTIFELAKQANDEGDYFPLWGTCLGFQLLCVLQS  129

Query  528  EDNIILEKFSA  560
              N IL  F +
Sbjct  130  GTNHILSSFDS  140



>ref|XP_003294636.1| hypothetical protein DICPUDRAFT_51633 [Dictyostelium purpureum]
 gb|EGC28836.1| hypothetical protein DICPUDRAFT_51633 [Dictyostelium purpureum]
Length=267

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 9/150 (6%)
 Frame = +3

Query  123  LLNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAG  302
             L TN     GC     +LN RPVIGI+S P   AS       G  YIAAS VK+VESAG
Sbjct  17   FLKTNCLKQDGCHH---ALNDRPVIGILSQP---ASSDKYKEYGYQYIAASYVKYVESAG  70

Query  303  ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSF---EKGEYLEALKEIYKKVLEKNDGGDN  473
            ARV+P++Y++  +TL K LN +NG++ PGG     E+  Y ++L  I+  V+E N  GD 
Sbjct  71   ARVVPILYDQDEDTLRKLLNSINGILLPGGGVYFDEQPIYNKSLYLIWNYVIESNKRGDY  130

Query  474  FPLLAINLGFQLLTIIVSEDNIILEKFSAS  563
            FPL    LGF+ +  + +    +L  F+AS
Sbjct  131  FPLWGTCLGFEEIVSVAANTFDVLTSFNAS  160



>ref|XP_011395864.1| Gamma-glutamyl hydrolase A [Auxenochlorella protothecoides]
 gb|KFM22997.1| Gamma-glutamyl hydrolase A [Auxenochlorella protothecoides]
Length=360

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 84/137 (61%), Gaps = 9/137 (7%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IG+VS  GD A        G +YIAAS +KF+E+AGARVIP++ + P E + ++ 
Sbjct  49   NMRPIIGVVSQEGDPAP------KGHTYIAASYIKFLEAAGARVIPILADMPPEEVERRF  102

Query  360  NLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
             LVNG++ PGGS     G  + +   +I++  L+ ND GD FPL    LGF+ L +I S+
Sbjct  103  KLVNGILVPGGSQVLRPGHGFYDVTSKIFELTLKANDHGDFFPLHGTCLGFETLAVIASK  162

Query  531  DNIILEKFSASXQASTL  581
            ++ IL +F A    S L
Sbjct  163  NHSILSEFDAENLPSPL  179



>gb|EFA81874.1| peptidase C26 family protein [Polysphondylium pallidum PN500]
Length=321

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 7/132 (5%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            SLN RP+IGI+S P +G         G  YIAAS VK++ESAGARV+P+ ++    T+  
Sbjct  23   SLNLRPIIGILSQPTNGEMASF----GDQYIAASYVKWIESAGARVVPIFFDSDAATVKS  78

Query  354  KLNLVNGVVFPGGSFE---KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
             L+ +NGVVFPGG  +   +  Y + LK I++ VL  N  G  FPL    +GFQ L ++ 
Sbjct  79   LLSQINGVVFPGGGVDLAAQPAYTDTLKLIWQTVLASNQNGGFFPLWGTCMGFQQLCMLA  138

Query  525  SEDNIILEKFSA  560
             +D  IL  F++
Sbjct  139  GDDFNILTGFNS  150



>ref|XP_005830901.1| hypothetical protein GUITHDRAFT_72685 [Guillardia theta CCMP2712]
 gb|EKX43921.1| hypothetical protein GUITHDRAFT_72685 [Guillardia theta CCMP2712]
Length=334

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 87/137 (64%), Gaps = 6/137 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP++GI+S P  G  G   N +G SYIA+S VKFVE AGARVIP+I+N P + ++ ++
Sbjct  28   NERPIVGILSQPCTGFRG--CNESG-SYIASSYVKFVEMAGARVIPIIFNAPHDEIMFRM  84

Query  360  NLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
              V+ ++FPGG+   + G  + E  K +++ V++ N  G  FPL    LGF+LL I+V+ 
Sbjct  85   RYVHMLLFPGGAVPLQPGTLFFETSKSLFEHVIDLNKRGFWFPLHGTCLGFELLHILVAR  144

Query  531  DNIILEKFSASXQASTL  581
               +L+ F+++   S L
Sbjct  145  SGGVLQTFNSTNCRSKL  161



>ref|XP_637673.1| peptidase C26 family protein [Dictyostelium discoideum AX4]
 sp|Q54LN4.1|GGHA_DICDI RecName: Full=Gamma-glutamyl hydrolase A; AltName: Full=Conjugase 
A; AltName: Full=GH A; AltName: Full=Gamma-Glu-X carboxypeptidase 
A; Flags: Precursor [Dictyostelium discoideum]
 gb|EAL64169.1| peptidase C26 family protein [Dictyostelium discoideum AX4]
Length=317

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 83/131 (63%), Gaps = 7/131 (5%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            +N RP+IGI++ P DG         G  YIAAS VK++ESAGARV+P++Y+   ++L + 
Sbjct  26   INNRPIIGILTQPTDGDMTTF----GSQYIAASYVKYIESAGARVVPILYDIDIKSLTEL  81

Query  357  LNLVNGVVFPGGSFE---KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            +  +NGV FPGG  +   +  Y + ++ I+ +V+E N+ GD FPL    +GFQ L ++ +
Sbjct  82   MGSINGVFFPGGGVDFNNQTVYTDTIQSIWSQVVEFNNNGDYFPLWGTCMGFQELALLSA  141

Query  528  EDNIILEKFSA  560
            ++  +L  +++
Sbjct  142  DNFNLLSSYNS  152



>ref|XP_007251560.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Astyanax 
mexicanus]
Length=309

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 5/137 (4%)
 Frame = +3

Query  138  WKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIP  317
            W +   C +    LNYRPVIG+++     +    ++A G SYIAAS VK++ESAGARV+P
Sbjct  8    WAVLAACASASVPLNYRPVIGVLAQENLESD---THAQGSSYIAASYVKYLESAGARVVP  64

Query  318  LIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAI  491
            +  N   E   K    +NG++ PGG    +K ++    K  Y+  ++ ND  D FP+   
Sbjct  65   IRINGSEEDYTKIFYAINGLLLPGGDVDLQKSQFSRVSKIFYELAIKANDAADYFPIWGT  124

Query  492  NLGFQLLTIIVSEDNII  542
              GFQ LT++ S  N++
Sbjct  125  CQGFQQLTVLTSSKNLL  141



>ref|XP_007421928.1| PREDICTED: gamma-glutamyl hydrolase [Python bivittatus]
Length=316

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 5/125 (4%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            S N RP+IGI++   D  S +     G SYIAAS VKF+ESAGARV+P+  N   E   K
Sbjct  28   SENERPIIGILAQETDFKSFQ---KFGSSYIAASYVKFIESAGARVVPIRLNRSYEEYDK  84

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
              + +NG++FPGG    +  E+ +  K  YKK LE ND GD FP+    LG QLL  + S
Sbjct  85   IFHGINGILFPGGGVDLKTSEFSKVAKIFYKKALEANDRGDYFPIWGTCLGHQLLAYLTS  144

Query  528  EDNII  542
             ++++
Sbjct  145  GEDLL  149



>ref|XP_003287039.1| hypothetical protein DICPUDRAFT_31892 [Dictyostelium purpureum]
 gb|EGC36406.1| hypothetical protein DICPUDRAFT_31892 [Dictyostelium purpureum]
Length=314

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 82/132 (62%), Gaps = 7/132 (5%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            ++N RP+IGI++ P +G         G  Y+AAS VK++ESAGARV+P++Y+   ++L  
Sbjct  22   AVNNRPIIGILTQPTNGGMATY----GDQYLAASYVKYIESAGARVVPILYDTDIKSLTS  77

Query  354  KLNLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
              N +NG++FPGG   F+    Y   ++ I++ V+E N+ GD FPL    +GFQ L ++ 
Sbjct  78   LFNSINGILFPGGGVDFDNATVYTNTIQSIWQLVIESNNNGDYFPLWGTCMGFQELALLA  137

Query  525  SEDNIILEKFSA  560
            + +  +L  +++
Sbjct  138  AGNFDLLSSYNS  149



>ref|XP_007251559.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Astyanax 
mexicanus]
Length=340

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 5/137 (4%)
 Frame = +3

Query  138  WKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIP  317
            W +   C +    LNYRPVIG+++     +    ++A G SYIAAS VK++ESAGARV+P
Sbjct  8    WAVLAACASASVPLNYRPVIGVLAQENLESD---THAQGSSYIAASYVKYLESAGARVVP  64

Query  318  LIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAI  491
            +  N   E   K    +NG++ PGG    +K ++    K  Y+  ++ ND  D FP+   
Sbjct  65   IRINGSEEDYTKIFYAINGLLLPGGDVDLQKSQFSRVSKIFYELAIKANDAADYFPIWGT  124

Query  492  NLGFQLLTIIVSEDNII  542
              GFQ LT++ S  N++
Sbjct  125  CQGFQQLTVLTSSKNLL  141



>gb|KDD74766.1| hypothetical protein H632_c1088p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=323

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 85/157 (54%), Gaps = 10/157 (6%)
 Frame = +3

Query  123  LLNTN-WKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESA  299
            L +TN WK        +  LN RP+IG+V+  G  A        G +YIAAS +KFVESA
Sbjct  28   LSDTNAWKNDDDDDKREEKLNVRPIIGVVAQSGRPAP------EGHTYIAASYIKFVESA  81

Query  300  GARVIPLIYNEPTETLIKKLNLVNGVVFPGGS--FEKG-EYLEALKEIYKKVLEKNDGGD  470
            GARVIP++ + P   + ++   +NGV+ PGGS     G ++ + +  ++   L  ND GD
Sbjct  82   GARVIPILPDMPPAEVKRRFQAINGVLIPGGSQNLRPGNDFFDTVDLLFNLTLAANDAGD  141

Query  471  NFPLLAINLGFQLLTIIVSEDNIILEKFSASXQASTL  581
             FP+    LGF+ L +  S ++ IL  F A    S L
Sbjct  142  FFPMHGTCLGFEALAVAASRNHSILTHFDAEDLPSAL  178



>ref|XP_011304816.1| PREDICTED: gamma-glutamyl hydrolase B-like isoform X3 [Fopius 
arisanus]
Length=320

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = +3

Query  180  NYRPVIGIVS----HPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            N RP+IGI+S    H  +G  G   +    SY+AAS VK+VES+GARV+P+   +P E  
Sbjct  8    NDRPIIGILSQELSHRLNGIYG---DQQFDSYLAASYVKYVESSGARVVPIWIGQPEEYY  64

Query  348  IKKLNLVNGVVFPGGS--FEK-GEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
               L  +NGV+FPGGS  F++ G Y EA ++IY+  LE ND GD FP+    LGF+L+T 
Sbjct  65   KSLLTRINGVIFPGGSSWFDRSGGYAEAGEKIYRIALEMNDHGDYFPIWGTCLGFELMTY  124

Query  519  IVS  527
            + +
Sbjct  125  LAA  127



>ref|XP_011304814.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Fopius arisanus]
 ref|XP_011304815.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Fopius arisanus]
Length=332

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = +3

Query  180  NYRPVIGIVS----HPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            N RP+IGI+S    H  +G  G   +    SY+AAS VK+VES+GARV+P+   +P E  
Sbjct  20   NDRPIIGILSQELSHRLNGIYG---DQQFDSYLAASYVKYVESSGARVVPIWIGQPEEYY  76

Query  348  IKKLNLVNGVVFPGGS--FEK-GEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
               L  +NGV+FPGGS  F++ G Y EA ++IY+  LE ND GD FP+    LGF+L+T 
Sbjct  77   KSLLTRINGVIFPGGSSWFDRSGGYAEAGEKIYRIALEMNDHGDYFPIWGTCLGFELMTY  136

Query  519  IVS  527
            + +
Sbjct  137  LAA  139



>ref|XP_011304813.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Fopius arisanus]
Length=368

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = +3

Query  180  NYRPVIGIVS----HPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            N RP+IGI+S    H  +G  G   +    SY+AAS VK+VES+GARV+P+   +P E  
Sbjct  56   NDRPIIGILSQELSHRLNGIYG---DQQFDSYLAASYVKYVESSGARVVPIWIGQPEEYY  112

Query  348  IKKLNLVNGVVFPGGS--FEK-GEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  518
               L  +NGV+FPGGS  F++ G Y EA ++IY+  LE ND GD FP+    LGF+L+T 
Sbjct  113  KSLLTRINGVIFPGGSSWFDRSGGYAEAGEKIYRIALEMNDHGDYFPIWGTCLGFELMTY  172

Query  519  IVS  527
            + +
Sbjct  173  LAA  175



>ref|XP_002946185.1| hypothetical protein VOLCADRAFT_102798 [Volvox carteri f. nagariensis]
 gb|EFJ53180.1| hypothetical protein VOLCADRAFT_102798 [Volvox carteri f. nagariensis]
Length=331

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 83/137 (61%), Gaps = 9/137 (7%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S PGD A        G SYIAAS VK++ESAGARV+P+ Y+   + + ++ 
Sbjct  30   NLRPIIGILSQPGDPAP------EGESYIAASYVKWLESAGARVVPIFYDMDAQDIERRF  83

Query  360  NLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
             ++NG++ PGG  + E G  + +  + + +  L+ ND GD FP+    LG + L++I+S 
Sbjct  84   AVINGLLLPGGGATLEPGHRFYDTARYLVELALKANDNGDYFPVHGTCLGMETLSVIISS  143

Query  531  DNIILEKFSASXQASTL  581
            +  +L +F A    + L
Sbjct  144  NYTLLGEFDAEDAPAPL  160



>ref|XP_006113705.1| PREDICTED: gamma-glutamyl hydrolase [Pelodiscus sinensis]
Length=333

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 72/126 (57%), Gaps = 5/126 (4%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P  N RP+IGI++   D       +  G SYIAAS VKF+ESAGARV+P+  N   E   
Sbjct  43   PGSNERPIIGILAQECDFTGF---HRFGSSYIAASYVKFLESAGARVVPIRLNRTEEEYD  99

Query  351  KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            +    +NGV+FPGG    +  EY    K  Y K L+ ND GD FP+    LG++ LT + 
Sbjct  100  QIFQSINGVLFPGGGVDLKTSEYSRVAKMFYNKALQANDKGDYFPVWGTCLGYEELTYLT  159

Query  525  SEDNII  542
            SE+ ++
Sbjct  160  SEEVLL  165



>ref|XP_005469772.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_005469773.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Oreochromis 
niloticus]
Length=320

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 11/127 (9%)
 Frame = +3

Query  177  LNYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            LNYRP+IG+++    P D        A G SYIAAS VK++E+AGARV+P+  N   E  
Sbjct  32   LNYRPIIGVLAQENLPWDQF------ARGSSYIAASYVKYLEAAGARVVPIRINRTEEEY  85

Query  348  IKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             K  N +NG++ PGG    +  ++  A K  Y   L+ ND GD FP+     GFQ LT++
Sbjct  86   AKIFNSINGLLLPGGDVDLQTSQFSRAAKIFYNLALKANDAGDYFPIWGTCQGFQQLTVL  145

Query  522  VSEDNII  542
             +  N++
Sbjct  146  TANKNLL  152



>gb|EMT14979.1| Gamma-glutamyl hydrolase [Aegilops tauschii]
Length=279

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            KL+LVNGV+F GGS ++G Y E +K++++ VL+KND G  FPL A  LGF+L+++IVS+D
Sbjct  27   KLSLVNGVLFTGGSVKRGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGFELVSMIVSKD  86

Query  534  NIILEKFSASXQASTLQ  584
            N ILE F AS QASTLQ
Sbjct  87   NNILESFHASDQASTLQ  103



>ref|XP_006783068.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006783069.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Neolamprologus 
brichardi]
Length=320

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 11/127 (9%)
 Frame = +3

Query  177  LNYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            LNYRP+IG+++    P D        A G SYIAAS VK++E+AGARV+P+  N   E  
Sbjct  32   LNYRPIIGVLAQENLPWD------QFARGSSYIAASYVKYLEAAGARVVPIRINRTEEEY  85

Query  348  IKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             K  N +NG++ PGG    +  ++  A K  Y   L+ ND GD FP+     GFQ LT++
Sbjct  86   AKIFNSINGLLLPGGDVDLQTSQFSRAAKIFYNLALKGNDAGDYFPIWGTCQGFQQLTVL  145

Query  522  VSEDNII  542
             +  N++
Sbjct  146  TANKNLL  152



>ref|XP_004548914.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Maylandia 
zebra]
 ref|XP_004548915.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Maylandia 
zebra]
Length=320

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 11/127 (9%)
 Frame = +3

Query  177  LNYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            LNYRP+IG+++    P D        A G SYIAAS VK++E+AGARV+P+  N   E  
Sbjct  32   LNYRPIIGVLAQENLPWD------QFARGSSYIAASYVKYLEAAGARVVPIRINRTEEEY  85

Query  348  IKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             K  N +NG++ PGG    +  ++  A K  Y   L+ ND GD FP+     GFQ LT++
Sbjct  86   AKIFNSINGLLLPGGDVDLQTSQFSRAAKIFYNLALKGNDAGDYFPIWGTCQGFQQLTVL  145

Query  522  VSEDNII  542
             +  N++
Sbjct  146  TANKNLL  152



>ref|XP_001696183.1| gamma-glutamyl hydrolase [Chlamydomonas reinhardtii]
 gb|EDP08160.1| gamma-glutamyl hydrolase [Chlamydomonas reinhardtii]
Length=379

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 9/137 (7%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S PGD A        G SYIAAS VK++ESAGARV+P++Y+   + +  + 
Sbjct  74   NMRPIIGILSQPGDPAP------DGQSYIAASYVKWLESAGARVVPILYDMSPQQVEDRF  127

Query  360  NLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
            +++NG++ PGG  +   G  + +  +++    +  ND GD FP+    LG + L++I+S 
Sbjct  128  DVINGLLLPGGGATLAPGHRFYDTARQLVDLAVAANDNGDYFPVHGTCLGMETLSVILSA  187

Query  531  DNIILEKFSASXQASTL  581
            +  IL  F A    + L
Sbjct  188  NYTILSPFDAEDAPAPL  204



>ref|XP_005652325.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27781.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 80/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N R +IG++S P D A GR       SYIAAS VKF+E+AGARV+P +++     + ++ 
Sbjct  13   NNRVLIGLLSQPSDPA-GRHE-----SYIAASYVKFLEAAGARVVPFVHDMDKAEIKRRF  66

Query  360  NLVNGVVFPGGSFE---KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
            +++NG + PGGS        + +   E+ +   E ND GD FP+LAI LGF+ L +I S 
Sbjct  67   DMINGFLIPGGSARLSPGHTFFDTATEVVRLANEANDNGDYFPILAICLGFETLAVIASG  126

Query  531  DNIILEKFSASXQASTL  581
            +  IL  + +   A+ L
Sbjct  127  NTSILGSYDSEDTAAPL  143



>gb|EJY84998.1| peptidase C26 family protein [Oxytricha trifallax]
Length=334

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            LN RP+IG+++ P  D      + A   SYI AS + ++ESAGAR +PLIY+   +T + 
Sbjct  45   LNNRPLIGVLTQPLSDSQKADPAYAGKSSYIMASYIHYLESAGARTVPLIYDGDLDTELA  104

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            K++ +NGV + GG  E G+Y    K+++ KV + ND G++ P+    LGFQ L +  +++
Sbjct  105  KIDKLNGVFYCGGGAE-GDYDVFGKKVFLKVKQMNDDGNHMPIWGTCLGFQDLAMYSADN  163

Query  534  -NIILEKFSASXQASTLQVV  590
             N ILE F A    S L+ +
Sbjct  164  SNSILESFPADDNMSNLKFL  183



>ref|XP_010707289.1| PREDICTED: gamma-glutamyl hydrolase [Meleagris gallopavo]
Length=408

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = +3

Query  168  DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            +P  N RP++GI+S           +  G SYIAAS VKF+ESAGAR++P+  N   E  
Sbjct  117  EPEPNERPIVGILSQECHFDE---FHKFGSSYIAASYVKFLESAGARIVPIRLNLSDEEY  173

Query  348  IKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             K  + +NGV+FPGG    +  EY    K  Y+K LE ND GD FP+    LG +LLT +
Sbjct  174  DKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYRKALEANDKGDYFPIWGTCLGHELLTYL  233

Query  522  VS  527
             S
Sbjct  234  TS  235



>gb|EJY70467.1| peptidase C26 family protein [Oxytricha trifallax]
Length=334

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            LN RP+IG+++ P  D      + A   SYI AS + ++ESAGAR +PLIY+   +T + 
Sbjct  45   LNNRPLIGVLTQPLSDSQKADPAYAGKSSYIMASYIHYLESAGARTVPLIYDGDLDTELA  104

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            K++ +NGV + GG  E G+Y    K+++ KV + ND G++ P+    LGFQ L +  +++
Sbjct  105  KIDKLNGVFYCGGGAE-GDYDVFGKKVFLKVKQMNDDGNHMPIWGTCLGFQDLAMYSADN  163

Query  534  -NIILEKFSASXQASTLQVV  590
             N ILE F A    S L+ +
Sbjct  164  SNSILESFPADDNMSNLKFL  183



>ref|NP_001104645.1| uncharacterized protein LOC563836 precursor [Danio rerio]
 gb|AAI53968.1| Zgc:171566 protein [Danio rerio]
Length=314

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 72/125 (58%), Gaps = 5/125 (4%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            +LNYRP+IGI++           +A G SYIAAS VK +ESAGARV+P+  N   E    
Sbjct  25   NLNYRPIIGILAQENLEED---PHAQGTSYIAASYVKHLESAGARVVPIRINRTEEEYET  81

Query  354  KLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
              N +NG++ PGG+   E  ++  A +  Y+  L+ ND  D FP+     GFQ LT++ S
Sbjct  82   LFNAINGLLLPGGNVDIETSQFTRAARIFYELALKANDASDYFPIWGTCQGFQQLTVLTS  141

Query  528  EDNII  542
              N++
Sbjct  142  NKNLL  146



>gb|EJY70465.1| peptidase C26 family protein [Oxytricha trifallax]
Length=334

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            LN RP+IG+++ P  D      + A   SYI AS + ++ESAGAR +PLIY+   +T + 
Sbjct  45   LNNRPLIGVLTQPLSDNQKADPAYAGKSSYIMASYIHYLESAGARTVPLIYDGDLDTELA  104

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            K++ +NGV + GG  E G+Y    K+++ KV + ND G++ P+    LGFQ L +  +++
Sbjct  105  KIDKLNGVFYCGGGAE-GDYDVFGKKVFLKVKQMNDDGNHMPIWGTCLGFQDLAMYSADN  163

Query  534  -NIILEKFSASXQASTLQVV  590
             N ILE F A    S L+ +
Sbjct  164  SNSILESFPADDNMSNLKFL  183



>ref|XP_004350727.1| peptidase C26 family protein [Dictyostelium fasciculatum]
 gb|EGG14019.1| peptidase C26 family protein [Dictyostelium fasciculatum]
Length=335

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 7/131 (5%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            +N RP+IGI++ P +G         G  Y+AAS VK+VES GARV+P++Y+ P + +   
Sbjct  36   INNRPIIGILTQPTNGDMANY----GDQYLAASYVKYVESGGARVVPILYDSPADEIKSL  91

Query  357  LNLVNGVVFPGGSF---EKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
               +NGV  PGG     +  +Y + L+ +Y+ V++ ND  D FPL    +GFQ + ++ +
Sbjct  92   FQSINGVFLPGGGVDLDQSPQYTDTLRLLYQLVIQANDNQDYFPLWGTCMGFQEINMMQA  151

Query  528  EDNIILEKFSA  560
             +  IL  + +
Sbjct  152  NNLDILSPYDS  162



>ref|XP_011406398.1| PREDICTED: gamma-glutamyl hydrolase A-like [Amphimedon queenslandica]
Length=137

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 71/131 (54%), Gaps = 28/131 (21%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            SLN RP+IGIVS          +   G SYIAAS VK++ESAGARV+P++          
Sbjct  20   SLNLRPIIGIVSE---------TTTEGHSYIAASYVKYIESAGARVVPIM----------  60

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
                   V+FPGG  S  +  YLE  K I++   + ND GD FPL    LGFQLL ++ S
Sbjct  61   -------VLFPGGGSSLVESAYLEVAKTIFELAKQANDEGDYFPLWGTCLGFQLLCVLQS  113

Query  528  EDNIILEKFSA  560
              N IL  F +
Sbjct  114  GTNHILSSFDS  124



>ref|NP_001025598.1| gamma-glutamyl hydrolase precursor [Xenopus (Silurana) tropicalis]
 gb|AAH91047.1| ggh protein [Xenopus (Silurana) tropicalis]
Length=315

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI++        ++    G SYIAAS VK +ESAGARVIP++ N   E   K  
Sbjct  29   NDRPIIGILAQETHFEELQM---FGKSYIAASYVKTIESAGARVIPILLNLAEEEYEKIF  85

Query  360  NLVNGVVFPGGSFE--KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            N +NG++FPGG+ +  K EY    K  Y + LE ND GD FP+    LGF+ LT + S
Sbjct  86   NSINGILFPGGAVDLVKSEYARVAKIFYNQALEANDKGDYFPIWGTCLGFEELTYLSS  143



>gb|ETN66928.1| gamma-glutamyl hydrolase [Anopheles darlingi]
Length=364

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 4/126 (3%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGV-SYIAASNVKFVESAGARVIPLIYNEPT  338
            A +  +N +PV+GI+S        +     G  SYIAAS VKFVE AGARV+P+  N+P 
Sbjct  42   ASEALVNDKPVVGILSQELSYLMTQNYGDEGYDSYIAASYVKFVEGAGARVVPIWINQPP  101

Query  339  ETLIKKLNLVNGVVFPGGSF---EKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  509
            E   + ++ VNG++FPGG+    +   Y +A + IY   +  ND GD+FPL    LGF+L
Sbjct  102  EYYEEMMSYVNGILFPGGATWFNQSNGYADAGRHIYDHAIRLNDNGDHFPLWGTCLGFEL  161

Query  510  LTIIVS  527
            LT + +
Sbjct  162  LTYLAA  167



>gb|KDR20013.1| Gamma-glutamyl hydrolase [Zootermopsis nevadensis]
Length=318

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 3/126 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            LN RP+IGI+S                SYIAAS VK+VE AGARV+P+  N+        
Sbjct  23   LNNRPIIGILSQELTDYMKDKFPGNYTSYIAASYVKYVEEAGARVVPIKINQTESYYESV  82

Query  357  LNLVNGVVFPGG--SFE-KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            ++ VNGV+FPGG  SF   G Y +A  ++Y++ + KN+ GD FP+    LGF+LLT + +
Sbjct  83   IDTVNGVLFPGGAASFSASGGYADAAWKLYQRAVSKNNAGDYFPVWGTCLGFELLTYLAT  142

Query  528  EDNIIL  545
              + IL
Sbjct  143  RQHNIL  148



>gb|EJY70466.1| GATase domain containing protein [Oxytricha trifallax]
Length=334

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            +N RP+IG+++ P  D      +     SYI AS + ++ES GAR +PLIY+   +T + 
Sbjct  45   VNNRPLIGVLTQPLSDSQMSDPAYDGKTSYIMASYINYIESGGARTVPLIYDGDLDTELA  104

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            KL+ +NGV++ GGS   G+Y    K++++KV + ND G   P+    LGF+ L +  S+D
Sbjct  105  KLDKLNGVLYCGGS-GAGDYDYFGKKVFEKVKQMNDDGQYMPIWGTCLGFEDLAMYTSDD  163

Query  534  -NIILEKFSASXQASTLQVV  590
             + +LE+F+A  ++ +++ +
Sbjct  164  SDTVLERFAADDESYSVKFL  183



>gb|EJY69422.1| GATase domain containing protein [Oxytricha trifallax]
Length=334

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            +N RP+IG+++ P  D      +     SYI AS + ++ES GAR +PLIY+   +T + 
Sbjct  45   VNNRPLIGVLTQPLSDSQMSDPAYDGKTSYIMASYINYIESGGARTVPLIYDGDLDTELA  104

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            KL+ +NGV++ GGS   G+Y    K++++KV + ND G   P+    LGF+ L +  S+D
Sbjct  105  KLDKLNGVLYCGGS-GAGDYDYFGKKVFEKVKQMNDDGQYMPIWGTCLGFEDLAMYTSDD  163

Query  534  -NIILEKFSASXQASTLQVV  590
             + +LE+F+A  ++ +++ +
Sbjct  164  SDTVLERFAADDESYSVKFL  183



>ref|XP_003391262.1| PREDICTED: gamma-glutamyl hydrolase A-like, partial [Amphimedon 
queenslandica]
Length=268

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  258  SYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKE  431
            SYIAAS VK++ESAGARV+P+I N   + L      +NGV+FPGG  S  +  YLE  K 
Sbjct  2    SYIAASYVKYIESAGARVVPIINNITQDELKDLFGSINGVLFPGGGSSLVESAYLEVAKT  61

Query  432  IYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSA  560
            I++   + ND GD FPL    LGFQLL ++ S  N IL  F +
Sbjct  62   IFELAKQANDEGDYFPLWGTCLGFQLLCVLQSGTNHILSSFDS  104



>gb|EJY84997.1| GATase domain containing protein [Oxytricha trifallax]
Length=333

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +3

Query  177  LNYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            +N RP+IG+++ P  D      +     SYI AS + ++ES GAR +PLIY+   +T + 
Sbjct  44   VNNRPLIGVLTQPLSDSQMSDPAYDGKTSYIMASYINYIESGGARTVPLIYDGDLDTELA  103

Query  354  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  533
            KL+ +NGV++ GGS   G+Y    K++++KV + ND G   P+    LGF+ L +  S+D
Sbjct  104  KLDKLNGVLYCGGS-GAGDYDYFGKKVFEKVKQMNDDGQYMPIWGTCLGFEDLAMYTSDD  162

Query  534  -NIILEKFSASXQASTLQVV  590
             + +LE+F+A  ++ +++ +
Sbjct  163  SDTVLERFAADDESYSVKFL  182



>ref|XP_009075416.1| PREDICTED: gamma-glutamyl hydrolase, partial [Acanthisitta chloris]
Length=292

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 70/127 (55%), Gaps = 7/127 (6%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGD-GASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            LN RP+IGI+S     G   R     G SYIAAS VKFVESAGAR +P+  N   E   K
Sbjct  4    LNDRPIIGILSQECHYGEFQRF----GRSYIAASYVKFVESAGARAVPIRLNLTDEEYDK  59

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
                +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  60   IFYSINGVLFPGGGVDLKTSEYSRVAKIFYDKALEANDKGDYFPIWGTCLGHEELTYLTS  119

Query  528  EDNIILE  548
             D +++ 
Sbjct  120  GDILLVR  126



>ref|NP_001086160.1| gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) 
precursor [Xenopus laevis]
 gb|AAH74274.1| MGC84044 protein [Xenopus laevis]
Length=315

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI++        +     G SYIAAS VK +ESAGARVIP++ N   E   K  
Sbjct  29   NDRPIIGILAQETHFDELQ---TFGRSYIAASYVKTIESAGARVIPILLNLAEEEYQKIF  85

Query  360  NLVNGVVFPGGSFE--KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            N +NG++FPGG+ +  K EY    K  Y   LE ND GD FP+    LGF+ LT + S
Sbjct  86   NSINGILFPGGAVDLVKSEYARVAKLFYNWALEANDKGDYFPVWGTCLGFEELTYLTS  143



>ref|XP_006012487.1| PREDICTED: gamma-glutamyl hydrolase-like [Latimeria chalumnae]
Length=314

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 74/131 (56%), Gaps = 6/131 (5%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            A + +LNYRP+IGI   P  G      N TG +Y+AAS VKFVESAG RV+P+  +   E
Sbjct  22   ANNETLNYRPIIGI---PAQGKPPSF-NFTGETYLAASYVKFVESAGGRVVPVKMHLSYE  77

Query  342  TLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  515
                  + +NGV+ PGG       EY    K  Y   L+ ND GD FP+L I LGF+ L+
Sbjct  78   EYENLFHSINGVLLPGGGVHLNDSEYARVSKIFYNLALKANDKGDYFPMLGICLGFEELS  137

Query  516  IIVSEDNIILE  548
             +    N++++
Sbjct  138  FLTGGKNVLIK  148



>ref|XP_007021921.1| Serine-threonine protein kinase, putative [Theobroma cacao]
 gb|EOY13446.1| Serine-threonine protein kinase, putative [Theobroma cacao]
Length=655

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 66/113 (58%), Gaps = 34/113 (30%)
 Frame = +3

Query  189  PVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLV  368
            PVIGI+SH GDGASGR++N T  SY     VKF+E+AG RVIPL YNE  E L       
Sbjct  541  PVIGILSHRGDGASGRLNNDTNASY-----VKFMEAAGVRVIPLTYNEHEEIL-------  588

Query  369  NGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
                                  ++KV+EKN  GD+FPL AI LGF+LLT+I+S
Sbjct  589  ----------------------FEKVVEKNKAGDHFPLYAICLGFELLTMIIS  619



>ref|XP_419226.4| PREDICTED: gamma-glutamyl hydrolase [Gallus gallus]
Length=439

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 76/133 (57%), Gaps = 8/133 (6%)
 Frame = +3

Query  153  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  332
            GC   +P  N RP++GI+S           +  G SYIAAS VKF+ESAGAR++P+  N 
Sbjct  146  GC---EPGPNERPIVGILSQECHFDE---FHKFGSSYIAASYVKFLESAGARIVPIRLNL  199

Query  333  PTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  506
              E   +  + +NGV+FPGG    +  EY    K  Y+K LE ND GD FP+    LG +
Sbjct  200  SDEEYDRIFHSINGVLFPGGGVDLKTSEYSRVAKIFYRKALEANDKGDYFPVWGTCLGHE  259

Query  507  LLTIIVSEDNIIL  545
            LLT + S + +++
Sbjct  260  LLTYLTSGEILLV  272



>ref|XP_008171736.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase [Chrysemys 
picta bellii]
Length=326

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 72/128 (56%), Gaps = 8/128 (6%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI++      + R     G SYIAAS VKF+ESAGARV+P+      +   K  
Sbjct  37   NERPIIGILAQESLSKTFR---KYGKSYIAASYVKFIESAGARVVPIRLYRSEKEYDKIF  93

Query  360  NLVNG---VVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
               NG   V+FPGG  S +  EY    +  YKK L+ ND GD FP+    LG Q LT + 
Sbjct  94   KATNGXVLVLFPGGGVSLKTSEYARVARIFYKKALKANDKGDYFPVWGTCLGHQELTYLT  153

Query  525  SEDNIILE  548
            SE N++++
Sbjct  154  SEKNLLVK  161



>ref|XP_009707401.1| PREDICTED: gamma-glutamyl hydrolase, partial [Cariama cristata]
Length=289

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S        R     G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  2    NERPIIGILSQECHFEKFR---RFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  58

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  59   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  116



>ref|XP_002595632.1| hypothetical protein BRAFLDRAFT_275357 [Branchiostoma floridae]
 gb|EEN51644.1| hypothetical protein BRAFLDRAFT_275357 [Branchiostoma floridae]
Length=318

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P +N RP+IG+++   +GA  +     G +YI AS VK++ESAGARV+P+  N  T    
Sbjct  27   PEVNDRPIIGVIAQASEGARAKF----GKTYIPASYVKYLESAGARVVPIRVNLTTAEYT  82

Query  351  KKLNLVNGVVFPGGS---FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
            K  N +NGV++PGG    F  G Y ++ K  Y   L+  D GD FP+    +GF+ LT +
Sbjct  83   KLFNSLNGVLYPGGGVDMFTSG-YAKSAKIFYDLALKAFDEGDYFPVWGTCMGFEQLTAL  141

Query  522  VSEDNII  542
             S  N++
Sbjct  142  TSNRNVL  148



>ref|XP_005645555.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21011.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 73/139 (53%), Gaps = 17/139 (12%)
 Frame = +3

Query  186  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  365
            RP+IGI++ PG+ A G        SYIAAS +KFVESAGAR +P+ Y+ P   + +    
Sbjct  40   RPLIGILTQPGNPAPG------NQSYIAASYIKFVESAGARAVPIPYDAPRAEVQRLFRA  93

Query  366  VNGVVFPGGSFEKGEYLEALKEIYKK-------VLEKNDGGDNFPLLAINLGFQLLTIIV  524
            VNG + PGG    G+ L      +          +  ND GD FPL    LGF+ L +IV
Sbjct  94   VNGALIPGG----GQNLSPHHPFFDTSALLLNLSIAANDAGDFFPLHGTCLGFEALAVIV  149

Query  525  SEDNIILEKFSASXQASTL  581
            S D   L KF +   AS L
Sbjct  150  SGDGRALTKFDSYDNASPL  168



>gb|KFP61510.1| Gamma-glutamyl hydrolase, partial [Cariama cristata]
Length=309

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S        R     G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  22   NERPIIGILSQECHFEKFR---RFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  78

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  79   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  136



>gb|KFQ12123.1| Gamma-glutamyl hydrolase, partial [Leptosomus discolor]
Length=318

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP++GI+S        +  +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  31   NERPIVGILSQE---CHFKKFHRFGSSYIAASYVKFLESAGARVVPIRLNRSDEEYDKIF  87

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  88   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  145



>ref|XP_009950167.1| PREDICTED: gamma-glutamyl hydrolase [Leptosomus discolor]
Length=322

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP++GI+S        +  +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  35   NERPIVGILSQE---CHFKKFHRFGSSYIAASYVKFLESAGARVVPIRLNRSDEEYDKIF  91

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  92   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  149



>ref|XP_005815172.1| PREDICTED: gamma-glutamyl hydrolase-like, partial [Xiphophorus 
maculatus]
Length=167

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 11/126 (9%)
 Frame = +3

Query  180  NYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            N RP+IG+++    P D        A G SYIAAS +KF+ESAGARV P+  N   E  I
Sbjct  32   NDRPIIGVLAQENLPDD------QFARGSSYIAASYIKFLESAGARVAPIRINRTEEEYI  85

Query  351  KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            K  N +NG++ PGG    +  ++  A +  Y   L+ N+ GD FP+     GFQ L+++ 
Sbjct  86   KMFNSINGLLLPGGDVDIQTSQFSRAARIFYNLALKANNAGDYFPIWGTCQGFQQLSVLT  145

Query  525  SEDNII  542
            +  N++
Sbjct  146  ARRNLL  151



>ref|XP_001626371.1| predicted protein [Nematostella vectensis]
 gb|EDO34271.1| predicted protein [Nematostella vectensis]
Length=314

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 75/128 (59%), Gaps = 9/128 (7%)
 Frame = +3

Query  183  YRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLN  362
            +RP+IGI++    G+S +       SYIAAS VK++ESAG RV+P+  +   + L K   
Sbjct  29   HRPIIGILAEKVYGSSSK-------SYIAASYVKYIESAGGRVVPIFPDMSEDKLEKLFY  81

Query  363  LVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDN  536
             +NGV+FPGG     K  Y +  K +Y   L+  D GD FP+    LGF+LLT+I S+D 
Sbjct  82   SINGVLFPGGGVDLSKSGYAKNGKFLYNMALKAYDKGDIFPVWGSCLGFELLTVITSDDK  141

Query  537  IILEKFSA  560
            + L +  A
Sbjct  142  VALSRVDA  149



>ref|XP_005288158.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Chrysemys 
picta bellii]
Length=362

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N +P+IGI++   D  S    +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  102  NEKPIIGILAQECDFTS---FHRFGSSYIAASYVKFLESAGARVVPIRLNRSEEEYDKIF  158

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
              +NGV+FPGG    +  EY    +  Y K L+ ND GD FP+    LG++ LT + S
Sbjct  159  QSINGVLFPGGGVDLKTSEYSRTARIFYNKALKANDKGDYFPVWGTCLGYEELTYLTS  216



>gb|KIY93948.1| gamma-glutamyl hydrolase [Monoraphidium neglectum]
Length=252

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            S+N RP+IGI+S PG  A        G SYIAAS +K+VE+AGARVIP+ Y++  E + +
Sbjct  10   SVNERPIIGILSQPGAPAP------DGDSYIAASYIKWVEAAGARVIPIFYDDTQEDIRR  63

Query  354  KLNLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            K   +NG++ PGG    + G  + +   ++    ++ ND GD FP+    LG + L+IIV
Sbjct  64   KFAAINGLLLPGGGARLKPGHLFYDTAAQLVGLAIKANDAGDYFPVHGTCLGMETLSIIV  123

Query  525  SEDNIIL  545
            S +  +L
Sbjct  124  SGNYSLL  130



>ref|XP_005288157.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Chrysemys 
picta bellii]
Length=389

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N +P+IGI++   D  S    +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  102  NEKPIIGILAQECDFTS---FHRFGSSYIAASYVKFLESAGARVVPIRLNRSEEEYDKIF  158

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
              +NGV+FPGG    +  EY    +  Y K L+ ND GD FP+    LG++ LT + S
Sbjct  159  QSINGVLFPGGGVDLKTSEYSRTARIFYNKALKANDKGDYFPVWGTCLGYEELTYLTS  216



>ref|XP_011304818.1| PREDICTED: gamma-glutamyl hydrolase B-like isoform X4 [Fopius 
arisanus]
Length=319

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +3

Query  258  SYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGS--FEK-GEYLEALK  428
            SY+AAS VK+VES+GARV+P+   +P E     L  +NGV+FPGGS  F++ G Y EA +
Sbjct  34   SYLAASYVKYVESSGARVVPIWIGQPEEYYKSLLTRINGVIFPGGSSWFDRSGGYAEAGE  93

Query  429  EIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            +IY+  LE ND GD FP+    LGF+L+T + +
Sbjct  94   KIYRIALEMNDHGDYFPIWGTCLGFELMTYLAA  126



>gb|KFP82604.1| Gamma-glutamyl hydrolase, partial [Acanthisitta chloris]
Length=288

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +3

Query  180  NYRPVIGIVSHPGD-GASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            N RP+IGI+S     G   R     G SYIAAS VKFVESAGAR +P+  N   E   K 
Sbjct  1    NDRPIIGILSQECHYGEFQRF----GRSYIAASYVKFVESAGARAVPIRLNLTDEEYDKI  56

Query  357  LNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
               +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S 
Sbjct  57   FYSINGVLFPGGGVDLKTSEYSRVAKIFYDKALEANDKGDYFPIWGTCLGHEELTYLTSG  116

Query  531  DNIILE  548
            D +++ 
Sbjct  117  DILLVR  122



>ref|XP_005852047.1| hypothetical protein CHLNCDRAFT_133025 [Chlorella variabilis]
 gb|EFN59945.1| hypothetical protein CHLNCDRAFT_133025 [Chlorella variabilis]
Length=386

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 80/138 (58%), Gaps = 9/138 (7%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            LN RP+IG+VS  G  A        G SYIA+S VK VESAGARV+P+  +   E + ++
Sbjct  51   LNLRPLIGVVSQVGAPAP------KGHSYIASSYVKMVESAGARVVPIFCDMSPEEVERR  104

Query  357  LNLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
               VNG++ PGGS     G+ + + + ++ +  +E ND G+ FP+    LGF+ L II S
Sbjct  105  FKAVNGILIPGGSQDLRPGQPFFDTVSQLVQLAVEANDKGNYFPVHGTCLGFETLAIIAS  164

Query  528  EDNIILEKFSASXQASTL  581
             ++ IL +F +    S L
Sbjct  165  GNHSILSEFDSENLPSPL  182



>ref|XP_002679966.1| predicted protein [Naegleria gruberi]
 gb|EFC47222.1| predicted protein [Naegleria gruberi]
Length=301

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 74/130 (57%), Gaps = 12/130 (9%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI++ P    +GR  +  G +YIAAS VK+VES GARV+P+ YN P   L    
Sbjct  3    NDRPIIGIIAQP----TGRTLSRYGNTYIAASYVKYVESGGARVVPIPYNLPESQLRTLF  58

Query  360  NLVNGVVFPGGSFE-------KGEYLEALKEIYKKVLEKNDGG-DNFPLLAINLGFQLLT  515
              +NGVVFPGG  +          YL+ L    K  +E  D   D+FP+    LG Q LT
Sbjct  59   ESLNGVVFPGGGTDLTNNDGSWTPYLKTLGLFVKWSMESYDKNQDSFPIWGTCLGMQSLT  118

Query  516  IIVSEDNIIL  545
            II+S D+ IL
Sbjct  119  IILSGDSNIL  128



>ref|XP_006631142.1| PREDICTED: gamma-glutamyl hydrolase-like [Lepisosteus oculatus]
Length=326

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  156  CPAPDPSL-----NYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARV  311
            C  P P+      NYRP+IGIV+    P D       +A G SYIAAS VK++E+AGARV
Sbjct  26   CYLPIPAFSSLSPNYRPIIGIVAQENLPSD------PHAQGSSYIAASYVKYLEAAGARV  79

Query  312  IPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  485
            +PL  N   E   K    +NG++ PGG    E  ++    +  Y   ++ ND  D FP+ 
Sbjct  80   VPLRINRTKEEYTKLFYSINGLLLPGGDVDLENSQFGRVSRIFYDLAIKANDASDYFPIW  139

Query  486  AINLGFQLLTIIVSEDNII  542
                GFQ +T++ S  N++
Sbjct  140  GTCQGFQEMTVLTSGKNLL  158



>ref|XP_008406524.1| PREDICTED: gamma-glutamyl hydrolase-like [Poecilia reticulata]
Length=319

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 9/125 (7%)
 Frame = +3

Query  180  NYRPVIGIVSHP--GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            N RP+IG+++     D    R     G SYIAAS VKF+ESAGARV P+  N   E  IK
Sbjct  32   NDRPIIGVLAQENLSDDQFAR-----GSSYIAASYVKFLESAGARVAPIRINRTEEEYIK  86

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
              N +NG++ PGG    +  ++  A +  Y   L+ ND GD FP+     GFQ L+++ +
Sbjct  87   IFNSINGLLLPGGDVDIQTSQFSRAARIFYNLALKANDAGDYFPIWGTCQGFQQLSVLTA  146

Query  528  EDNII  542
              N++
Sbjct  147  RKNLL  151



>ref|XP_010288197.1| PREDICTED: gamma-glutamyl hydrolase, partial [Phaethon lepturus]
Length=292

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P  N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   
Sbjct  2    PVGNERPIIGILSQE---CHFEKFHRFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYD  58

Query  351  KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + 
Sbjct  59   KIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLT  118

Query  525  S  527
            S
Sbjct  119  S  119



>gb|KDR20012.1| Gamma-glutamyl hydrolase [Zootermopsis nevadensis]
Length=317

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 77/131 (59%), Gaps = 4/131 (3%)
 Frame = +3

Query  150  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
            G C   + + N  P+IG+++      S    N T VSYIAAS VKF+E AGAR++P++ N
Sbjct  15   GQCSCVESTTNNHPIIGVLAQEKVLESDPQLN-THVSYIAASYVKFLEGAGARIVPIMIN  73

Query  330  EPTETLIKKLNLVNGVVFPGGSFE---KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            +  +      N VNGV+ PGG  +    G Y EA ++++   ++ N  GD FP+L I LG
Sbjct  74   KTDKYYENITNHVNGVLLPGGDAQFDAPGGYSEAGRKLFDHAMKMNQAGDYFPVLGICLG  133

Query  501  FQLLTIIVSED  533
            F+LLT + + +
Sbjct  134  FELLTFLAANN  144



>gb|KFQ39814.1| Gamma-glutamyl hydrolase, partial [Mesitornis unicolor]
Length=314

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 65/118 (55%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  27   NERPIIGILSQECHFDK---FHKFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  83

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG       EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  84   HSINGVLFPGGGVDLRTSEYARVAKIFYHKALEANDKGDYFPIWGTCLGHEELTYLTS  141



>gb|KFQ77761.1| Gamma-glutamyl hydrolase, partial [Phaethon lepturus]
Length=306

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P  N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   
Sbjct  16   PVGNERPIIGILSQE---CHFEKFHRFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYD  72

Query  351  KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + 
Sbjct  73   KIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLT  132

Query  525  S  527
            S
Sbjct  133  S  133



>ref|XP_005988287.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Latimeria 
chalumnae]
Length=318

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 5/135 (4%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             SG   AP  + N RP+IGI++   + A   +    G +Y+AAS VK++ESAG RV+P+ 
Sbjct  19   FSGVLAAPSGNRNERPIIGILTQETEDA---VLKPFGKTYVAASYVKYLESAGCRVMPVR  75

Query  324  YNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  497
             N       K  N +NG++FPGG+   E  ++ +A +  Y   ++  D GD FP+    L
Sbjct  76   LNLTFSEYEKIFNSINGILFPGGAVNLENSDFAKAARIFYSLAIKAYDSGDYFPIWGTCL  135

Query  498  GFQLLTIIVSEDNII  542
            G QLLT++ +  N++
Sbjct  136  GLQLLTVLTAGKNLL  150



>ref|XP_007559766.1| PREDICTED: gamma-glutamyl hydrolase-like [Poecilia formosa]
Length=319

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 9/125 (7%)
 Frame = +3

Query  180  NYRPVIGIVSHP--GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            N RP+IG+++     D    R     G SYIAAS VKF+ESAGARV P+  N   E  IK
Sbjct  32   NDRPIIGVLAQENLSDDQFAR-----GSSYIAASYVKFLESAGARVAPIRINRTEEEYIK  86

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
              N +NG++ PGG    +  ++  A +  Y   L+ ND GD FP+     GFQ L+++ +
Sbjct  87   IFNSINGLLLPGGDVDIQTSQFSRAARIFYNLALKANDAGDYFPIWGTCQGFQQLSVLTA  146

Query  528  EDNII  542
              N++
Sbjct  147  RKNLL  151



>ref|XP_010189075.1| PREDICTED: gamma-glutamyl hydrolase [Mesitornis unicolor]
Length=325

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 65/118 (55%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  38   NERPIIGILSQECHFDK---FHKFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  94

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG       EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  95   HSINGVLFPGGGVDLRTSEYARVAKIFYHKALEANDKGDYFPIWGTCLGHEELTYLTS  152



>gb|EJY68255.1| Putative gamma-glutamyl hydrolase [Oxytricha trifallax]
Length=343

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 78/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  189  PVIGIVSHPGDGASGRISNATGV-SYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  365
            PVIGI+S   +     ++   G  SYI  S V FVESAGARV+PL+  EP E  ++KL  
Sbjct  60   PVIGIISQTLETEMQNLTEFQGYKSYIMKSYVDFVESAGARVVPLVVGEPEEVTLQKLQK  119

Query  366  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNI-I  542
            +NGVVFPGG    G+YLE  + ++  + E ND G  +PL    +G++ +   VS++   +
Sbjct  120  LNGVVFPGGD---GDYLEYGRYVFNAIKEFNDNGTFYPLWGTCMGYENIVSYVSDNGWNV  176

Query  543  LEKFSASXQASTLQVV  590
            L+ +     +  L+ V
Sbjct  177  LDVYDYDSGSMALEFV  192



>ref|XP_009829558.1| hypothetical protein H257_06135 [Aphanomyces astaci]
 gb|ETV80611.1| hypothetical protein H257_06135 [Aphanomyces astaci]
Length=349

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 79/141 (56%), Gaps = 11/141 (8%)
 Frame = +3

Query  162  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  341
            AP P L   P+IGI SH  +          G  +I AS +K+VESAG R + + YN   E
Sbjct  57   APLPILTRNPIIGIHSHRDE--------EHGDDFIVASYLKWVESAGGRGVRIPYNATKE  108

Query  342  TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             L   L  VNGV+FPGGS   G+   A + IY + +E N+ GD+FP+    LGF+ L ++
Sbjct  109  ELDVLLKSVNGVLFPGGS---GDPNAAAEYIYSQAIEFNNNGDHFPVWGTCLGFEWLVVL  165

Query  522  VSEDNIILEKFSASXQASTLQ  584
             + ++ IL+   A   +STLQ
Sbjct  166  QAGNHSILDHVDADNVSSTLQ  186



>ref|XP_004359252.1| hypothetical protein DFA_01284 [Dictyostelium fasciculatum]
 gb|EGG21402.1| hypothetical protein DFA_01284 [Dictyostelium fasciculatum]
Length=615

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 50/133 (38%), Positives = 78/133 (59%), Gaps = 7/133 (5%)
 Frame = +3

Query  177  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  356
            +N RP+IGI+S P D     +++     YIAA  VK +E +GARV+P++Y+   E +   
Sbjct  3    VNNRPIIGILSQPCDN---EMTDHETDQYIAAGYVKHLEGSGARVVPILYDSTPEEIETL  59

Query  357  LNLVNGVVFPGGSFEK----GEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
               +NG++ PGG  +      +Y E L+ +Y+ V++ ND  D FPL    LGF+ L ++ 
Sbjct  60   FKSINGILLPGGGADHLDQLPQYCETLRLLYRLVIDANDRKDYFPLWGTCLGFEQLVMMQ  119

Query  525  SEDNIILEKFSAS  563
            + D  ILE+F AS
Sbjct  120  ANDIHILEQFKAS  132


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 80/133 (60%), Gaps = 8/133 (6%)
 Frame = +3

Query  177  LNYRPVIGIVSHP--GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            +N RP+IGI++ P   DG+S  +       YIAAS VK++ESAGARV+P++Y+   + L 
Sbjct  316  INQRPIIGILTQPTRNDGSSKSLGYD---QYIAASYVKYIESAGARVVPILYDSTPKQLK  372

Query  351  KKLNLVNGVVFPGGSF---EKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
                 +NG++ PGG+        Y + ++ +Y+ V+E ND  D FPL    LGF+ + ++
Sbjct  373  TLFQSINGILLPGGAVLLQYYPLYQDTIRYLYQLVVEANDRQDYFPLWGTCLGFEQILMM  432

Query  522  VSEDNIILEKFSA  560
             +++  ++E F A
Sbjct  433  QADNIYLMESFDA  445



>ref|XP_010863022.1| PREDICTED: gamma-glutamyl hydrolase-like [Esox lucius]
Length=315

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 7/134 (5%)
 Frame = +3

Query  153  GCPAPDPS--LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            G P P  S  LNYRP+IG+++   +   G I +A G SYIAAS VK++ESAGARV P+  
Sbjct  17   GVPLPVESSHLNYRPIIGVLAQ--ENIVGDI-HAQGSSYIAASYVKYLESAGARVAPIRT  73

Query  327  NEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            N   E   K  N +NG++ PGG    +  +Y    K  Y   ++ ND  D FP+     G
Sbjct  74   NRTDEEYEKIFNSINGLLLPGGDVDLQTSQYSRLSKIFYDLAIKANDAFDYFPIWGTCQG  133

Query  501  FQLLTIIVSEDNII  542
             Q +T++ S  N++
Sbjct  134  LQQMTVLTSSRNLL  147



>ref|XP_008642427.1| PREDICTED: gamma-glutamyl hydrolase, partial [Corvus brachyrhynchos]
 gb|KFO52675.1| Gamma-glutamyl hydrolase, partial [Corvus brachyrhynchos]
Length=316

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 64/118 (54%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S        +     G SYIAAS VKFVESAGAR +P+  N   E   K  
Sbjct  29   NDRPIIGILSQECHFDEYQ---RYGRSYIAASYVKFVESAGARAVPIRLNLTDEEYDKIF  85

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG       EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  86   HSINGVLFPGGGVDLRTSEYSRVAKIFYHKALEANDKGDYFPIWGTCLGHEELTYLTS  143



>ref|XP_005988286.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Latimeria 
chalumnae]
Length=380

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 5/135 (4%)
 Frame = +3

Query  144  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  323
             SG   AP  + N RP+IGI++   + A   +    G +Y+AAS VK++ESAG RV+P+ 
Sbjct  19   FSGVLAAPSGNRNERPIIGILTQETEDA---VLKPFGKTYVAASYVKYLESAGCRVMPVR  75

Query  324  YNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  497
             N       K  N +NG++FPGG+   E  ++ +A +  Y   ++  D GD FP+    L
Sbjct  76   LNLTFSEYEKIFNSINGILFPGGAVNLENSDFAKAARIFYSLAIKAYDSGDYFPIWGTCL  135

Query  498  GFQLLTIIVSEDNII  542
            G QLLT++ +  N++
Sbjct  136  GLQLLTVLTAGKNLL  150



>gb|KFW77964.1| Gamma-glutamyl hydrolase, partial [Manacus vitellinus]
Length=317

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N +P+IGI++   D    +     G SYIAAS VKFVESAGAR +P+  N   E   +  
Sbjct  30   NDKPIIGILAQECDFGEFQ---GFGRSYIAASYVKFVESAGARAVPIRLNLTDEEYSRIF  86

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  87   HSINGVLFPGGGVDLKTSEYARVAKIFYHKALEANDNGDYFPVWGTCLGHEELTYLTS  144



>ref|XP_010874408.1| PREDICTED: RING finger protein 122 isoform X1 [Esox lucius]
 ref|XP_010874409.1| PREDICTED: RING finger protein 122 isoform X1 [Esox lucius]
 ref|XP_010874410.1| PREDICTED: RING finger protein 122 isoform X1 [Esox lucius]
 ref|XP_010874411.1| PREDICTED: RING finger protein 122 isoform X1 [Esox lucius]
 ref|XP_010874412.1| PREDICTED: RING finger protein 122 isoform X1 [Esox lucius]
 ref|XP_010874413.1| PREDICTED: RING finger protein 122 isoform X1 [Esox lucius]
Length=316

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = +3

Query  114  FSYLLNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVE  293
            +S  L T WK       PDP +N RP+IGI++      +  +    G +YI AS VK++E
Sbjct  15   WSCALPTKWK-------PDP-INNRPIIGILTQE---VNDHVMKPFGKTYIPASYVKYIE  63

Query  294  SAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGG  467
            S G+RV+P+   + T    K    +NG++F GGS   E   +    +  Y+  L+ ND G
Sbjct  64   SGGSRVVPIRLTQSTAEYEKIFRSINGLLFIGGSSNLETSNFARVARIFYRLALKANDAG  123

Query  468  DNFPLLAINLGFQLLTIIVSEDNII  542
            D FP+    LG QLLT++V+ +N++
Sbjct  124  DFFPIWGTCLGMQLLTVLVAGENLL  148



>ref|XP_002595630.1| hypothetical protein BRAFLDRAFT_275351 [Branchiostoma floridae]
 gb|EEN51642.1| hypothetical protein BRAFLDRAFT_275351 [Branchiostoma floridae]
Length=317

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 6/126 (5%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P +N RP+IG+++     ASG      G +YI A+ +K++ESAGARV+P+  N  T    
Sbjct  26   PEVNDRPIIGVIAQ----ASGEARAKFGKTYIPATYIKYLESAGARVVPIRVNLTTAEYT  81

Query  351  KKLNLVNGVVFPGGSFEK--GEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  524
            K  N +NGV++PGG   K    Y ++ K  Y   L+  D GD FP+    +GFQ LT + 
Sbjct  82   KLFNSLNGVLYPGGGVNKFTSGYAKSAKIFYDLALKAFDEGDYFPVWGTCMGFQELTALT  141

Query  525  SEDNII  542
            S+ +++
Sbjct  142  SDRDVL  147



>ref|XP_005009586.1| PREDICTED: gamma-glutamyl hydrolase [Anas platyrhynchos]
Length=393

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 71/135 (53%), Gaps = 5/135 (4%)
 Frame = +3

Query  147  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  326
            S   P      N RP++G+++              G SYIAAS VKF+ESAGARV+PL  
Sbjct  95   SAALPGRQSEPNERPIVGVLA---QECHFNKFQQFGNSYIAASYVKFLESAGARVVPLRL  151

Query  327  NEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  500
            N   E   K  + +NGV+FPGG    +  EY    K  Y+K LE ND GD FP+    LG
Sbjct  152  NLSDEVYDKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYRKALEANDKGDYFPIWGTCLG  211

Query  501  FQLLTIIVSEDNIIL  545
             + LT + S   +++
Sbjct  212  HEELTYLTSNKVLLV  226



>gb|KFV70089.1| Gamma-glutamyl hydrolase, partial [Picoides pubescens]
Length=315

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   +  
Sbjct  28   NERPIIGILSQECHYDK---FHKFGSSYIAASYVKFLESAGARVVPVRLNLSDEEYDRIF  84

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  85   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  142



>ref|XP_008918537.1| PREDICTED: gamma-glutamyl hydrolase [Manacus vitellinus]
Length=381

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N +P+IGI++   D    +     G SYIAAS VKFVESAGAR +P+  N   E   +  
Sbjct  94   NDKPIIGILAQECDFGEFQ---GFGRSYIAASYVKFVESAGARAVPIRLNLTDEEYSRIF  150

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  151  HSINGVLFPGGGVDLKTSEYARVAKIFYHKALEANDNGDYFPVWGTCLGHEELTYLTS  208



>ref|XP_009902444.1| PREDICTED: gamma-glutamyl hydrolase [Picoides pubescens]
Length=324

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   +  
Sbjct  37   NERPIIGILSQECHYDK---FHKFGSSYIAASYVKFLESAGARVVPVRLNLSDEEYDRIF  93

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  94   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  151



>ref|XP_004068950.1| PREDICTED: gamma-glutamyl hydrolase-like [Oryzias latipes]
Length=315

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 11/133 (8%)
 Frame = +3

Query  159  PAPDPSLNYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  329
            P     L  RP+IG+++    P D        A G SYIAAS VKF+ESAGARV P+  N
Sbjct  21   PGRSQQLTDRPIIGVLAQENLPKDAF------ARGSSYIAASYVKFLESAGARVAPIRIN  74

Query  330  EPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  503
               E   K    +NG++ PGG    +K ++    K  Y   +  ND GD FP+     GF
Sbjct  75   LTDEEYTKLFQSINGLLLPGGDVDIQKSQFSRVSKIFYSMAIRANDAGDYFPIWGTCQGF  134

Query  504  QLLTIIVSEDNII  542
            Q LT++ +  N++
Sbjct  135  QQLTVLTANKNLL  147



>ref|XP_011406499.1| PREDICTED: gamma-glutamyl hydrolase A-like [Amphimedon queenslandica]
Length=288

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 70/131 (53%), Gaps = 28/131 (21%)
 Frame = +3

Query  174  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  353
            SLN RP+IGIVS          +     SYIAAS VK++ESAGARV+P++          
Sbjct  20   SLNLRPIIGIVSE---------TTTEDHSYIAASYVKYIESAGARVVPIM----------  60

Query  354  KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
                   V+FPGG  S  +  YLE  K I++   + ND GD FPL    LGFQLL ++ S
Sbjct  61   -------VLFPGGGSSLVESAYLEVAKTIFELAKQANDEGDYFPLWGTCLGFQLLCVLQS  113

Query  528  EDNIILEKFSA  560
              N IL  F +
Sbjct  114  GTNHILSSFDS  124



>ref|XP_008862000.1| hypothetical protein H310_00848 [Aphanomyces invadans]
 gb|ETW08195.1| hypothetical protein H310_00848 [Aphanomyces invadans]
Length=351

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 74/137 (54%), Gaps = 11/137 (8%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P L   P+IGI SH        I        IAAS VK+VESAG R + + YN     L 
Sbjct  63   PVLTKNPIIGIHSHQSSTYHDEI--------IAASYVKWVESAGGRAVRIPYNASQTELR  114

Query  351  KKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
            K L  VNGV+FPGG    G+  EA + IY+  +E ND G  FP+    LGF+ L  + S+
Sbjct  115  KLLRSVNGVLFPGG---DGDPNEAAEFIYQYAIELNDNGTYFPVWGTCLGFEWLVQLQSK  171

Query  531  DNIILEKFSASXQASTL  581
            +N IL+   A+  +STL
Sbjct  172  NNSILDTVDAANISSTL  188



>ref|XP_008861998.1| hypothetical protein H310_00846 [Aphanomyces invadans]
 gb|ETW08193.1| hypothetical protein H310_00846 [Aphanomyces invadans]
Length=352

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 11/138 (8%)
 Frame = +3

Query  171  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  350
            P L   P+IGI +H  D   G         +I AS +K+VESAG R + + YN  T  L 
Sbjct  63   PILTRNPIIGIHAH-RDAEHGD-------DFIVASYLKWVESAGGRGVRIPYNASTAELD  114

Query  351  KKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  530
            K L  VNGV+FPGGS   G+  EA + IY K +E ND GD+FP+    LGF+ L  + + 
Sbjct  115  KLLKSVNGVLFPGGS---GDPNEAAEYIYNKAIELNDKGDHFPVWGTCLGFEWLVQLTAG  171

Query  531  DNIILEKFSASXQASTLQ  584
            +  +L+   A   +STL+
Sbjct  172  NMSVLDSVDADNISSTLE  189



>ref|XP_008280794.1| PREDICTED: gamma-glutamyl hydrolase-like [Stegastes partitus]
Length=275

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 71/127 (56%), Gaps = 11/127 (9%)
 Frame = +3

Query  177  LNYRPVIGIVSH---PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  347
            LN RP+IG+++    PGD        A G SYIAAS VK++E +GARV+P+  N   +  
Sbjct  36   LNLRPLIGVLAQENLPGD------QFARGSSYIAASYVKYLEGSGARVVPIRINRTEDEY  89

Query  348  IKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  521
             K    VNG++ PGG    +  ++  A K  Y   L+ ND GD FP+     GFQ L+++
Sbjct  90   AKIFYSVNGLLLPGGDVDLQTSQFSRAAKIFYNLALKANDAGDYFPIWGTCQGFQQLSVL  149

Query  522  VSEDNII  542
             +  N++
Sbjct  150  TANKNLL  156



>gb|KFO99622.1| Gamma-glutamyl hydrolase, partial [Calypte anna]
Length=317

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 66/118 (56%), Gaps = 5/118 (4%)
 Frame = +3

Query  180  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  359
            N RP++GI++           +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  30   NERPIVGILAQE---CHFEKFHRFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  86

Query  360  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  527
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  87   HSINGVLFPGGGVDLKTSEYSRIAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160