BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF013J06

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      213   8e-77   Solanum tuberosum [potatoes]
ref|NP_001234186.1|  catalase isozyme 2                                 214   1e-75   
gb|ACH63223.1|  catalase                                                213   1e-73   Rheum australe [Himalayan rhubarb]
ref|XP_002510677.1|  catalase, putative                                 212   8e-73   
gb|AAM97541.1|  catalase 2                                              214   2e-72   Capsicum annuum
gb|AAF79625.1|AC027665_26  F5M15.5                                      201   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890395.1|  F5M15.5                                            201   3e-68   
gb|ADB03784.1|  catalase                                                227   6e-68   Ipomoea batatas [batate]
gb|AAR14052.2|  catalase                                                213   3e-67   Solanum tuberosum [potatoes]
gb|AAL38024.1|AF443179_1  catalase                                      216   4e-67   Nicotiana tabacum [American tobacco]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          223   2e-66   Ipomoea batatas [batate]
gb|AAC84138.1|  catalase                                                213   2e-66   Cichorium intybus [radicchio]
gb|KDD77132.1|  catalase                                                204   3e-66   Helicosporidium sp. ATCC 50920
gb|ADI58890.1|  catalase                                                211   5e-66   Vigna mungo [urad dal]
gb|ABB51561.1|  truncated catalase 2                                    218   4e-65   Avicennia marina
gb|ACJ71242.1|  catalase 1                                              211   5e-65   Vigna unguiculata
gb|AHG98056.1|  catalase                                                213   6e-65   Plectranthus barbatus
dbj|BAC79443.1|  catalase                                               219   6e-65   Acacia ampliceps
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          218   9e-65   Avicennia marina
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               218   1e-64   Ricinus communis
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               218   1e-64   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAB62892.1|  catalase-1                                              218   1e-64   Nicotiana glutinosa
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      218   2e-64   Nicotiana sylvestris
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       216   2e-64   Cucumis sativus [cucumbers]
gb|AHF21552.1|  catalase                                                218   2e-64   Hylocereus undatus [dragon fruit]
gb|AFU48609.1|  catalase 1                                              218   2e-64   Nicotiana benthamiana
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      218   2e-64   Nicotiana tomentosiformis
emb|CCP37650.1|  catalase-1                                             218   2e-64   Nicotiana tabacum [American tobacco]
gb|ACL27272.1|  catalase                                                218   2e-64   Nicotiana benthamiana
gb|AAB71764.1|  catalase 1                                              218   2e-64   Nicotiana tabacum [American tobacco]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      218   2e-64   Nicotiana tomentosiformis
ref|NP_001237556.1|  catalase-1/2                                       217   2e-64   Glycine max [soybeans]
gb|ABY21704.1|  catalase-1 precursor                                    217   2e-64   Panax ginseng [Asiatic ginseng]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      217   2e-64   Nicotiana sylvestris
gb|AGC65520.1|  catalase                                                217   3e-64   Eriobotrya japonica [loquat]
ref|NP_001235974.1|  catalase-3                                         217   3e-64   Glycine max [soybeans]
gb|AGE15298.2|  catalase 1                                              217   3e-64   Eriobotrya japonica [loquat]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             217   3e-64   Phaseolus vulgaris [French bean]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 217   3e-64   Cucumis melo [Oriental melon]
gb|AGI65617.1|  catalase                                                216   4e-64   Fragaria x ananassa
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         217   4e-64   Jatropha curcas
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    216   5e-64   Arabis alpina [alpine rockcress]
ref|XP_007046520.1|  Catalase 2                                         216   5e-64   Theobroma cacao [chocolate]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         216   5e-64   Setaria italica
gb|AAC19397.1|  leaf catalase                                           216   5e-64   Mesembryanthemum crystallinum
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      216   5e-64   Fragaria vesca subsp. vesca
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               216   5e-64   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AET97564.1|  catalase                                                216   5e-64   Ziziphus jujuba [Chinese jujube]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               216   5e-64   Zea mays [maize]
ref|XP_010530333.1|  PREDICTED: catalase-2                              216   5e-64   Tarenaya hassleriana [spider flower]
ref|XP_009103333.1|  PREDICTED: catalase-1                              216   6e-64   Brassica rapa
emb|CDY01363.1|  BnaA07g11360D                                          216   6e-64   
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      216   6e-64   Solanum lycopersicum
prf||1803522A  catalase                                                 216   6e-64
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             215   6e-64   
gb|ABF93811.1|  Catalase-1, putative, expressed                         213   6e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 216   6e-64   Solanum tuberosum [potatoes]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               216   7e-64   Gossypium hirsutum [American cotton]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 215   7e-64   
gb|KJB14250.1|  hypothetical protein B456_002G115900                    216   8e-64   Gossypium raimondii
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      214   8e-64   Nelumbo nucifera [Indian lotus]
emb|CDY31877.1|  BnaC07g15270D                                          216   9e-64   Brassica napus [oilseed rape]
gb|ADU56199.1|  catalase                                                216   9e-64   Hevea brasiliensis [jebe]
gb|KJB17474.1|  hypothetical protein B456_003G002800                    214   9e-64   Gossypium raimondii
gb|AAO17721.1|  catalase                                                216   9e-64   Hypericum perforatum
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 216   9e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           216   9e-64   
gb|KJB17473.1|  hypothetical protein B456_003G002800                    216   1e-63   Gossypium raimondii
ref|NP_001291326.1|  catalase isozyme 1                                 216   1e-63   Sesamum indicum [beniseed]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           216   1e-63   Sesamum indicum [beniseed]
gb|AAX88799.1|  catalase                                                216   1e-63   Euphorbia characias
ref|XP_010692546.1|  PREDICTED: catalase                                216   1e-63   Beta vulgaris subsp. vulgaris [field beet]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          216   1e-63   Soldanella alpina
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 214   1e-63   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             214   1e-63   
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               215   1e-63   Gossypium hirsutum [American cotton]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         215   1e-63   Camelina sativa [gold-of-pleasure]
gb|KHG12976.1|  Catalase isozyme 2                                      215   1e-63   Gossypium arboreum [tree cotton]
ref|XP_010437527.1|  PREDICTED: catalase-2                              215   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007018034.1|  Catalase 2                                         215   1e-63   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         215   1e-63   Camelina sativa [gold-of-pleasure]
emb|CDY52649.1|  BnaAnng11640D                                          214   1e-63   Brassica napus [oilseed rape]
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 215   1e-63   Phoenix dactylifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 215   1e-63   Vitis vinifera
gb|AAG43363.1|AF151368_1  catalase                                      215   1e-63   Hevea brasiliensis [jebe]
ref|NP_001268098.1|  catalase                                           215   1e-63   Vitis vinifera
gb|AHB72694.1|  catalase                                                215   2e-63   Beta vulgaris subsp. maritima [sea beet]
ref|XP_002521709.1|  catalase, putative                                 215   2e-63   Ricinus communis
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         215   2e-63   Tarenaya hassleriana [spider flower]
prf||1906388A  catalase                                                 215   2e-63
emb|CDX76313.1|  BnaA08g10870D                                          214   2e-63   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      215   2e-63   Nelumbo nucifera [Indian lotus]
gb|AAK67359.2|AF390210_1  catalase                                      215   2e-63   Suaeda salsa
emb|CDX72514.1|  BnaC07g45360D                                          215   2e-63   
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         215   2e-63   Tarenaya hassleriana [spider flower]
ref|NP_001289779.1|  catalase isozyme 1                                 215   2e-63   Nelumbo nucifera [Indian lotus]
gb|KEH36313.1|  catalase heme-binding enzyme                            213   2e-63   Medicago truncatula
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             215   2e-63   
gb|AIA61608.1|  catalase                                                215   2e-63   Gynostemma pentaphyllum [jiaogulan]
emb|CDY17510.1|  BnaC03g65530D                                          214   2e-63   Brassica napus [oilseed rape]
gb|AAR84577.1|  catalase 1b                                             214   2e-63   Lotus japonicus
gb|KHG25152.1|  Catalase isozyme 1                                      215   2e-63   Gossypium arboreum [tree cotton]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      215   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      215   2e-63   Phoenix dactylifera
gb|ABK24453.1|  unknown                                                 215   2e-63   Picea sitchensis
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             215   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              215   2e-63   Brassica rapa
gb|ACJ71244.1|  catalase 2                                              212   2e-63   Vigna unguiculata
gb|ABV55108.1|  catalase 2                                              214   2e-63   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      215   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      214   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ71245.1|  catalase 2                                              212   3e-63   Vigna unguiculata
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             214   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      214   3e-63   Phoenix dactylifera
gb|AAF71742.1|AF248491_1  catalase                                      214   3e-63   Raphanus sativus
ref|XP_009138342.1|  PREDICTED: catalase-2                              214   3e-63   Brassica rapa
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             214   3e-63   
emb|CAA64220.1|  catalase                                               214   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            214   3e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAD17935.1|  catalase                                                214   3e-63   Brassica juncea [brown mustard]
gb|AAK96854.1|  catalase                                                214   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      214   3e-63   
gb|ACV92695.1|  catalase                                                214   3e-63   Brassica oleracea
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          214   3e-63   Amborella trichopoda
gb|AAB86582.2|  catalase                                                214   3e-63   Raphanus sativus
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              214   3e-63   
gb|AAF61734.1|AF243519_1  catalase 4                                    214   3e-63   Helianthus annuus
dbj|BAH19523.1|  AT4G35090                                              214   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031791.1|  catalase 2                                         214   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      214   3e-63   Elaeis guineensis
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             215   3e-63   
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             214   4e-63   Eutrema salsugineum [saltwater cress]
emb|CAE82295.1|  catalase                                               214   4e-63   Homogyne alpina
ref|NP_001105310.1|  catalase isozyme 2                                 214   4e-63   
gb|KFK30147.1|  catalase                                                214   4e-63   Arabis alpina [alpine rockcress]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      214   4e-63   Phoenix dactylifera
gb|AAD17936.1|  catalase                                                214   4e-63   Brassica juncea [brown mustard]
gb|AHF27433.1|  catalase                                                214   4e-63   Cucurbita maxima [Boston marrow]
dbj|BAJ33995.1|  unnamed protein product                                214   4e-63   Eutrema halophilum
gb|AAD50974.1|AF170272_1  catalase CAT1                                 214   4e-63   Manihot esculenta [manioc]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              214   4e-63   
gb|AAD17933.1|  catalase                                                214   4e-63   Brassica juncea [brown mustard]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             214   4e-63   Eutrema salsugineum [saltwater cress]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                214   4e-63   Erythranthe guttata [common monkey flower]
gb|AAR84578.1|  catalase 1a                                             214   4e-63   Lotus japonicus
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          214   4e-63   Helianthus annuus
gb|AIP93616.1|  CAT1                                                    214   4e-63   Bassia scoparia [burning bush]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 214   4e-63   Eucalyptus grandis [rose gum]
gb|AFN81243.1|  catalase 1                                              214   5e-63   Brassica rapa subsp. pekinensis [bai cai]
gb|ACA50528.1|  putative catalase 2                                     214   5e-63   Brassica napus [oilseed rape]
gb|AAF61733.1|AF243518_1  catalase 3                                    214   5e-63   Helianthus annuus
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       214   5e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AAM97542.1|  catalase 3                                              214   5e-63   Capsicum annuum
gb|AIR77003.1|  catalase                                                208   5e-63   Lilium longiflorum [Easter lily]
ref|XP_010094556.1|  Catalase isozyme 1                                 214   5e-63   Morus notabilis
gb|AAF19965.1|AF207906_1  catalase 1                                    214   5e-63   Zantedeschia aethiopica [arum-lily]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    214   5e-63   Gossypium raimondii
ref|XP_009106100.1|  PREDICTED: catalase-2                              214   5e-63   Brassica rapa
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      214   6e-63   
tpg|DAA43177.1|  TPA: catalase2                                         214   6e-63   
gb|AHF27432.1|  catalase                                                213   6e-63   Cucurbita maxima [Boston marrow]
gb|AFU90823.1|  catalase                                                213   6e-63   Populus x beijingensis
gb|ACB11496.1|  catalase                                                214   6e-63   Pinus sylvestris [Scotch pine]
ref|NP_001048861.1|  Os03g0131200                                       214   6e-63   
gb|ACJ11733.1|  catalase                                                213   6e-63   Gossypium hirsutum [American cotton]
ref|XP_001752315.1|  predicted protein                                  213   6e-63   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             213   6e-63   
emb|CDP07287.1|  unnamed protein product                                213   6e-63   Coffea canephora [robusta coffee]
dbj|BAA34714.1|  catalase                                               213   6e-63   Oryza sativa [red rice]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      213   6e-63   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       213   7e-63   Cucumis sativus [cucumbers]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      213   7e-63   Elaeis guineensis
ref|XP_010061175.1|  PREDICTED: catalase-like                           213   8e-63   Eucalyptus grandis [rose gum]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    213   8e-63   
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      213   8e-63   Cucumis melo [Oriental melon]
gb|AHF27430.1|  catalase                                                213   8e-63   Cucurbita moschata [ayote]
gb|AFR53082.1|  CAT                                                     213   8e-63   Anthurium andraeanum [flamingo-lily]
gb|ACJ76836.3|  catalase                                                213   8e-63   Dimocarpus longan [longan]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      213   8e-63   Prunus mume [ume]
dbj|BAQ21275.1|  catalase                                               213   9e-63   Citrus tamurana
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             213   9e-63   Prunus persica
emb|CAD42908.1|  catalase                                               213   9e-63   Prunus persica
gb|KEH36312.1|  catalase heme-binding enzyme                            213   9e-63   Medicago truncatula
ref|XP_001784759.1|  predicted protein                                  213   9e-63   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     213   1e-62   Eucalyptus grandis [rose gum]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         213   1e-62   Oryza brachyantha
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             213   1e-62   Selaginella moellendorffii
gb|AIZ77475.1|  catalase                                                213   1e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 213   1e-62   
gb|AFU90822.1|  catalase                                                213   1e-62   Populus tomentosa [Chinese white poplar]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              213   1e-62   
gb|AJE26131.1|  catalase                                                213   1e-62   Salix matsudana [tortured willow]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     210   1e-62   Eucalyptus grandis [rose gum]
ref|XP_002301920.1|  catalase family protein                            213   1e-62   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               213   1e-62   Populus deltoides
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              213   1e-62   Cicer arietinum [garbanzo]
ref|XP_003558892.1|  PREDICTED: catalase-1                              213   1e-62   Brachypodium distachyon [annual false brome]
ref|NP_001240021.1|  catalase                                           213   1e-62   Glycine max [soybeans]
gb|AGV54297.1|  peroxisomal catalase                                    213   1e-62   Phaseolus vulgaris [French bean]
gb|ACL35349.1|  catalase                                                213   1e-62   Picea glauca
emb|CAA45564.1|  catalase                                               213   1e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69111.1|  BnaC01g03420D                                          212   1e-62   
tpg|DAA43178.1|  TPA: catalase2                                         213   1e-62   
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 213   2e-62   Populus euphratica
gb|ADC95629.1|  catalase                                                213   2e-62   Bruguiera gymnorhiza [Burma mangrove]
gb|EMT05040.1|  Catalase-1                                              213   2e-62   
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          213   2e-62   Vigna radiata var. radiata [golden gram]
ref|XP_002306976.2|  catalase family protein                            213   2e-62   
gb|ADZ45555.1|  catalase                                                213   2e-62   Vigna radiata [mung bean]
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         213   2e-62   Camelina sativa [gold-of-pleasure]
dbj|BAJ90861.1|  predicted protein                                      213   2e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001237571.1|  catalase-4                                         212   2e-62   Glycine max [soybeans]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             212   2e-62   Phaseolus vulgaris [French bean]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      212   2e-62   Cucumis melo [Oriental melon]
ref|XP_010477308.1|  PREDICTED: catalase-1                              212   2e-62   Camelina sativa [gold-of-pleasure]
gb|AIS20825.1|  CAT                                                     212   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 212   2e-62   
gb|AAD37788.1|AF149283_1  catalase 1                                    211   2e-62   Phaseolus vulgaris [French bean]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                212   2e-62   Erythranthe guttata [common monkey flower]
gb|ADZ45556.1|  catalase                                                212   2e-62   Vigna radiata [mung bean]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      212   2e-62   Populus euphratica
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             212   2e-62   Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      212   2e-62   Citrus sinensis [apfelsine]
gb|AAP80622.1|AF475100_1  catalase isozyme                              206   2e-62   Triticum aestivum [Canadian hard winter wheat]
gb|ADU56198.1|  catalase                                                212   2e-62   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             212   2e-62   Capsella rubella
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               212   2e-62   Cucurbita pepo
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          212   2e-62   Amborella trichopoda
prf||2104177A  catalase                                                 212   3e-62
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               212   3e-62   Ricinus communis
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      212   3e-62   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      212   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 212   3e-62   Elaeis guineensis
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              212   3e-62   Populus euphratica
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      212   3e-62   
emb|CAG23920.1|  catalase                                               211   4e-62   Festuca arundinacea [tall fescue]
dbj|BAJ88747.1|  predicted protein                                      213   4e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              212   4e-62   Populus euphratica
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 211   4e-62   Phoenix dactylifera
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     213   4e-62   Eucalyptus grandis [rose gum]
emb|CDP01803.1|  unnamed protein product                                211   4e-62   Coffea canephora [robusta coffee]
gb|AIU99487.1|  catalase                                                211   4e-62   Saccharum hybrid cultivar ROC22
gb|AHF27429.1|  catalase                                                211   5e-62   Cucurbita moschata [ayote]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      211   5e-62   Vitis vinifera
gb|EPS69543.1|  catalase                                                211   5e-62   Genlisea aurea
gb|AAF61732.1|AF243517_1  catalase 2                                    211   5e-62   Helianthus annuus
gb|AGT16054.1|  catalase                                                211   6e-62   Saccharum hybrid cultivar R570
gb|AAC19398.1|  root catalase                                           211   6e-62   Mesembryanthemum crystallinum
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      211   6e-62   Eucalyptus grandis [rose gum]
gb|AGT16188.1|  catalase                                                211   6e-62   Saccharum hybrid cultivar R570
gb|AGT16203.1|  catalase                                                211   6e-62   Saccharum hybrid cultivar R570
gb|AGT16310.1|  catalase                                                211   7e-62   Saccharum hybrid cultivar R570
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             211   7e-62   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          211   7e-62   
ref|XP_011022275.1|  PREDICTED: catalase-like                           210   8e-62   Populus euphratica
gb|ADM96039.1|  catalase                                                210   9e-62   Cucumis sativus [cucumbers]
gb|ABM47415.1|  catalase                                                210   9e-62   Prunus avium [gean]
gb|AEQ30070.1|  catalase                                                210   9e-62   Litchi chinensis [litchi]
gb|AIM43584.1|  catalase                                                210   1e-61   Saccharum hybrid cultivar Yacheng05-179
ref|NP_001105415.1|  catalase isozyme 1                                 210   1e-61   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 210   1e-61   Prunus mume [ume]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             210   1e-61   Prunus persica
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               210   1e-61   Zea mays [maize]
gb|AIU99488.1|  catalase                                                210   1e-61   Saccharum hybrid cultivar ROC22
ref|NP_001241808.1|  catalase isozyme B                                 210   1e-61   Zea mays [maize]
gb|AIU99480.1|  catalase                                                210   1e-61   Saccharum spontaneum [fodder cane]
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               210   1e-61   Zea mays [maize]
gb|AIU99484.1|  catalase                                                210   1e-61   Saccharum arundinaceum
emb|CAD42909.1|  catalase                                               210   1e-61   Prunus persica
gb|AIX10947.1|  putative catalase                                       210   1e-61   Gardenia jasminoides
gb|ACJ22771.1|  catalase 1                                              210   1e-61   Jatropha curcas
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            210   1e-61   Pisum sativum [garden pea]
dbj|BAH37035.1|  catalase 1                                             210   1e-61   Pisum sativum [garden pea]
gb|ABK41476.1|  catalase                                                210   1e-61   Haematococcus lacustris
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      210   1e-61   
gb|AIU99486.1|  catalase                                                210   1e-61   Saccharum spontaneum [fodder cane]
dbj|BAA34205.1|  catalase                                               210   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AFW66787.1|  catalase3                                               210   2e-61   
gb|AFD29285.1|  catalase                                                210   2e-61   Vicia faba [broad bean]
ref|XP_005708279.1|  catalase                                           181   2e-61   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         209   2e-61   
gb|AHZ13843.1|  catalase                                                209   2e-61   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    209   2e-61   
gb|AAG61140.2|AF332973_1  catalase 2                                    209   3e-61   
gb|AAC17731.1|  catalase 1                                              209   3e-61   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               209   3e-61   
gb|AFW66788.1|  catalase3                                               209   3e-61   
ref|NP_564121.1|  catalase 1                                            209   3e-61   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 215   3e-61   
gb|AHA50082.1|  catalase                                                209   3e-61   
gb|AGT15888.1|  catalase                                                209   3e-61   
gb|AJF34884.1|  catalase                                                209   4e-61   
gb|AII80275.1|  catalase                                                204   4e-61   
gb|AIU99481.1|  catalase                                                209   4e-61   
emb|CAA42720.1|  catalase-1                                             209   5e-61   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 210   5e-61   
gb|AIU99482.1|  catalase                                                209   5e-61   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    209   5e-61   
gb|AIU99483.1|  catalase                                                209   5e-61   
ref|NP_001058635.1|  Os06g0727200                                       209   5e-61   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 209   5e-61   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      209   5e-61   
gb|AIU99479.1|  catalase                                                209   5e-61   
gb|AAB70006.1|  catalase                                                208   6e-61   
ref|XP_010692544.1|  PREDICTED: catalase-like                           208   7e-61   
gb|EMS51034.1|  Catalase isozyme 2                                      208   7e-61   
ref|XP_001696763.1|  catalase/peroxidase                                208   8e-61   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      208   9e-61   
emb|CAH61266.1|  catalase                                               208   9e-61   
dbj|BAJ92414.1|  predicted protein                                      208   9e-61   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               208   1e-60   
gb|ADY02963.1|  catalase                                                207   1e-60   
ref|XP_002950455.1|  catalase                                           207   1e-60   
gb|ABB88582.1|  catalase                                                207   1e-60   
gb|ACL81498.1|  catalase                                                207   2e-60   
gb|AIU99485.1|  catalase                                                207   2e-60   
gb|AAB07026.1|  catalase 1                                              207   2e-60   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           207   2e-60
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          206   2e-60   
gb|ABN71233.2|  catalase                                                207   2e-60   
gb|ADQ28492.1|  catalase                                                207   2e-60   
ref|XP_011396830.1|  Catalase isozyme 2                                 207   2e-60   
dbj|BAA34204.1|  catalase                                               207   2e-60   
ref|NP_001045673.1|  Os02g0115700                                       207   2e-60   
gb|AFW66785.1|  catalase3 isoform 1                                     211   2e-60   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          206   3e-60   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      206   4e-60   
dbj|BAA05494.1|  catalase                                               206   4e-60   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      206   5e-60   
gb|AAY59707.1|  catalase                                                206   5e-60   
gb|AEG89525.1|  catalase                                                202   5e-60   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               206   6e-60   
gb|EMT06167.1|  Catalase isozyme 2                                      209   7e-60   
ref|XP_005645077.1|  catalase                                           205   8e-60   
gb|ADN94253.1|  catalase                                                205   1e-59   
emb|CAB16750.1|  catalase                                               199   1e-59   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             203   1e-59   
emb|CAA73663.1|  catalase                                               204   2e-59   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                204   2e-59   
emb|CAA43814.1|  catalase                                               204   3e-59   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             202   3e-59   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             204   3e-59   
emb|CDY29518.1|  BnaA06g14520D                                          204   3e-59   
ref|XP_009149540.1|  PREDICTED: catalase-1                              204   3e-59   
emb|CDY31490.1|  BnaC05g15990D                                          204   4e-59   
gb|ADR01107.1|  catalase 3                                              200   4e-59   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 203   4e-59   
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               203   4e-59   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 203   5e-59   
ref|XP_001779509.1|  predicted protein                                  203   5e-59   
gb|ABR16304.1|  unknown                                                 202   6e-59   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   205   7e-59   
gb|EMS61345.1|  Catalase isozyme 1                                      205   7e-59   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         203   8e-59   
ref|NP_973873.1|  catalase 3                                            201   9e-59   
gb|ABK24543.1|  unknown                                                 202   9e-59   
emb|CDP07288.1|  unnamed protein product                                202   1e-58   
gb|ABK24449.1|  unknown                                                 202   2e-58   
dbj|BAH20307.1|  AT1G20620                                              201   2e-58   
gb|AAD30291.2|AF139538_1  catalase 2                                    202   2e-58   
gb|AAD30292.1|AF139539_1  catalase 3                                    202   2e-58   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             201   2e-58   
emb|CDY31488.1|  BnaC05g15970D                                          202   2e-58   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 201   2e-58   
gb|AII23739.1|  catalase                                                201   2e-58   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         201   2e-58   
ref|NP_564120.1|  catalase 3                                            201   2e-58   
emb|CDY29519.1|  BnaA06g14510D                                          201   2e-58   
ref|XP_009110221.1|  PREDICTED: catalase-3                              201   3e-58   
dbj|BAH56915.1|  AT1G20620                                              201   3e-58   
ref|NP_001031073.1|  catalase 3                                         201   3e-58   
emb|CDY33636.1|  BnaC08g19360D                                          201   3e-58   
gb|AAM65021.1|  unknown                                                 201   3e-58   
emb|CDY31878.1|  BnaC07g15280D                                          201   3e-58   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    201   3e-58   
ref|XP_009149539.1|  PREDICTED: catalase-3                              202   4e-58   
emb|CDY01364.1|  BnaA07g11370D                                          202   6e-58   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         200   6e-58   
ref|XP_010498496.1|  PREDICTED: catalase-3                              200   6e-58   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               200   6e-58   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    200   1e-57   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          199   2e-57
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      199   2e-57   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          199   2e-57   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    199   2e-57   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      199   2e-57   
gb|AAC48918.1|  salicylic acid binding catalase                         199   2e-57   
emb|CBI29557.3|  unnamed protein product                                189   2e-57   
ref|NP_001274863.1|  catalase isozyme 1                                 197   1e-56   
emb|CAA85470.1|  catalase                                               197   1e-56   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               197   1e-56   
ref|NP_001234827.1|  catalase isozyme 1                                 197   1e-56   
gb|ACJ71243.1|  catalase 2                                              189   1e-56   
gb|ABC01913.1|  catalase isozyme 1-like protein                         196   3e-56   
emb|CDY40645.1|  BnaA03g53180D                                          195   5e-56   
gb|AAR97905.1|  catalase                                                195   5e-56   
gb|AAC49807.1|  catalase 3                                              195   7e-56   
dbj|BAF91369.1|  catalase                                               194   2e-55   
gb|ACY30463.1|  catalase                                                189   2e-55   
emb|CAC37634.1|  catalase 1                                             188   5e-55   
gb|ABB72796.1|  catalase isozyme 1-like protein                         192   7e-55   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        192   9e-55   
ref|NP_001105416.1|  catalase isozyme 3                                 192   1e-54   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               191   2e-54   
gb|AAO12509.1|  catalase                                                183   2e-54   
gb|AEA86312.1|  catalase isozyme                                        182   4e-54   
gb|AEQ94083.1|  putative catalase                                       183   4e-53   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          187   6e-53   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     187   1e-52   
emb|CAB56850.1|  catalase                                               184   2e-52   
emb|CAP74531.1|  putative Td650 protein                                 179   5e-52   
emb|CDP01802.1|  unnamed protein product                                183   2e-51   
gb|AFC01205.1|  catalase                                                177   2e-51   
gb|AAN78323.1|  catalase1                                               173   1e-50   
gb|AEB22071.1|  catalase 2                                              171   3e-50   
emb|CDW92180.1|  putative catalase                                      174   7e-50   
gb|ABY74514.1|  catalase                                                171   2e-49   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              177   5e-49   
emb|CDW92181.1|  putative catalase                                      172   5e-49   
ref|XP_005536240.1|  catalase                                           173   1e-47   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    151   2e-46   
emb|CAJ00337.1|  putative catalase                                      165   2e-46   
ref|WP_034700019.1|  catalase                                           162   8e-46   
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             159   2e-45   
ref|WP_002978792.1|  catalase                                           161   3e-45   
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                     164   6e-45   
ref|WP_038700758.1|  catalase                                           159   9e-45   
ref|WP_038335781.1|  catalase                                           160   1e-44   
ref|WP_019973735.1|  catalase                                           160   2e-44   
ref|WP_038987770.1|  catalase                                           159   7e-44   
ref|WP_006266515.1|  catalase                                           159   7e-44   
ref|WP_006263075.1|  catalase                                           159   7e-44   
ref|WP_006256937.1|  MULTISPECIES: catalase                             159   7e-44   
ref|WP_041889734.1|  catalase                                           159   1e-43   
gb|KJE89728.1|  catalase isozyme 2                                      155   3e-43   
ref|WP_024740569.1|  catalase                                           152   3e-43   
gb|KFK81701.1|  catalase family protein                                 154   5e-43   
gb|AIC75339.1|  CAT                                                     149   6e-43   
ref|WP_028251747.1|  hydroperoxidase                                    154   1e-42   
ref|WP_029198005.1|  catalase                                           149   1e-42   
ref|XP_005644653.1|  catalase-domain-containing protein                 160   1e-42   
ref|XP_005642928.1|  catalase                                           159   2e-42   
gb|EJF09706.1|  catalase                                                159   2e-42   
ref|WP_040574212.1|  catalase                                           159   2e-42   
gb|KHG11966.1|  Catalase isozyme 2                                      143   3e-42   
ref|XP_004366029.2|  catalase isozyme 2                                 151   3e-42   
gb|ADU56189.1|  catalase 1                                              150   4e-42   
gb|EXU58285.1|  catalase family protein                                 151   4e-42   
ref|WP_002638677.1|  catalase                                           150   6e-42   
gb|AFC35182.1|  catalase dismutase                                      153   6e-42   
dbj|GAE06714.1|  catalase                                               152   1e-41   
ref|WP_027091399.1|  catalase                                           157   1e-41   
ref|WP_003470096.1|  catalase                                           156   2e-41   
ref|WP_016090862.1|  catalase                                           149   2e-41   
ref|WP_036154357.1|  catalase                                           147   2e-41   
ref|WP_024480166.1|  catalase                                           149   2e-41   
ref|WP_007772930.1|  MULTISPECIES: hydroperoxidase II                   149   2e-41   
ref|WP_028783654.1|  catalase                                           156   3e-41   
gb|ACN96906.1|  catalase 2                                              153   3e-41   
ref|WP_029448689.1|  catalase                                           148   3e-41   
ref|WP_034668781.1|  catalase                                           148   4e-41   
ref|WP_039073350.1|  catalase                                           155   4e-41   
ref|WP_025614677.1|  catalase                                           147   4e-41   
ref|WP_024632816.1|  MULTISPECIES: catalase                             155   4e-41   
ref|WP_034663722.1|  catalase                                           155   4e-41   
ref|WP_025027035.1|  catalase                                           155   4e-41   
ref|WP_003211348.1|  catalase                                           155   4e-41   
ref|WP_012009409.1|  catalase                                           155   4e-41   
ref|WP_013551748.1|  catalase                                           148   4e-41   
ref|WP_044333630.1|  catalase                                           155   4e-41   
ref|WP_024425295.1|  MULTISPECIES: catalase                             155   4e-41   
ref|WP_041109904.1|  catalase                                           155   4e-41   
ref|WP_008359888.1|  catalase                                           155   5e-41   
emb|CEI86636.1|  Putative Catalase                                      155   5e-41   
emb|CEG67568.1|  Putative Catalase                                      155   5e-41   
ref|WP_029445986.1|  catalase                                           147   5e-41   
gb|AIM05077.1|  catalase                                                148   5e-41   
ref|WP_024426596.1|  catalase                                           155   5e-41   
dbj|GAN06759.1|  catalase                                               155   5e-41   
ref|WP_035405433.1|  catalase                                           155   6e-41   
ref|WP_029335752.1|  catalase                                           155   6e-41   
ref|WP_024371859.1|  catalase                                           155   6e-41   
ref|WP_034282264.1|  catalase                                           155   6e-41   
ref|WP_036667842.1|  catalase                                           155   6e-41   
ref|WP_039177466.1|  catalase                                           155   6e-41   
ref|WP_040272342.1|  hydroperoxidase                                    153   6e-41   
gb|AGQ21569.2|  catalase                                                150   6e-41   
ref|WP_035703421.1|  catalase                                           155   6e-41   
ref|WP_041091807.1|  catalase                                           155   7e-41   
ref|WP_041089594.1|  catalase                                           155   7e-41   
ref|WP_008348997.1|  MULTISPECIES: catalase                             155   7e-41   
gb|KJF46757.1|  catalase                                                155   7e-41   
ref|WP_024719958.1|  MULTISPECIES: catalase                             155   7e-41   
gb|AHI58962.1|  catalase KatX2                                          155   7e-41   
ref|WP_018904045.1|  hydroperoxidase II                                 154   7e-41   
ref|WP_018932076.1|  catalase                                           155   7e-41   
ref|WP_034321610.1|  catalase                                           155   7e-41   
ref|WP_011246134.1|  catalase                                           155   7e-41   
ref|WP_003355010.1|  catalase                                           155   7e-41   
ref|WP_007497088.1|  catalase                                           155   8e-41   



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   213 bits (543),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERI ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIAERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   100 bits (250),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF  E
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRE  57



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   214 bits (544),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERI ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIAERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF  E
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRE  57



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   213 bits (543),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 90.1 bits (222),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            MDP K+RPSS+ ++P+ TTN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF  E
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRE  57



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   212 bits (540),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARG +AKGFFEVTHD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFFIRDG +FPDV+HAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHI  166


 Score = 88.6 bits (218),  Expect(2) = 8e-73, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            MDP K+RPSSS +TPF TTN GAPV NN  ++TVG RGPILLEDYH++EK+ NFT E
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGAPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRE  57


 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  539  ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  598

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSH+
Sbjct  599  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHL  648


 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  97   RPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSAC  273
            RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF  E  P      
Sbjct  489  RPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIPERVVHA  548

Query  274  EGCNCQGLL  300
             G + +G  
Sbjct  549  RGASAKGFF  557



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   214 bits (545),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERI ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  49   ERIAERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  108

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  109  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  158


 Score = 85.1 bits (209),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  103  SSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            SS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF  E
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRE  49



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   201 bits (511),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+
Sbjct  96   ERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETM  155

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RD RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++I
Sbjct  156  RDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNI  205


 Score = 87.4 bits (215),  Expect(2) = 3e-69, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  82   DP--SKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            DP   +YRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFT E
Sbjct  39   DPIRKRYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  96


 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT LT ADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  578  ERIPERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETL  637

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  638  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  687


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  97   RPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSAC  273
            RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P      
Sbjct  528  RPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIPERVVHA  587

Query  274  EGCNCQGLL  300
             G + +G  
Sbjct  588  RGASAKGFF  596



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   201 bits (510),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+
Sbjct  64   ERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETM  123

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RD RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++I
Sbjct  124  RDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNI  173


 Score = 85.1 bits (209),  Expect(2) = 3e-68, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            DP  YRPSS++N PF TTNGG PV NN  +LT+G RGP+LLEDYHL+EK+ NFT E
Sbjct  11   DP--YRPSSAYNAPFYTTNGGTPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  64


 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT LT ADFLR PG QTP+IVRFSTVIHERGSPET+
Sbjct  546  ERIPERVVHARGASAKGFFEVTHDITQLTSADFLRGPGAQTPVIVRFSTVIHERGSPETL  605

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  606  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  655


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  97   RPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSAC  273
            RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P      
Sbjct  496  RPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIPERVVHA  555

Query  274  EGCNCQGLL  300
             G + +G  
Sbjct  556  RGASAKGFF  564



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/110 (98%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVKMYTREGN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKMYTREGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHI  166


 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKIQNFT E  P
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G   +G  
Sbjct  61   ERVVHARGATAKGFF  75



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   213 bits (543),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERI ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  40   ERIAERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  99

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  100  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  149


 Score = 68.6 bits (166),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  130  TTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF  E
Sbjct  1    TTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRE  40



>gb|AAL38024.1|AF443179_1 catalase [Nicotiana tabacum]
Length=227

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  1    ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  60

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  61   RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  110



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/110 (96%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVKMYTR GN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHI  166


 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT E  P
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETI
Sbjct  57   ERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHI  166


 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFT E  P
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERIVHARGASAKGFF  75



>gb|KDD77132.1| catalase [Helicosporidium sp. ATCC 50920]
Length=496

 Score =   204 bits (519),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARG  A G+FEVT D++ LTCADFLRAPGVQTPL+VRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGTVAHGYFEVTDDVSDLTCADFLRAPGVQTPLLVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFFIRDG +FPD+IHA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFIRDGIKFPDMIHALKPNPKSHI  166


 Score = 74.7 bits (182),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*E  249
            MDP KY PSS +N+   TTN GAPV+NN  +LT G RGPILLED+ L+EK+ NF  E
Sbjct  1    MDPYKYTPSSKYNSRHWTTNTGAPVYNNNNSLTAGLRGPILLEDFELIEKLSNFDRE  57



>gb|ADI58890.1| catalase [Vigna mungo]
Length=163

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  16   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  75

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  76   RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  125



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHI  166


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FT E  P
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G   +G  
Sbjct  61   ERVVHARGATAKGFF  75



>gb|ACJ71242.1| catalase 1 [Vigna unguiculata]
Length=236

 Score =   211 bits (538),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +2

Query  251  IPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRD  430
            IPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RD
Sbjct  1    IPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRD  60

Query  431  PRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            PRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  61   PRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHI  108



>gb|AHG98056.1| catalase, partial [Plectranthus barbatus]
Length=299

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  19   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  78

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  79   RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  128



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER PERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERTPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHI  166


 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFT E  P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHI  166


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FT E  P
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G   +G  
Sbjct  61   ERVVHARGATAKGFF  75



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSH+
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHL  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  50   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  109

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  110  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  159


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSACE  276
            PSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF  E  P       
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  277  GCNCQGLL  300
            G + +G  
Sbjct  61   GASAKGFF  68



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PFCTTN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPG QTP+IVRFSTVIHERGSPET+
Sbjct  56   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETL  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  116  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  165


 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  88   SKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTS  264
            S  RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF  E  P   
Sbjct  3    SHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERV  62

Query  265  SACEGCNCQGLL  300
                G + +G  
Sbjct  63   VHARGASAKGFF  74



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPER+VHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF  E  P
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERIVHARGASAKGFF  75



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  56   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  116  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  165


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PR  258
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF  E  P 
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  259  TSSACEGCNCQGLL  300
                  G + +G  
Sbjct  61   RVVHARGASAKGFF  74



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHI  166


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+FN+ + TTN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF  E  P
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHI  166


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHI  166


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  50   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  109

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  110  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  159


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSACE  276
            PSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF  E  P       
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  277  GCNCQGLL  300
            G + +G  
Sbjct  61   GASAKGFF  68



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF  E  P
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N P  +TN GAPVW+N  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 116/139 (83%), Gaps = 6/139 (4%)
 Frame = +2

Query  158  TTPAHSPSAAEGQFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCA  337
            T  A  P   E   C K+  + R      ERIPERVVHARGA+AKGFFEVTHDITHLTCA
Sbjct  33   TVGARGPILLEDYHCEKLANFDR------ERIPERVVHARGASAKGFFEVTHDITHLTCA  86

Query  338  DFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRD  517
            DFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFPVFFIRD
Sbjct  87   DFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLVGNNFPVFFIRD  146

Query  518  GAQFPDVIHAFKPNPKSHI  574
            G +FPD++HA KPNP++HI
Sbjct  147  GIKFPDMVHALKPNPRTHI  165


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  60   ERVVHARGASAKGFF  74



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF  E  P
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>prf||1803522A catalase
Length=491

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 116/139 (83%), Gaps = 6/139 (4%)
 Frame = +2

Query  158  TTPAHSPSAAEGQFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCA  337
            T  A  P   E   C K+  + R      ERIPERVVHARGA+AKGFFEVTHDITHLTCA
Sbjct  33   TVGARGPILLEDYHCEKLANFDR------ERIPERVVHARGASAKGFFEVTHDITHLTCA  86

Query  338  DFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRD  517
            DFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFPVFFIRD
Sbjct  87   DFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLVGNNFPVFFIRD  146

Query  518  GAQFPDVIHAFKPNPKSHI  574
            G +FPD++HA KPNP++HI
Sbjct  147  GIKFPDMVHALKPNPRTHI  165


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  60   ERVVHARGASAKGFF  74



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHV  166


 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   215 bits (547),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHI  166


 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA++KGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASSKGFF  75



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFF+VTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHI  166


 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  94   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  153

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHI
Sbjct  154  RDPRGFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHI  203


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +1

Query  94   YRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSA  270
            YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P     
Sbjct  43   YRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVH  102

Query  271  CEGCNCQGLL  300
              G + +G  
Sbjct  103  ARGASAKGFF  112



>ref|XP_008778560.1| PREDICTED: catalase isozyme 2-like [Phoenix dactylifera]
Length=482

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+F+  + TTN GAPVWN+  ALTVG RGPILLEDYHL+EKI +F  E  P
Sbjct  1    MDPYKFRPSSAFDPTYTTTNAGAPVWNDDQALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTH+++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHI  166


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K  PS+++N  F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTH+I+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHER SPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>prf||1906388A catalase
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  54   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  113

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  114  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  163


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P    
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  62   HARGASAKGFF  72



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N+P+ T N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHI  166


 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  55   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  114

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  115  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  164


 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P    
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  63   HARGASAKGFF  73



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT+LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  54   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  113

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  114  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  163


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P    
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  62   HARGASAKGFF  72



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F  E  P
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF+T + TTN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F  E  P
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F  E  P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHV  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F  E  P
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F  E  P
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHV  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F  E  P
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+ ++PF TTN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF  E  P
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSH+
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHL  166


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F  E  P
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++H+ KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHI  166


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  56   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  116  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  165


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF T N GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  60   ERVVHARGASAKGFF  74



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFT E  P
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERIVHARGASAKGFF  75



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHI  166


 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F  E  P
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETI
Sbjct  57   ERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHI  166


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFT E  P
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERIVHARGASAKGFF  75



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 115/139 (83%), Gaps = 6/139 (4%)
 Frame = +2

Query  158  TTPAHSPSAAEGQFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCA  337
            T  A  P   E   C K+  + R      ERIPERVVHARGA+AKGFFEVTHDITHLTCA
Sbjct  33   TVGARGPILLEDYHCEKLANFDR------ERIPERVVHARGASAKGFFEVTHDITHLTCA  86

Query  338  DFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRD  517
            DFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV  YTREGN+DLVGNNFPVFFIRD
Sbjct  87   DFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVNFYTREGNWDLVGNNFPVFFIRD  146

Query  518  GAQFPDVIHAFKPNPKSHI  574
            G +FPD++HA KPNP++HI
Sbjct  147  GIKFPDMVHALKPNPRTHI  165


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  60   ERVVHARGASAKGFF  74



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHI  166


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F  E  P
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 112/127 (88%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+
Sbjct  46   QLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPV  99

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFK
Sbjct  100  IVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFK  159

Query  554  PNPKSHI  574
            PNPKSH+
Sbjct  160  PNPKSHL  166


 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FT E  P
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFT E  P
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGMSAKGFF  75



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THDI+HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N+P  TTN GAPVWN+  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  +FPD IHAFKPNPKS+I
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNI  166


 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETI
Sbjct  57   ERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFT E  P
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERIVHARGASAKGFF  75



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F  E  P
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G   +G  
Sbjct  61   ERVVHARGATAKGFF  75



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AIR77003.1| catalase, partial [Lilium longiflorum]
Length=292

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGF E THD+T LTCADFLRAPGVQTP+I+RFSTVIHERGSPETI
Sbjct  11   ERIPERVVHARGASAKGFLECTHDVTGLTCADFLRAPGVQTPIILRFSTVIHERGSPETI  70

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  71   RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  120



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHI  166


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHI  166


 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F  E  P
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+T+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F  E  P
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HI
Sbjct  117  RDPRGFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHI  166


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 111/127 (87%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHD++ L+CADFLRAPGVQTP+
Sbjct  15   QLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPV  68

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFK
Sbjct  69   IVRFSTVIHERGSPETVRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFK  128

Query  554  PNPKSHI  574
            PNPKSH+
Sbjct  129  PNPKSHL  135



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  56   ERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  116  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  165


 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PR  258
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P 
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  259  TSSACEGCNCQGLL  300
                  G + +G  
Sbjct  61   RVVHARGASAKGFF  74



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDI+HLTCADFLRA GVQTPLIVRFSTVIHERGSPET+
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F  E  P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHV  166


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+H+TCADFLRAPGVQTP+I+RFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHI  166


 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNP++HI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHI  166


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHV  166


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHI  166


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F  E  P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF  E  P
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 111/127 (87%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+
Sbjct  46   QLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPV  99

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFK
Sbjct  100  IVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFK  159

Query  554  PNPKSHI  574
            PNPKSH+
Sbjct  160  PNPKSHL  166


 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FT E  P
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNP+S+I
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSNI  166


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++++ F TTN G PVWN+  ALT+G+RGPILLEDYHL+EK+ +F  E  P
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLIEKVAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER PERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+
Sbjct  57   ERTPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHI  166


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K  PSS+FN PF TTN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F  E  P
Sbjct  1    MDPYKPIPSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARERTP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF  E  P
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  41   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  100

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  101  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  150


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  130  TTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSSACEGCNCQGLL  300
            TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF  E  P       G + +G  
Sbjct  2    TTNAGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFF  59



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPE I
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHI  166


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNP++HI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHI  166


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F  E  P
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  166


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F  E  P
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 6/131 (5%)
 Frame = +2

Query  182  AAEGQFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGV  361
            + + Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGV
Sbjct  33   SEDYQLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGV  86

Query  362  QTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVI  541
            QTP+IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI
Sbjct  87   QTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVI  146

Query  542  HAFKPNPKSHI  574
             AFKPNPKSHI
Sbjct  147  RAFKPNPKSHI  157


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 10/75 (13%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++         EDY L+EKI  FT E  P
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMS---------EDYQLIEKIATFTRERIP  51

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  52   ERVVHARGASAKGFF  66



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  56   ERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  116  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  165


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PR  258
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P 
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  259  TSSACEGCNCQGLL  300
                  G + +G  
Sbjct  61   RVVHARGASAKGFF  74



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  58   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  117

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHI
Sbjct  118  RDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHI  167


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P    
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  66   HARGASAKGFF  76



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF  E  P
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+I
Sbjct  117  RDPRGFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNI  166


 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHI  166


 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF  E  P
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER+PERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET 
Sbjct  57   ERVPERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETP  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F  E  P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIH RGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK+YT EGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HI
Sbjct  117  RDPRGFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHI  166


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHI  166


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  91   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  150

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  151  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  200


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 51/109 (47%), Gaps = 35/109 (32%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSR-----------------------  189
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSR                       
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRDSPKKSSNAYSDINQEKILEFPK  60

Query  190  -----------GPILLEDYHLVEKIQNFT*ED-PRTSSACEGCNCQGLL  300
                        PILLEDYHLVEKI +F  E  P       G + +G  
Sbjct  61   AAPITFHKNLASPILLEDYHLVEKIADFDRERIPERVVHARGASAKGFF  109



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  166


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K  PSS+ ++PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKVVPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F  E  P
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 111/127 (87%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+
Sbjct  46   QLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPV  99

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  QFP+VI AFK
Sbjct  100  IVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPEVIRAFK  159

Query  554  PNPKSHI  574
            PNPKSHI
Sbjct  160  PNPKSHI  166


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FT E  P
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  166


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K  PSS+ ++PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHE GSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 111/127 (87%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+
Sbjct  46   QLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPV  99

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFK
Sbjct  100  IVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFK  159

Query  554  PNPKSHI  574
            PNPKSHI
Sbjct  160  PNPKSHI  166


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FT E  P
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  254  PERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDP  433
            PERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDP
Sbjct  1    PERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDP  60

Query  434  RGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  61   RGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHI  107



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLR PGVQTP+IVRFSTVIHERGSPE+I
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHI  166


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF  E  P
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAP80622.1|AF475100_1 catalase isozyme, partial [Triticum aestivum]
Length=268

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTV+HERGSPET+
Sbjct  71   ERIPERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETL  130

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HAFKP+PK+++
Sbjct  131  RDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNM  180


 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            K+RP+S  N+ + TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F  E  P    
Sbjct  19   KHRPTSGANSGYWTTNSGAPVWNNNNALTVGQRGPILLEDYHLIEKLAQFDRERIPERVV  78

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  79   HARGASAKGFF  89



>gb|ADU56198.1| catalase [Musa acuminata AAA Group]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPETI
Sbjct  57   ERIPERVVHARGASAKGFFECTHDVTGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHI  166


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+F T + TTN G PVWN+  ALTVG RGPILLEDYHL+EKI +F  E  P
Sbjct  1    MDPYKFRPSSAFGTTYTTTNAGGPVWNDNEALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 111/127 (87%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVH RGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+
Sbjct  46   QLIEKIATFTR------ERIPERVVHRRGASAKGFFEVTHDISNLTCADFLRAPGVQTPV  99

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFK
Sbjct  100  IVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFK  159

Query  554  PNPKSHI  574
            PNPKSH+
Sbjct  160  PNPKSHL  166


 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FT E  P
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHRRGASAKGFF  75



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ER PER+VHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPETI
Sbjct  57   ERTPERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETI  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNWDLVGNNFPVFFVRDPMKFPDVIHAFKPNPKSHI  166


 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FT E  P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERIVHARGASAKGFF  75



>prf||2104177A catalase
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVR STVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARG +AKGFFEVTHD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA K YTREGNFD+VGNNFPVFFIRDG +FPDV+HAFKPNPKSHI
Sbjct  117  RDPRGFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHI  166


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSSS +TPF TTN G PV NN  ++TVG RGPILLEDYH++EK+ NFT E  P
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGDPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGMSAKGFF  75



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HL CADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  166


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F  E  P
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFL APGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHI  166


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F  E  P
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  77   ERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  136

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  137  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  186


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            ++RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF  E  P    
Sbjct  25   EFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIPERVV  84

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  85   HARGASAKGFF  95



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DL GNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  117  RDPRGFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  166


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F  E  P
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  98   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  157

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HI
Sbjct  158  RDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHI  207


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            ++RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F  E  P    
Sbjct  46   QHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIPERVV  105

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  106  HARGASAKGFF  116



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+
Sbjct  76   ERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETL  135

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  136  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  185


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF  E  P    
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  84   HARGASAKGFF  94



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVT+D++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHI  166


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F  E  P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  208

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHI
Sbjct  209  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHI  258


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  67   PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*  246
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF  
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  247  ED-PRTSSACEGCNCQGLL  300
            E  P       G + +G  
Sbjct  149  ERIPERVVHARGASAKGFF  167



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHI  166


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK+YTREGNFDLVGNN PVFFIRDG +FPD++HAFKPNPK+++
Sbjct  117  RDPRGFAVKLYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNL  166


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F  E  P
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 111/127 (87%), Gaps = 6/127 (5%)
 Frame = +2

Query  194  QFCWKIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPL  373
            Q   KI T+ R      ERIPERVVHARGA+AKGFFEVTHD++ L+CADFLRAPGVQTP+
Sbjct  15   QLIEKIATFTR------ERIPERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPV  68

Query  374  IVRFSTVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFK  553
            IVRFSTVIHERGSPET+RDPRGFAVK YTREG+FDLVGNNFPVFF+RD  QFPDVI AFK
Sbjct  69   IVRFSTVIHERGSPETVRDPRGFAVKFYTREGSFDLVGNNFPVFFVRDAMQFPDVIRAFK  128

Query  554  PNPKSHI  574
            PNPKSH+
Sbjct  129  PNPKSHL  135



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHI  166


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLT ADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNP+SHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHI  166


 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHI
Sbjct  117  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHSLKPNPKSHI  166


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++N PF TTN GAPV+NN  +LTVG+RGPILLEDYH VEK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AGT16054.1| catalase [Saccharum hybrid cultivar R570]
Length=492

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+T LTCADFLRAPGV+TP+IVRFSTVIHERGSPETI
Sbjct  56   ERIPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETI  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+
Sbjct  116  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHV  165


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            ++RPSSS +T   TTN GAPVWN+  ALTVG RGPILLEDYHL+EK+ +F  E  P    
Sbjct  4    QFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVV  63

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  64   HARGASAKGFF  74



>gb|AAC19398.1| root catalase [Mesembryanthemum crystallinum]
Length=493

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 110/123 (89%), Gaps = 6/123 (5%)
 Frame = +2

Query  206  KIITWWRKFKTSLERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRF  385
            KI +W R      ERIPERVVHARGA+AKGFFEVT+DITHLTCADFLRAPGVQTP+IVRF
Sbjct  50   KIASWDR------ERIPERVVHARGASAKGFFEVTNDITHLTCADFLRAPGVQTPVIVRF  103

Query  386  STVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPK  565
            STVIHERGSPET+RDPRGFA+K YTREGNFDLVGNNFPVFF RD  +FPDV+ AFKPNPK
Sbjct  104  STVIHERGSPETMRDPRGFALKFYTREGNFDLVGNNFPVFFNRDAMKFPDVVRAFKPNPK  163

Query  566  SHI  574
            SHI
Sbjct  164  SHI  166


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSSS+NT F TT  G PVWN+  +LTVG+RGPILLEDYHL+EKI ++  E  P
Sbjct  1    MDPYKYRPSSSYNTSFMTTKTGQPVWNDDSSLTVGARGPILLEDYHLLEKIASWDRERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  57   ERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  116

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+I
Sbjct  117  RDPRGFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNI  166


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-P  255
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF  E  P
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  256  RTSSACEGCNCQGLL  300
                   G + +G  
Sbjct  61   ERVVHARGASAKGFF  75



>gb|AGT16188.1| catalase [Saccharum hybrid cultivar R570]
Length=492

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  245  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  424
            ERIPERVVHARGA+AKGFFE THD+T LTCADFLRAPGV+TP+IVRFSTVIHERGSPETI
Sbjct  56   ERIPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETI  115

Query  425  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHI  574
            RDPRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+
Sbjct  116  RDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHV  165


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFT*ED-PRTSS  267
            ++RPSSS +T   TTN GAPVWN+  ALTVG RGPILLEDYHL+EK+ +F  E  P    
Sbjct  4    QFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVV  63

Query  268  ACEGCNCQGLL  300
               G + +G  
Sbjct  64   HARGASAKGFF  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750