BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF013J02

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008221422.1|  PREDICTED: DELLA protein GAIP-B                  83.2    4e-15   Prunus mume [ume]
ref|XP_004298516.1|  PREDICTED: DELLA protein GAIP                    82.4    6e-15   Fragaria vesca subsp. vesca
ref|XP_010681882.1|  PREDICTED: DELLA protein GAI-like                81.3    2e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|AGK07287.1|  GAI1                                                  80.5    3e-14   Rosa hybrid cultivar
ref|XP_007045197.1|  GRAS family transcription factor family protein  80.1    4e-14   
gb|ACR58455.1|  GAI/RGA protein                                       80.1    5e-14   Gossypium hirsutum [American cotton]
gb|ABG26370.1|  DELLA protein GAI                                     80.1    5e-14   Gossypium barbadense [Egyptian cotton]
gb|KJB15415.1|  hypothetical protein B456_002G177000                  79.7    5e-14   Gossypium raimondii
ref|XP_002527794.1|  DELLA protein GAIP-B, putative                   79.0    9e-14   
ref|XP_002312450.2|  hypothetical protein POPTR_0008s13090g           79.0    9e-14   
ref|XP_006469195.1|  PREDICTED: DELLA protein GAIP-B-like             78.6    1e-13   Citrus sinensis [apfelsine]
ref|XP_006448223.1|  hypothetical protein CICLE_v10017466mg           78.6    1e-13   Citrus clementina [clementine]
ref|XP_010264458.1|  PREDICTED: DELLA protein GAI1                    78.6    1e-13   Nelumbo nucifera [Indian lotus]
gb|ACL68360.1|  DELLA protein                                         78.2    2e-13   Malus domestica [apple tree]
gb|AAY56751.1|  DELLA protein                                         78.2    2e-13   Malus domestica [apple tree]
gb|ADH53778.1|  GAI2                                                  78.2    2e-13   Malus domestica [apple tree]
ref|XP_011070609.1|  PREDICTED: DELLA protein GAI1                    77.4    3e-13   Sesamum indicum [beniseed]
emb|CBI26874.3|  unnamed protein product                              76.6    3e-13   Vitis vinifera
emb|CAN67929.1|  hypothetical protein VITISV_007904                   77.4    3e-13   Vitis vinifera
ref|XP_002284648.1|  PREDICTED: DELLA protein GAI1                    77.4    3e-13   Vitis vinifera
ref|XP_011038614.1|  PREDICTED: DELLA protein GAIP                    77.4    3e-13   Populus euphratica
ref|XP_002314799.2|  hypothetical protein POPTR_0010s12080g           77.4    4e-13   Populus trichocarpa [western balsam poplar]
gb|KDP38079.1|  hypothetical protein JCGZ_04722                       77.0    5e-13   Jatropha curcas
gb|AFJ23219.1|  DELLA protein                                         77.0    5e-13   Pyrus betulifolia
ref|XP_011023720.1|  PREDICTED: DELLA protein GAIP-B-like             76.6    5e-13   Populus euphratica
ref|XP_009351505.1|  PREDICTED: DELLA protein GAI-like                76.6    5e-13   Pyrus x bretschneideri [bai li]
gb|AFJ23220.1|  DELLA protein                                         76.6    5e-13   Pyrus x bretschneideri [bai li]
gb|AEX97109.1|  spur-type DELLA protein                               76.6    6e-13   Malus domestica [apple tree]
gb|ADW85805.1|  DELLA protein                                         76.6    6e-13   Malus domestica [apple tree]
gb|ACL68359.1|  DELLA protein                                         76.6    6e-13   Malus baccata var. xiaojinensis
ref|XP_009789076.1|  PREDICTED: DELLA protein GAI1-like               75.9    1e-12   Nicotiana sylvestris
gb|AFP58844.1|  DELLA domain GRAS family transcription factor GAI     75.5    1e-12   Populus tomentosa [Chinese white poplar]
gb|AEK06229.1|  GAI1                                                  75.5    2e-12   Vitis vinifera
sp|Q6EI05.1|GAIPB_CUCMA  RecName: Full=DELLA protein GAIP-B; AltN...  75.5    2e-12   Cucurbita maxima [Boston marrow]
gb|ABL61270.1|  GAI1                                                  75.1    2e-12   Malus hupehensis
sp|Q6EI06.1|GAIP_CUCMA  RecName: Full=DELLA protein GAIP; AltName...  75.1    2e-12   Cucurbita maxima [Boston marrow]
ref|XP_010274729.1|  PREDICTED: DELLA protein GAI1-like               75.1    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009603475.1|  PREDICTED: DELLA protein GAI1-like               74.7    2e-12   Nicotiana tomentosiformis
gb|AAY56752.1|  DELLA protein                                         74.3    4e-12   Malus domestica [apple tree]
ref|XP_004150593.1|  PREDICTED: DELLA protein GAIP-B-like             74.3    4e-12   Cucumis sativus [cucumbers]
ref|XP_004166672.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  73.9    4e-12   
ref|XP_007033025.1|  GRAS family transcription factor family protein  74.3    4e-12   
ref|XP_008467128.1|  PREDICTED: DELLA protein GAIP-B                  73.9    4e-12   Cucumis melo [Oriental melon]
ref|XP_006482132.1|  PREDICTED: DELLA protein GAI-like                73.9    5e-12   Citrus sinensis [apfelsine]
gb|KDO64603.1|  hypothetical protein CISIN_1g043131mg                 73.9    5e-12   Citrus sinensis [apfelsine]
ref|XP_006430617.1|  hypothetical protein CICLE_v10011367mg           73.2    8e-12   Citrus clementina [clementine]
gb|AEE69074.2|  GAI-like protein                                      73.2    9e-12   Juglans regia
ref|XP_009349514.1|  PREDICTED: DELLA protein GAI-like                72.4    1e-11   
ref|XP_010109004.1|  hypothetical protein L484_027201                 72.4    2e-11   
ref|XP_007163387.1|  hypothetical protein PHAVU_001G230500g           72.0    2e-11   Phaseolus vulgaris [French bean]
dbj|BAF62637.1|  DELLA protein                                        72.0    2e-11   Phaseolus vulgaris [French bean]
ref|XP_002266267.1|  PREDICTED: DELLA protein GAI-like                72.0    2e-11   Vitis vinifera
ref|XP_010554410.1|  PREDICTED: DELLA protein GAI-like                71.6    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_010553798.1|  PREDICTED: DELLA protein GAI-like                71.6    3e-11   Tarenaya hassleriana [spider flower]
gb|AFC88481.1|  DELLA protein                                         71.6    3e-11   Rosa lucieae [memorial rose]
gb|AFC88482.1|  DELLA protein                                         71.6    3e-11   Rosa lucieae [memorial rose]
emb|CDP11067.1|  unnamed protein product                              68.6    3e-11   Coffea canephora [robusta coffee]
ref|XP_006364643.1|  PREDICTED: DELLA protein GAI-like                71.2    4e-11   
ref|NP_001234365.1|  DELLA protein GAI                                71.2    4e-11   Solanum lycopersicum
gb|AEI25530.1|  gibberellic acid insensitive protein                  71.2    4e-11   Solanum tuberosum [potatoes]
ref|XP_007214956.1|  hypothetical protein PRUPE_ppa003206mg           71.2    4e-11   Prunus persica
gb|AFA35960.1|  ELLA domain GRAS family transcription factor          70.9    5e-11   Nicotiana attenuata
ref|XP_009796771.1|  PREDICTED: DELLA protein GAI-like                70.1    8e-11   Nicotiana sylvestris
pdb|2ZSH|B  Chain B, Structural Basis Of Gibberellin(Ga3)-Induced...  66.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011097451.1|  PREDICTED: DELLA protein GAI-like                70.1    8e-11   Sesamum indicum [beniseed]
emb|CAN59753.1|  hypothetical protein VITISV_036639                   70.1    9e-11   Vitis vinifera
ref|XP_010032696.1|  PREDICTED: DELLA protein GAI                     70.1    1e-10   Eucalyptus grandis [rose gum]
dbj|BAM14051.1|  DELLA 1 sprice variant                               68.6    1e-10   Lactuca sativa [cultivated lettuce]
ref|XP_010502135.1|  PREDICTED: DELLA protein RGA-like                69.3    1e-10   Camelina sativa [gold-of-pleasure]
gb|ABO61516.1|  GAI1                                                  68.9    2e-10   Glycine max [soybeans]
ref|NP_001240948.1|  DELLA protein GAI 1                              68.9    2e-10   Glycine max [soybeans]
gb|KHN07547.1|  DELLA protein GAI1                                    65.5    2e-10   Glycine soja [wild soybean]
ref|XP_009594460.1|  PREDICTED: DELLA protein GAI-like                68.9    2e-10   Nicotiana tomentosiformis
ref|XP_009114228.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  68.6    3e-10   Brassica rapa
gb|ADD71137.1|  DELLA protein                                         68.6    3e-10   Brassica napus [oilseed rape]
sp|Q5BN22.1|RGA2_BRACM  RecName: Full=DELLA protein RGA2; AltName...  68.6    3e-10   Brassica rapa
dbj|BAG16380.1|  GRAS family transcription factor                     68.6    3e-10   Brassica rapa var. perviridis [kabuna]
emb|CDY04092.1|  BnaA09g18700D                                        68.6    3e-10   
gb|KHN17945.1|  DELLA protein GAI1                                    67.0    3e-10   Glycine soja [wild soybean]
dbj|BAG71200.1|  DELLA 1                                              68.2    3e-10   Lactuca sativa [cultivated lettuce]
ref|XP_006395878.1|  hypothetical protein EUTSA_v10005482mg           68.2    4e-10   Eutrema salsugineum [saltwater cress]
ref|XP_006826893.1|  hypothetical protein AMTR_s00010p00148880        68.2    4e-10   Amborella trichopoda
emb|CDY64837.1|  BnaC09g52270D                                        68.2    4e-10   Brassica napus [oilseed rape]
ref|XP_010513881.1|  PREDICTED: DELLA protein RGA isoform X1          68.2    4e-10   
dbj|BAG16374.1|  GRAS family transcription factor                     68.2    4e-10   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_010476569.1|  PREDICTED: DELLA protein GAI-like                67.8    4e-10   Camelina sativa [gold-of-pleasure]
gb|AHB17742.1|  GA repressor DELLA                                    67.8    4e-10   Actinidia deliciosa [Chinese gooseberry]
gb|ABI34432.1|  CRY                                                   67.8    5e-10   Pisum sativum [garden pea]
gb|AHB17743.1|  GA repressor DELLA                                    67.8    5e-10   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like               67.4    5e-10   Glycine max [soybeans]
ref|XP_006292324.1|  hypothetical protein CARUB_v10018534mg           67.8    6e-10   
ref|XP_004503135.1|  PREDICTED: DELLA protein GAI-like                67.4    7e-10   Cicer arietinum [garbanzo]
gb|KJB08563.1|  hypothetical protein B456_001G089400                  67.4    7e-10   Gossypium raimondii
gb|ACM47244.1|  putative gibberellin signaling DELLA protein          67.4    7e-10   Sinningia speciosa [Brazilian gloxinia]
gb|AAY28970.1|  GIA/RGA-like gibberellin response modulator           67.0    7e-10   Gossypium hirsutum [American cotton]
gb|EPS61323.1|  hypothetical protein M569_13471                       67.0    7e-10   Genlisea aurea
sp|Q84TQ7.1|GAI_GOSHI  RecName: Full=DELLA protein GAI; AltName: ...  67.0    8e-10   Gossypium hirsutum [American cotton]
ref|XP_003538395.1|  PREDICTED: DELLA protein GAI1                    67.0    8e-10   Glycine max [soybeans]
ref|XP_003552980.1|  PREDICTED: DELLA protein GAI-like                67.0    1e-09   Glycine max [soybeans]
gb|EYU30084.1|  hypothetical protein MIMGU_mgv1a027121mg              67.0    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_004140302.1|  PREDICTED: DELLA protein GAI-like                66.6    1e-09   
gb|EYU30908.1|  hypothetical protein MIMGU_mgv1a024641mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
gb|AEB36192.1|  RGA-like 1                                            63.9    1e-09   Helianthus tuberosus [Jerusalem artichoke]
emb|CAA72178.1|  RGA2 protein                                         66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75492.1|  GAI                                                  66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172945.1|  DELLA protein GAI                                   66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004155733.1|  PREDICTED: DELLA protein GAI-like                66.6    1e-09   
gb|AEB36201.1|  RGA-like 1                                            63.9    1e-09   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010424927.1|  PREDICTED: DELLA protein RGA-like                66.6    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002890081.1|  hypothetical protein ARALYDRAFT_471680           66.2    1e-09   
gb|AEB36183.1|  RGA-like 1                                            63.9    1e-09   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002305198.1|  hypothetical protein POPTR_0004s08890g           66.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010496659.1|  PREDICTED: DELLA protein GAI                     65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011021384.1|  PREDICTED: DELLA protein GAI-like                66.2    2e-09   Populus euphratica
ref|XP_010459010.1|  PREDICTED: DELLA protein GAI-like                65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010527787.1|  PREDICTED: DELLA protein GAI-like                65.9    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_006383329.1|  hypothetical protein POPTR_0005s14540g           65.9    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004504565.1|  PREDICTED: DELLA protein GAI1-like               65.5    2e-09   Cicer arietinum [garbanzo]
ref|XP_008229195.1|  PREDICTED: DELLA protein GAI                     65.9    2e-09   
ref|XP_006307228.1|  hypothetical protein CARUB_v10008833mg           65.5    3e-09   Capsella rubella
gb|AHX57850.1|  DELLA                                                 65.5    3e-09   Prunus mume [ume]
gb|AEB36151.1|  RGA-like 1                                            62.8    3e-09   Helianthus petiolaris
gb|ABI30654.1|  putative gibberellin signaling DELLA protein LA       65.5    3e-09   Pisum sativum [garden pea]
gb|AEB36150.1|  RGA-like 1                                            62.8    3e-09   Helianthus petiolaris
gb|AEB36147.1|  RGA-like 1                                            62.8    3e-09   Helianthus petiolaris
ref|XP_009590329.1|  PREDICTED: DELLA protein GAI-like                65.5    3e-09   Nicotiana tomentosiformis
ref|XP_008460522.1|  PREDICTED: DELLA protein GAI-like                65.5    3e-09   Cucumis melo [Oriental melon]
gb|AEB36211.1|  RGA-like 1                                            62.8    3e-09   Helianthus argophyllus
gb|AEB36172.1|  RGA-like 1                                            62.8    3e-09   Helianthus exilis
gb|AEB36338.1|  RGA-like 1                                            62.8    3e-09   Helianthus annuus
gb|AEB36307.1|  RGA-like 1                                            62.8    3e-09   Helianthus annuus
gb|AEB36175.1|  RGA-like 1                                            62.4    3e-09   Helianthus exilis
gb|AEB36179.1|  RGA-like 1                                            62.4    3e-09   Helianthus exilis
gb|AEB36200.1|  RGA-like 1                                            62.8    3e-09   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002876760.1|  RGA1 protein                                     65.5    3e-09   
gb|AEB36153.1|  RGA-like 1                                            62.8    3e-09   Helianthus petiolaris
gb|AEB36196.1|  RGA-like 1                                            62.8    3e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36327.1|  RGA-like 1                                            62.4    3e-09   Helianthus annuus
gb|AEB36202.1|  RGA-like 1                                            62.8    3e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36217.1|  RGA-like 1                                            62.8    3e-09   Helianthus argophyllus
gb|AEB36197.1|  RGA-like 1                                            62.8    3e-09   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_006846116.1|  hypothetical protein AMTR_s00012p00140520        61.6    4e-09   
gb|AEB36184.1|  RGA-like 1                                            62.8    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36186.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36207.1|  RGA-like 1                                            62.4    4e-09   Helianthus argophyllus
gb|AEB36203.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36190.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36313.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36156.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AEB36182.1|  RGA-like 1                                            62.4    4e-09   Helianthus exilis
gb|AEB36297.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36157.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AEB36206.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36193.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36204.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36189.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_011002785.1|  PREDICTED: DELLA protein GAI                     65.1    4e-09   Populus euphratica
gb|AEB36154.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AHB17744.1|  GA repressor DELLA                                    65.1    4e-09   Actinidia deliciosa [Chinese gooseberry]
gb|AEB36152.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AEB36149.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AEB36148.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AEB36176.1|  RGA-like 1                                            62.4    4e-09   Helianthus exilis
gb|AEB36194.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36334.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36294.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36155.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
gb|AEB36315.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
ref|XP_009779842.1|  PREDICTED: DELLA protein GAI-like isoform X3     65.1    4e-09   Nicotiana sylvestris
gb|AEB36311.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36304.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36178.1|  RGA-like 1                                            62.4    4e-09   Helianthus exilis
ref|XP_009779840.1|  PREDICTED: DELLA protein GAI-like isoform X1     65.1    4e-09   Nicotiana sylvestris
gb|AEB36330.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36305.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36293.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36219.1|  RGA-like 1                                            62.4    4e-09   Helianthus annuus
gb|AEB36158.1|  RGA-like 1                                            62.4    4e-09   Helianthus petiolaris
ref|XP_006416958.1|  hypothetical protein EUTSA_v10007323mg           64.7    4e-09   Eutrema salsugineum [saltwater cress]
gb|AEB36177.1|  RGA-like 1                                            62.4    4e-09   Helianthus exilis
gb|AEB36205.1|  RGA-like 1                                            62.4    4e-09   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009779843.1|  PREDICTED: DELLA protein GAI-like isoform X4     64.7    5e-09   Nicotiana sylvestris
ref|XP_002534030.1|  DELLA protein GAI, putative                      64.7    5e-09   Ricinus communis
gb|EYU45810.1|  hypothetical protein MIMGU_mgv1a003644mg              64.7    5e-09   Erythranthe guttata [common monkey flower]
gb|AFR90187.1|  GIA/RGA-like gibberellin response modulator           62.4    5e-09   Helianthus floridanus
gb|AFR90188.1|  GIA/RGA-like gibberellin response modulator           62.4    5e-09   Helianthus debilis subsp. debilis
gb|AEB36329.1|  RGA-like 1                                            62.0    5e-09   Helianthus annuus
ref|XP_011099949.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  64.7    5e-09   Sesamum indicum [beniseed]
dbj|BAG71201.1|  DELLA 2                                              64.7    5e-09   Lactuca sativa [cultivated lettuce]
gb|AEB36181.1|  RGA-like 1                                            62.0    5e-09   Helianthus exilis
gb|AAY56749.1|  DELLA protein                                         64.7    6e-09   Malus domestica [apple tree]
gb|ABS50250.1|  DELLA protein                                         64.3    6e-09   Malus hupehensis
gb|AEX97110.1|  spur-type DELLA protein                               64.3    6e-09   Malus domestica [apple tree]
ref|XP_008381346.1|  PREDICTED: DELLA protein GAI                     64.3    7e-09   
gb|ABG35314.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|AFR90189.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|ABG35340.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|ABG35317.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|ABG35324.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|ABG35336.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|ABG35316.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|ABG35338.1|  GIA/RGA-like gibberellin response modulator           62.0    7e-09   Helianthus annuus
gb|EYU25601.1|  hypothetical protein MIMGU_mgv1a003589mg              63.9    8e-09   Erythranthe guttata [common monkey flower]
dbj|BAF62636.1|  DELLA protein                                        63.9    8e-09   Phaseolus vulgaris [French bean]
ref|XP_007156503.1|  hypothetical protein PHAVU_003G291500g           63.9    8e-09   Phaseolus vulgaris [French bean]
gb|KEH34625.1|  DELLA domain GRAS family transcription factor GAI     63.9    9e-09   Medicago truncatula
gb|AEB36195.1|  RGA-like 1                                            61.2    9e-09   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36171.1|  RGA-like 1                                            61.2    1e-08   Helianthus exilis
ref|XP_010551797.1|  PREDICTED: DELLA protein RGL1-like               63.5    1e-08   Tarenaya hassleriana [spider flower]
gb|AEX97111.1|  spur-type DELLA protein                               63.5    1e-08   Malus domestica [apple tree]
ref|XP_008343058.1|  PREDICTED: DELLA protein GAI-like                63.5    1e-08   
ref|XP_009334448.1|  PREDICTED: DELLA protein GAI-like                63.5    1e-08   Pyrus x bretschneideri [bai li]
gb|AAY56750.1|  DELLA protein                                         63.5    1e-08   Malus domestica [apple tree]
gb|AEB36160.1|  RGA-like 1                                            60.8    1e-08   Helianthus paradoxus
gb|AEB36159.1|  RGA-like 1                                            60.8    2e-08   Helianthus paradoxus
gb|AEB36165.1|  RGA-like 1                                            60.8    2e-08   Helianthus paradoxus
gb|AEB36163.1|  RGA-like 1                                            60.5    2e-08   Helianthus paradoxus
ref|XP_009370101.1|  PREDICTED: DELLA protein GAI-like                63.2    2e-08   
gb|KFK33379.1|  rga1 protein                                          63.2    2e-08   Arabis alpina [alpine rockcress]
ref|XP_010916517.1|  PREDICTED: DELLA protein SLR1 isoform X1         62.4    3e-08   
gb|AFR90185.1|  GIA/RGA-like gibberellin response modulator           60.1    4e-08   Helianthus annuus
ref|NP_178266.1|  DELLA protein RGA                                   61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72177.1|  RGA1 protein                                         61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75493.1|  GRS protein                                          61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK97709.1|  At2g01570/F2I9.19                                     61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AHB17746.1|  GA repressor DELLA                                    61.2    7e-08   Actinidia deliciosa [Chinese gooseberry]
gb|KDP33169.1|  hypothetical protein JCGZ_13434                       61.6    7e-08   Jatropha curcas
ref|XP_010528540.1|  PREDICTED: DELLA protein RGL1                    60.8    9e-08   Tarenaya hassleriana [spider flower]
gb|AHB17745.1|  GA repressor DELLA                                    60.5    1e-07   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010066602.1|  PREDICTED: DELLA protein GAIP-B-like             60.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_008809806.1|  PREDICTED: DELLA protein SLR1                    60.5    1e-07   Phoenix dactylifera
emb|CDY36236.1|  BnaC07g20900D                                        60.1    2e-07   Brassica napus [oilseed rape]
ref|XP_009390245.1|  PREDICTED: DELLA protein SLR1-like               60.1    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFR90186.1|  GIA/RGA-like gibberellin response modulator           58.2    2e-07   Helianthus ciliaris
gb|ADA84480.1|  GRAS                                                  59.3    3e-07   Antirrhinum majus [garden snapdragon]
ref|XP_010470510.1|  PREDICTED: DELLA protein RGL1 isoform X1         59.3    3e-07   
ref|XP_010511563.1|  PREDICTED: DELLA protein RGL1-like               58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010415179.1|  PREDICTED: DELLA protein RGL1-like               58.9    3e-07   Camelina sativa [gold-of-pleasure]
gb|KFK26113.1|  hypothetical protein AALP_AA8G204400                  58.5    4e-07   Arabis alpina [alpine rockcress]
ref|XP_010926472.1|  PREDICTED: DELLA protein SLR1-like               58.5    5e-07   Elaeis guineensis
emb|CDY17662.1|  BnaA06g34810D                                        58.5    5e-07   Brassica napus [oilseed rape]
ref|XP_009101333.1|  PREDICTED: DELLA protein RGA1                    58.5    5e-07   Brassica rapa
gb|ACJ83347.1|  unknown                                               57.0    6e-07   Medicago truncatula
gb|AAM15902.1|AF492585_1  GIA/RGA-like gibberellin response modul...  55.5    7e-07   Dubautia arborea
ref|XP_008782281.1|  PREDICTED: DELLA protein SLR1-like               57.8    9e-07   Phoenix dactylifera
ref|XP_006400289.1|  hypothetical protein EUTSA_v100155350mg          53.9    1e-06   
gb|ADH53780.1|  GAI1                                                  57.8    1e-06   Malus domestica [apple tree]
gb|ADH53779.1|  GAI1                                                  57.8    1e-06   Malus domestica [apple tree]
ref|XP_002887024.1|  hypothetical protein ARALYDRAFT_475738           57.0    2e-06   
ref|NP_176809.1|  DELLA protein RGL1                                  56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302161.1|  hypothetical protein CARUB_v10020171mg           56.2    2e-06   Capsella rubella
gb|ADH53781.1|  GAI2                                                  56.2    3e-06   Malus baccata var. xiaojinensis
gb|AIW50513.1|  dwarf 8 protein                                       55.8    3e-06   Andropterum stolzii
gb|AFJ42394.1|  DELLA protein DWARF8                                  55.8    3e-06   Andropterum stolzii
gb|AAM15894.1|AF492577_1  GIA/RGA-like gibberellin response modul...  53.1    4e-06   Calycadenia multiglandulosa
emb|CAA12242.1|  RGA-like                                             55.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM15896.1|AF492579_1  GIA/RGA-like gibberellin response modul...  55.5    4e-06   Anisocarpus madioides
ref|XP_006391387.1|  hypothetical protein EUTSA_v10018436mg           55.8    4e-06   Eutrema salsugineum [saltwater cress]
gb|AAM15885.1|  GIA/RGA-like gibberellin response modulator           55.5    5e-06   Dubautia raillardioides
gb|AAM15906.1|AF492589_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia raillardioides
gb|AAM15898.1|AF492581_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15888.1|AF492570_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium kauense
gb|AAM15886.1|AF492568_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Wilkesia gymnoxiphium
gb|AAM15899.1|AF492582_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15891.1|AF492573_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Madia sativa [coast tarweed]
gb|AAM15889.1|AF492571_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15893.1|AF492576_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Carlquistia muirii
gb|AAM15903.1|AF492586_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia arborea
gb|AAM15890.1|AF492572_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15900.1|AF492583_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium kauense
gb|AAM15907.1|AF492590_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia microcephala
gb|AAM15881.1|AF492563_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia arborea
gb|AAM15880.1|AF492562_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia arborea
gb|AAM15901.1|AF492584_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Argyroxiphium kauense
gb|AAM15892.1|AF492575_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Carlquistia muirii
gb|AAM15883.1|AF492565_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia ciliolata subsp. glutinosa
gb|AAM15882.1|AF492564_1  GIA/RGA-like gibberellin response modul...  55.5    5e-06   Dubautia ciliolata subsp. glutinosa
gb|AAM15884.1|AF492566_1  GIA/RGA-like gibberellin response modul...  55.5    6e-06   Dubautia menziesii
gb|AAM15904.1|AF492587_1  GIA/RGA-like gibberellin response modul...  55.5    6e-06   Dubautia knudsenii
gb|AIW50530.1|  dwarf 8 protein                                       55.1    6e-06   
gb|AIW50531.1|  dwarf 8 protein                                       54.7    7e-06   
gb|KFK38060.1|  hypothetical protein AALP_AA3G064800                  54.3    1e-05   
gb|AIW50644.1|  dwarf 8 protein                                       53.9    1e-05   
gb|AFD62413.1|  reduced height-2                                      54.3    1e-05   
gb|AGA16543.1|  DELLA protein RGL2                                    53.9    2e-05   
gb|AIW50630.1|  dwarf 8 protein                                       53.5    2e-05   
gb|AIW50627.1|  dwarf 8 protein                                       53.5    2e-05   
gb|AIW50626.1|  dwarf 8 protein                                       53.5    2e-05   
gb|AIW50502.1|  dwarf 8 protein                                       53.5    2e-05   
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg           53.9    2e-05   
gb|AIW50643.1|  dwarf 8 protein                                       53.5    2e-05   
gb|AIW50653.1|  dwarf 8 protein                                       53.5    2e-05   
gb|AFD62384.1|  reduced height-1                                      53.5    2e-05   
gb|AFD62419.1|  reduced height-2                                      53.5    2e-05   
gb|AFD62396.1|  reduced height-2                                      53.5    2e-05   
gb|AFD62376.1|  reduced height-1                                      53.5    2e-05   
gb|AFD62391.1|  reduced height-2                                      53.5    2e-05   
gb|AFD62385.1|  reduced height-1                                      53.5    2e-05   
gb|AFD62360.1|  reduced height-1                                      53.5    2e-05   
gb|KFK41051.1|  hypothetical protein AALP_AA2G079000                  53.5    2e-05   
gb|AFD62369.1|  reduced height-1                                      53.5    2e-05   
gb|EPS67815.1|  hypothetical protein M569_06957                       53.5    2e-05   
ref|XP_002873832.1|  hypothetical protein ARALYDRAFT_488615           52.8    3e-05   
ref|XP_009127484.1|  PREDICTED: DELLA protein RGL1                    52.8    3e-05   
emb|CDY70426.1|  BnaCnng68300D                                        52.8    3e-05   
emb|CDY55037.1|  BnaCnng28010D                                        52.8    3e-05   
emb|CDY43122.1|  BnaA05g32640D                                        52.8    4e-05   
emb|CDY50707.1|  BnaC05g47760D                                        52.4    4e-05   
gb|AAM15905.1|AF492588_1  GIA/RGA-like gibberellin response modul...  52.8    4e-05   
gb|AAM15895.1|AF492578_1  GIA/RGA-like gibberellin response modul...  52.4    5e-05   
gb|AIW50634.1|  dwarf 8 protein                                       52.4    5e-05   
gb|AIW50594.1|  dwarf 8 protein                                       52.0    5e-05   
gb|AIW50593.1|  dwarf 8 protein                                       52.0    5e-05   
ref|NP_197251.1|  DELLA protein RGL3                                  52.4    6e-05   
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  52.4    6e-05   
gb|AIW50676.1|  dwarf 8 protein                                       52.0    6e-05   
gb|AIW50697.1|  dwarf 8 protein                                       52.0    6e-05   
gb|AGQ04489.1|  slender rice 1                                        48.9    6e-05   
gb|AIW50677.1|  dwarf 8 protein                                       52.0    6e-05   
gb|AIW50615.1|  dwarf 8 protein                                       52.0    6e-05   
ref|XP_009413642.1|  PREDICTED: DELLA protein SLR1-like               52.0    6e-05   
gb|AIW50695.1|  dwarf 8 protein                                       52.0    7e-05   
gb|AIW50614.1|  dwarf 8 protein                                       52.0    7e-05   
gb|AIW50696.1|  dwarf 8 protein                                       52.0    7e-05   
gb|AIW50608.1|  dwarf 8 protein                                       51.6    7e-05   
gb|AIW50605.1|  dwarf 8 protein                                       51.6    7e-05   
gb|AGQ04486.1|  slender rice 1                                        48.5    7e-05   
sp|Q8W127.1|SLN1_HORVU  RecName: Full=DELLA protein SLN1; AltName...  52.0    7e-05   
gb|AIW50533.1|  dwarf 8 protein                                       51.6    8e-05   
gb|AGQ04494.1|  slender rice 1                                        48.5    8e-05   
gb|AIW50560.1|  dwarf 8 protein                                       50.8    8e-05   
gb|AIW50629.1|  dwarf 8 protein                                       51.6    9e-05   
gb|AIW50631.1|  dwarf 8 protein                                       51.2    9e-05   
gb|AIW50633.1|  dwarf 8 protein                                       51.2    9e-05   
gb|AIW50656.1|  dwarf 8 protein                                       51.2    9e-05   
gb|AIW50532.1|  dwarf 8 protein                                       51.2    1e-04   
ref|XP_009409625.1|  PREDICTED: DELLA protein SLR1-like               51.6    1e-04   
gb|AIW50632.1|  dwarf 8 protein                                       51.2    1e-04   
gb|AHW42470.1|  RGA                                                   51.2    1e-04   
gb|AIW50540.1|  dwarf 8 protein                                       50.4    1e-04   
gb|AIW50481.1|  dwarf 8 protein                                       50.8    1e-04   
emb|CDY16422.1|  BnaA02g12260D                                        49.3    1e-04   
gb|AIW50581.1|  dwarf 8 protein                                       50.8    1e-04   
gb|AIW50499.1|  dwarf 8 protein                                       50.8    2e-04   
emb|CDY16915.1|  BnaC09g40420D                                        50.8    2e-04   
emb|CDY38434.1|  BnaA10g17240D                                        50.8    2e-04   
ref|XP_009107522.1|  PREDICTED: DELLA protein RGL3                    50.8    2e-04   
gb|AIW50541.1|  dwarf 8 protein                                       50.1    2e-04   
gb|AIW50554.1|  dwarf 8 protein                                       49.7    2e-04   
gb|AIW50543.1|  dwarf 8 protein                                       50.1    2e-04   
gb|AJN00621.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50534.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50658.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50657.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50559.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50510.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50566.1|  dwarf 8 protein                                       50.4    2e-04   
gb|AIW50587.1|  dwarf 8 protein                                       50.4    2e-04   
gb|ABI84226.1|  dwarf plant9                                          50.4    2e-04   
gb|AIW50700.1|  dwarf 8 protein                                       50.1    2e-04   
gb|AIW50583.1|  dwarf 8 protein                                       49.7    2e-04   
ref|XP_004982031.1|  PREDICTED: DELLA protein DWARF8-like             50.4    2e-04   
ref|XP_008644580.1|  PREDICTED: DELLA protein DWARF8-like             50.4    2e-04   
gb|AIW50573.1|  dwarf 8 protein                                       50.1    2e-04   
gb|AIW50571.1|  dwarf 8 protein                                       50.1    2e-04   
gb|AIW50488.1|  dwarf 8 protein                                       50.1    2e-04   
gb|AIW50547.1|  dwarf 8 protein                                       50.1    2e-04   
ref|XP_006289966.1|  hypothetical protein CARUB_v10003592mg           50.4    2e-04   
gb|AIW50472.1|  dwarf 8 protein                                       50.1    3e-04   
gb|EEE59780.1|  hypothetical protein OsJ_12286                        50.4    3e-04   
gb|AIW50584.1|  dwarf 8 protein                                       49.7    3e-04   
ref|NP_001051032.1|  Os03g0707600                                     50.1    3e-04   
gb|AGG68489.1|  mutant DELLA protein                                  50.1    3e-04   
gb|AJN00613.1|  dwarf 8 protein                                       50.1    3e-04   
gb|EAY91579.1|  hypothetical protein OsI_13213                        50.1    3e-04   
gb|AAX07462.1|  gibberellic acid-insensitive                          50.1    3e-04   
gb|AJN00620.1|  dwarf 8 protein                                       49.7    3e-04   
ref|XP_003560731.1|  PREDICTED: DELLA protein SLN1                    50.1    3e-04   
gb|AIW50638.1|  dwarf 8 protein                                       49.7    3e-04   
gb|ACY74341.1|  putative DELLA protein                                50.1    3e-04   
gb|AIW50639.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50476.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50511.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50493.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50509.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50504.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50512.1|  dwarf 8 protein                                       49.7    3e-04   
ref|XP_008457015.1|  PREDICTED: DELLA protein GAI-like                50.1    3e-04   
gb|AIW50681.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50503.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AJN00619.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50494.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50665.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50664.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50495.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50706.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50655.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50482.1|  dwarf 8 protein                                       49.7    3e-04   
ref|XP_002884379.1|  hypothetical protein ARALYDRAFT_477591           50.1    3e-04   
gb|AIW50682.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AIW50507.1|  dwarf 8 protein                                       49.7    3e-04   
gb|AJN00624.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00609.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50654.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00607.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00634.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00622.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00616.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50705.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50508.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00632.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00628.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00626.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50609.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50464.1|  dwarf 8 protein                                       49.7    4e-04   
ref|XP_010492705.1|  PREDICTED: DELLA protein RGL3-like               49.7    4e-04   
gb|AIW50555.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50475.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00618.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00633.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00612.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50678.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50702.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50473.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AIW50537.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00635.1|  dwarf 8 protein                                       49.7    4e-04   
gb|AJN00611.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50651.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50652.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50621.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50620.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50539.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50501.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AFJ42397.1|  DELLA protein DWARF8                                  49.3    4e-04   
gb|AIW50474.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50636.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50557.1|  dwarf 8 protein                                       49.3    4e-04   
gb|AIW50628.1|  dwarf 8 protein                                       49.3    4e-04   
ref|XP_010420475.1|  PREDICTED: DELLA protein RGL3                    49.7    5e-04   
ref|XP_010453948.1|  PREDICTED: DELLA protein RGL3-like               49.7    5e-04   
gb|AIW50477.1|  dwarf 8 protein                                       49.3    5e-04   
emb|CBW30292.1|  RHT-D1 protein                                       49.3    5e-04   
ref|XP_002960248.1|  GRAS-family protein                              49.3    5e-04   
gb|AJN00625.1|  dwarf 8 protein                                       48.9    6e-04   
gb|ACC93927.1|  DELLA                                                 48.1    6e-04   
gb|AIW50641.1|  dwarf 8 protein                                       48.9    6e-04   
ref|XP_006650473.1|  PREDICTED: DELLA protein SLR1-like               49.3    6e-04   
gb|AIW50592.1|  dwarf 8 protein                                       48.9    6e-04   
gb|AFJ42395.1|  DELLA protein DWARF8                                  48.9    6e-04   
gb|AIW50561.1|  dwarf 8 protein                                       48.9    7e-04   
gb|AIW50506.1|  dwarf 8 protein                                       48.9    7e-04   
gb|AIW50469.1|  dwarf 8 protein                                       48.9    7e-04   
ref|XP_009380281.1|  PREDICTED: DELLA protein SLN1-like               48.9    7e-04   
gb|ACC93914.1|  DELLA                                                 47.8    7e-04   
gb|ACC93921.1|  DELLA                                                 48.1    7e-04   
gb|ACC93913.1|  DELLA                                                 47.8    7e-04   
gb|ACI43412.1|  DWARF8 protein                                        45.8    8e-04   
gb|AIW50490.1|  dwarf 8 protein                                       48.5    8e-04   
gb|ACC93912.1|  DELLA                                                 47.8    8e-04   
gb|ACI43411.1|  DWARF8 protein                                        45.8    8e-04   
gb|AIW50489.1|  dwarf 8 protein                                       48.5    9e-04   
gb|AIW50552.1|  dwarf 8 protein                                       48.5    9e-04   
ref|XP_004145854.1|  PREDICTED: DELLA protein GAI-like                48.5    9e-04   
gb|AIW50623.1|  dwarf 8 protein                                       48.5    9e-04   
gb|AJN00623.1|  dwarf 8 protein                                       48.5    9e-04   
gb|AIW50622.1|  dwarf 8 protein                                       48.5    9e-04   
gb|AJN00631.1|  dwarf 8 protein                                       48.5    0.001   
gb|AJN00608.1|  dwarf 8 protein                                       48.5    0.001   
emb|CCG14222.1|  gibberellin DELLA protein                            48.5    0.001   
gb|AIW50517.1|  dwarf 8 protein                                       48.5    0.001   
gb|AIW50642.1|  dwarf 8 protein                                       48.5    0.001   
gb|AIW50483.1|  dwarf 8 protein                                       48.1    0.001   
gb|AIW50701.1|  dwarf 8 protein                                       48.5    0.001   
gb|AIW50671.1|  dwarf 8 protein                                       48.5    0.001   
gb|AIW50625.1|  dwarf 8 protein                                       48.5    0.001   
gb|AIW50516.1|  dwarf 8 protein                                       48.5    0.001   



>ref|XP_008221422.1| PREDICTED: DELLA protein GAIP-B [Prunus mume]
Length=633

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = +2

Query  371  KKMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             KMWEE  Q  D GMDELLAVLGYKV++SDMAEVA KLEQLEE MGSVQ D LS LA
Sbjct  32   NKMWEEDAQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGSVQEDGLSQLA  88



>ref|XP_004298516.1| PREDICTED: DELLA protein GAIP [Fragaria vesca subsp. vesca]
Length=611

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MWEES+ D GMDELLAVLGYKVK+S MA+VA K+EQLEE MG+VQ D LS LA
Sbjct  31   MWEESQHDDGMDELLAVLGYKVKSSSMADVAQKIEQLEEFMGTVQQDGLSHLA  83



>ref|XP_010681882.1| PREDICTED: DELLA protein GAI-like [Beta vulgaris subsp. vulgaris]
Length=609

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q DAG+DELLAVLGYKV++SDMAEVA KLEQLEE MG+V+GD L  LA
Sbjct  27   KMWEDGAQNDAGVDELLAVLGYKVRSSDMAEVANKLEQLEEYMGNVRGDGLCQLA  81



>gb|AGK07287.1| GAI1 [Rosa hybrid cultivar]
Length=618

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            +WE+S++D GMDELLAVLGYKVK+S+MA+VA KLEQLEE MG+VQ D LS LA
Sbjct  31   IWEDSQRDDGMDELLAVLGYKVKSSNMADVAQKLEQLEEFMGTVQEDGLSQLA  83



>ref|XP_007045197.1| GRAS family transcription factor family protein [Theobroma cacao]
 gb|EOY01029.1| GRAS family transcription factor family protein [Theobroma cacao]
Length=615

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW++  ++QD GMDELLAVLGYKVK SDMAEVA KLEQLEEVM +VQ D +S LA
Sbjct  32   KMWQDEVAQQDCGMDELLAVLGYKVKTSDMAEVAQKLEQLEEVMCNVQDDGISHLA  87



>gb|ACR58455.1| GAI/RGA protein [Gossypium hirsutum]
Length=616

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+W+E  ++QD GMDELLAVLGYKVK SDMAEVA KLEQLEEVM +VQ D +S LA
Sbjct  27   KVWDEESAQQDCGMDELLAVLGYKVKTSDMAEVARKLEQLEEVMCNVQDDGISHLA  82



>gb|ABG26370.1| DELLA protein GAI [Gossypium barbadense]
Length=616

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+W+E  ++QD GMDELLAVLGYKVK SDMAEVA KLEQLEEVM +VQ D +S LA
Sbjct  27   KVWDEESAQQDCGMDELLAVLGYKVKTSDMAEVAQKLEQLEEVMCNVQDDGISHLA  82



>gb|KJB15415.1| hypothetical protein B456_002G177000 [Gossypium raimondii]
Length=617

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+W+E  ++QD GMDELLAVLGYKVK SDMAEVA KLEQLEEVM +VQ D +S LA
Sbjct  27   KVWDEEAAQQDCGMDELLAVLGYKVKTSDMAEVAQKLEQLEEVMCNVQDDGISHLA  82



>ref|XP_002527794.1| DELLA protein GAIP-B, putative [Ricinus communis]
 gb|EEF34604.1| DELLA protein GAIP-B, putative [Ricinus communis]
Length=609

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ E   D GMDELLAVLGYKV++SDMAEVA KLEQLEEVMG+VQ D L  LA
Sbjct  43   KIWEDEEAKGDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGNVQEDGLCQLA  98



>ref|XP_002312450.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
 gb|EEE89817.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
Length=600

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESE---QDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE E    D GMDELLAVLGYKV++SDMAEVA KLEQLEEVMG  Q D LS LA
Sbjct  39   KIWEEGEGHQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGHAQEDGLSHLA  95



>ref|XP_006469195.1| PREDICTED: DELLA protein GAIP-B-like [Citrus sinensis]
Length=594

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE + D GMDELLAVLGY V++SDM EVA K+EQLEE MG+ Q D ++ LA
Sbjct  29   KMWEEEQTDGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAFQADGINHLA  82



>ref|XP_006448223.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
 gb|ESR61463.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
Length=594

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE + D GMDELLAVLGY V++SDM EVA K+EQLEE MG+ Q D ++ LA
Sbjct  29   KMWEEEQTDGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAFQADGINHLA  82



>ref|XP_010264458.1| PREDICTED: DELLA protein GAI1 [Nelumbo nucifera]
Length=610

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E+EQ DAG+DELLAVLGYKV++SDMAEVA KLEQL+ VMGS Q D L+ LA
Sbjct  24   KMWDEAEQQDAGVDELLAVLGYKVRSSDMAEVAQKLEQLDIVMGSAQEDGLNHLA  78



>gb|ACL68360.1| DELLA protein [Malus domestica]
Length=636

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q  D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  38   KMWEDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  93



>gb|AAY56751.1| DELLA protein [Malus domestica]
Length=639

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q  D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  38   KMWEDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  93



>gb|ADH53778.1| GAI2 [Malus domestica]
Length=636

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q  D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  38   KMWEDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  93



>ref|XP_011070609.1| PREDICTED: DELLA protein GAI1 [Sesamum indicum]
Length=569

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW    ++AG+DEL AVLGY VK+SDMAEVA K++QLEEVMGSVQ D LS LA
Sbjct  24   KMWSCEAEEAGVDELFAVLGYNVKSSDMAEVAQKIQQLEEVMGSVQHDGLSHLA  77



>emb|CBI26874.3| unnamed protein product [Vitis vinifera]
Length=408

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVA KLEQLEEV+ + Q D LS LA
Sbjct  31   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVIVNAQEDGLSHLA  85



>emb|CAN67929.1| hypothetical protein VITISV_007904 [Vitis vinifera]
Length=558

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVA KLEQLEEV+ + Q D LS LA
Sbjct  22   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVIVNAQEDGLSHLA  76



>ref|XP_002284648.1| PREDICTED: DELLA protein GAI1 [Vitis vinifera]
 sp|Q8S4W7.1|GAI1_VITVI RecName: Full=DELLA protein GAI1; AltName: Full=Gibberellic acid-insensitive 
mutant protein 1; AltName: Full=VvGAI1 [Vitis 
vinifera]
 gb|AAM19210.1|AF378125_1 GAI-like protein 1 [Vitis vinifera]
Length=590

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVA KLEQLEEV+ + Q D LS LA
Sbjct  22   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVIVNAQEDGLSHLA  76



>ref|XP_011038614.1| PREDICTED: DELLA protein GAIP [Populus euphratica]
Length=602

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEE---SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K WEE    + D GMDELLAVLGYKV++SDMAEVA KLEQLEEVMG  Q D LS LA
Sbjct  40   KTWEEEKGRQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGHAQEDGLSHLA  96



>ref|XP_002314799.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
 gb|EEF00970.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
Length=602

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEE---SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K WEE    + D GMDELLAVLGYKV++SDMAEVA KLEQLEEVMG  Q D LS LA
Sbjct  40   KTWEEEKGRQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGHAQEDGLSHLA  96



>gb|KDP38079.1| hypothetical protein JCGZ_04722 [Jatropha curcas]
Length=623

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE E++ D GMDELLAVLGYKV++SDMAEVA KLEQLEEVM +VQ D LS L+
Sbjct  41   KIWEDEAQGDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMCNVQEDGLSHLS  95



>gb|AFJ23219.1| DELLA protein [Pyrus betulifolia]
Length=634

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+     D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  91



>ref|XP_011023720.1| PREDICTED: DELLA protein GAIP-B-like [Populus euphratica]
Length=602

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESE---QDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+W E E    D GMDELLAVLGYKV++SDMAEVA KLEQLEEVMG  Q D LS LA
Sbjct  41   KIWAEGEGHQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGHAQEDGLSHLA  97



>ref|XP_009351505.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+     D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  91



>gb|AFJ23220.1| DELLA protein [Pyrus x bretschneideri]
Length=634

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+     D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  91



>gb|AEX97109.1| spur-type DELLA protein [Malus domestica]
Length=635

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q  D GMDELLAVLGYKV++SDMA+VA KLEQLEE MG  Q D LS LA
Sbjct  37   KMWEDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMGCAQEDGLSQLA  92



>gb|ADW85805.1| DELLA protein [Malus domestica]
Length=635

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q  D GMDELLAVLGYKV++SDMA+VA KLEQLEE MG  Q D LS LA
Sbjct  37   KMWEDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMGCAQEDGLSQLA  92



>gb|ACL68359.1| DELLA protein [Malus baccata var. xiaojinensis]
Length=636

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW++  Q  D GMDELLAVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  38   KMWKDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  93



>ref|XP_009789076.1| PREDICTED: DELLA protein GAI1-like [Nicotiana sylvestris]
Length=587

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 4/54 (7%)
 Frame = +2

Query  377  MWEESEQDAGMD-ELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MWEE   D G+D ELLAVLGYKVKASDMAEVA KLEQLEEVMGSV+ D+LS LA
Sbjct  35   MWEE---DGGVDDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVEQDNLSFLA  85



>gb|AFP58844.1| DELLA domain GRAS family transcription factor GAI [Populus tomentosa]
Length=603

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  380  WEE---SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            WEE    + D GMDELLAVLGYKV++SDMAEVA KLEQLEEVMG  Q D LS LA
Sbjct  42   WEEEKGRQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGHAQEDGLSHLA  96



>gb|AEK06229.1| GAI1 [Vitis vinifera]
Length=590

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVA +LEQLEEV+ + Q D LS LA
Sbjct  22   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQELEQLEEVIVNAQEDGLSHLA  76



>sp|Q6EI05.1|GAIPB_CUCMA RecName: Full=DELLA protein GAIP-B; AltName: Full=CmGAIP-B; Short=GAIP-B; 
AltName: Full=Gibberellic acid-insensitive phloem 
protein B [Cucurbita maxima]
 gb|AAQ96165.1| gibberellic acid insensitive phloem B [Cucurbita maxima]
Length=587

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE  Q D GMDELLAVLGYKVK+SDMAEVA KLEQLEE M  VQ   LS LA
Sbjct  33   KLWEEDAQLDGGMDELLAVLGYKVKSSDMAEVAQKLEQLEEAMCQVQDTGLSHLA  87



>gb|ABL61270.1| GAI1 [Malus hupehensis]
Length=638

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW++  Q  D GMDELLAVLGYKV++SDMA+VA KLEQLEE MG  Q D LS LA
Sbjct  37   KMWDDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMGCAQEDGLSQLA  92



>sp|Q6EI06.1|GAIP_CUCMA RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP; Short=GAIP; 
AltName: Full=Gibberellic acid-insensitive phloem protein 
[Cucurbita maxima]
 gb|AAQ96164.1| gibberellic acid insensitive phloem [Cucurbita maxima]
Length=579

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE  Q D GMDELLAVLGYKVK+SDMAEVA KLEQLEE M  VQ   LS LA
Sbjct  33   KLWEEEVQLDGGMDELLAVLGYKVKSSDMAEVAQKLEQLEEAMCQVQDTGLSHLA  87



>ref|XP_010274729.1| PREDICTED: DELLA protein GAI1-like [Nelumbo nucifera]
Length=602

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E EQ DAG+DELLAVLGYKV++S+MAEVA KLEQL+ V+GS Q D LS LA
Sbjct  28   KMWDELEQQDAGVDELLAVLGYKVRSSEMAEVAQKLEQLDMVLGSAQEDGLSHLA  82



>ref|XP_009603475.1| PREDICTED: DELLA protein GAI1-like [Nicotiana tomentosiformis]
Length=563

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 4/55 (7%)
 Frame = +2

Query  374  KMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             MWEE   D G+D ELLAVLGYKVKASDMAEVA KLEQLE+VMGSV+ D+LS LA
Sbjct  31   NMWEE---DGGVDDELLAVLGYKVKASDMAEVAQKLEQLEKVMGSVEQDNLSFLA  82



>gb|AAY56752.1| DELLA protein [Malus domestica]
Length=635

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+  Q  D GMDELLAVLGYKV++SDMA+VA KLEQLEE M   Q D LS LA
Sbjct  37   KMWEDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMSCAQEDGLSQLA  92



>ref|XP_004150593.1| PREDICTED: DELLA protein GAIP-B-like [Cucumis sativus]
 emb|CBX88046.1| gibberellin DELLA protein, partial [Cucumis sativus]
 gb|KGN51488.1| DELLA protein GAIP-B [Cucumis sativus]
Length=586

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE  Q D GMDELLAVLGYKVK+SDMA+VA KLEQLEE M  VQ   LS LA
Sbjct  33   KLWEEEAQLDGGMDELLAVLGYKVKSSDMADVAQKLEQLEEAMCQVQDTGLSHLA  87



>ref|XP_004166672.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B-like [Cucumis 
sativus]
Length=586

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE  Q D GMDELLAVLGYKVK+SDMA+VA KLEQLEE M  VQ   LS LA
Sbjct  33   KLWEEEAQLDGGMDELLAVLGYKVKSSDMADVAQKLEQLEEAMCQVQDTGLSHLA  87



>ref|XP_007033025.1| GRAS family transcription factor family protein [Theobroma cacao]
 gb|EOY03951.1| GRAS family transcription factor family protein [Theobroma cacao]
Length=655

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE ++  GMDELLAVLGYKV+ SDMA+VA KLEQLE VMG+ Q D +S L+
Sbjct  34   KLWEEEQEAGGMDELLAVLGYKVRYSDMADVAQKLEQLEMVMGTAQEDGISHLS  87



>ref|XP_008467128.1| PREDICTED: DELLA protein GAIP-B [Cucumis melo]
Length=586

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE  Q D GMDELLAVLGYKVK+SDMA+VA KLEQLEE M  VQ   LS LA
Sbjct  33   KLWEEEAQLDGGMDELLAVLGYKVKSSDMADVAQKLEQLEEAMCQVQDTGLSHLA  87



>ref|XP_006482132.1| PREDICTED: DELLA protein GAI-like [Citrus sinensis]
 gb|KDO50841.1| hypothetical protein CISIN_1g008153mg [Citrus sinensis]
Length=576

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE +   GMDELL VLGYKV++S+MA+VA KLEQLE VMG+ Q D +S LA
Sbjct  31   KMWEEEQDTGGMDELLEVLGYKVRSSEMADVAQKLEQLEMVMGTAQEDGISHLA  84



>gb|KDO64603.1| hypothetical protein CISIN_1g043131mg [Citrus sinensis]
Length=592

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE + D G MDELLAVLGY V++SDM EVA K+EQLEE MG+ Q D ++ LA
Sbjct  26   KMWEEEQTDGGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAFQADGINHLA  80



>ref|XP_006430617.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
 gb|ESR43857.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
Length=576

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE +   GMDELL VLGYKV++S+MA+VA KLEQLE VMG+ Q D +S LA
Sbjct  31   KMWEEEQDTEGMDELLEVLGYKVRSSEMADVAQKLEQLEMVMGTAQEDGISHLA  84



>gb|AEE69074.2| GAI-like protein [Juglans regia]
Length=613

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K  WE E + D GMDELLAVLGY+V++SDMAEVA KLE LE++MG+ QGD LS LA
Sbjct  31   KMCWEDEVQPDGGMDELLAVLGYQVRSSDMAEVAQKLELLEDLMGNAQGDGLSQLA  86



>ref|XP_009349514.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWE+     D GMDELLAVLGYKV +S+MAEVA KLEQLEE MG  Q D LS LA
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVWSSNMAEVAQKLEQLEEFMGCAQEDGLSQLA  91



>ref|XP_010109004.1| hypothetical protein L484_027201 [Morus notabilis]
 gb|EXC20644.1| hypothetical protein L484_027201 [Morus notabilis]
Length=584

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMW-EESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW +E EQ+AG MDELLAVLGYKV++SDMAEVA KLEQLE V+GS Q D +S L+
Sbjct  40   KMWTQEEEQEAGGMDELLAVLGYKVRSSDMAEVAQKLEQLEMVLGSAQEDGISQLS  95



>ref|XP_007163387.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
 gb|ESW35381.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
Length=596

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE   +Q  GMDELLA LGYKV+ASDMA+VA KLEQLE VMGS Q + +S L+
Sbjct  27   KMWEEDRHQQGGGMDELLAALGYKVRASDMADVAQKLEQLEMVMGSAQEEGISHLS  82



>dbj|BAF62637.1| DELLA protein [Phaseolus vulgaris]
Length=596

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE   +Q  GMDELLA LGYKV+ASDMA+VA KLEQLE VMGS Q + +S L+
Sbjct  27   KMWEEDRHQQGGGMDELLAALGYKVRASDMADVAQKLEQLEMVMGSAQEEGISHLS  82



>ref|XP_002266267.1| PREDICTED: DELLA protein GAI-like [Vitis vinifera]
Length=613

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW++ +Q DAGMDELLAVLGY V++SDM +VA KLEQLE VMG+ Q D +S L+
Sbjct  33   KMWDDGQQQDAGMDELLAVLGYNVRSSDMVDVAQKLEQLEMVMGNAQEDGISHLS  87



>ref|XP_010554410.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KM +E +   GMDELLAVLGYKV++S+MA+VA KLEQLEE+MG+VQ D LS LA
Sbjct  28   KMVKEEDDGGGMDELLAVLGYKVRSSEMADVAQKLEQLEEMMGNVQEDGLSHLA  81



>ref|XP_010553798.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=611

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E+D GMDELLAVLGYKVK+S+MAEVA KLEQLEE+MG  Q D LS  A
Sbjct  31   EEDGGMDELLAVLGYKVKSSEMAEVAQKLEQLEEMMGHFQEDGLSHFA  78



>gb|AFC88481.1| DELLA protein [Rosa lucieae]
Length=562

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE ++   MDELLAVLGYKV++ DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  27   KIWEEEQESGSMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGSAQQDGISQLS  80



>gb|AFC88482.1| DELLA protein [Rosa lucieae]
Length=564

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE ++   MDELLAVLGYKV++ DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  27   KIWEEEQESGSMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGSAQQDGISQLS  80



>emb|CDP11067.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSL  532
            KMW + E D   DELLAVLGYKVKASDMAEVA K+EQLEEV G+ + D LS L
Sbjct  72   KMWVD-ESDRQDDELLAVLGYKVKASDMAEVAQKIEQLEEVFGNAENDSLSHL  123



>ref|XP_006364643.1| PREDICTED: DELLA protein GAI-like [Solanum tuberosum]
Length=588

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VA KLEQLE  MG+   D ++ L+
Sbjct  28   KIWEEDEEETPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGTTMEDGITHLS  84



>ref|NP_001234365.1| DELLA protein GAI [Solanum lycopersicum]
 sp|Q7Y1B6.1|GAI_SOLLC RecName: Full=DELLA protein GAI; AltName: Full=Gibberellic acid-insensitive 
mutant protein [Solanum lycopersicum]
 gb|AAP22369.1| GAI-like protein [Solanum lycopersicum]
Length=588

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VA KLEQLE  MG+   D ++ L+
Sbjct  27   KIWEEDEEEKPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGTTMEDGITHLS  83



>gb|AEI25530.1| gibberellic acid insensitive protein [Solanum tuberosum]
Length=588

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VA KLEQLE  MG+   D ++ L+
Sbjct  28   KIWEEDEEETPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGTTMEDGITHLS  84



>ref|XP_007214956.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
 gb|EMJ16155.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
Length=593

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = +2

Query  374  KMWEESEQDA-----GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +QD      GMDELLAVLGYKV+ASDMAEVA KLEQLE VMGS Q D +S L+
Sbjct  32   KIWEQ-DQDGCGGSGGMDELLAVLGYKVRASDMAEVAEKLEQLEMVMGSAQEDGISQLS  89



>gb|AFA35960.1| ELLA domain GRAS family transcription factor [Nicotiana attenuata]
Length=561

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K++EE + DAGMDELLAVLGYKVK+SDMAEVA KLEQLE  M +   D +S L+
Sbjct  20   KIYEEEQPDAGMDELLAVLGYKVKSSDMAEVAKKLEQLEMAMCTTLEDGISHLS  73



>ref|XP_009796771.1| PREDICTED: DELLA protein GAI-like [Nicotiana sylvestris]
Length=568

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K++EE + DAGMDELLAVLGYKVK+SDMAEVA KLEQLE  M +   D +S L+
Sbjct  20   KIFEEEQPDAGMDELLAVLGYKVKSSDMAEVAQKLEQLEMAMCTTLEDGISHLS  73



>pdb|2ZSH|B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition 
By The Gibberellin Receptor
 pdb|2ZSI|B Chain B, Structural Basis Of Gibberellin(Ga4)-Induced Della Recognition 
By The Gibberellin Receptor
Length=110

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M  E +   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ DDLS LA
Sbjct  14   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLA  66



>ref|XP_011097451.1| PREDICTED: DELLA protein GAI-like [Sesamum indicum]
Length=565

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MW E + DAGMDEL AVLGYKVK+SDMA+VA KLEQLE  MGS   D  S L+
Sbjct  21   MWAEQQPDAGMDELFAVLGYKVKSSDMADVAEKLEQLEMAMGSTAEDGSSVLS  73



>emb|CAN59753.1| hypothetical protein VITISV_036639 [Vitis vinifera]
Length=580

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  377  MWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MW++ +Q DAGMDELLAVLGY V++SDM +VA KLEQLE VMG+ Q D +S L+
Sbjct  1    MWDDGQQQDAGMDELLAVLGYNVRSSDMVDVAQKLEQLEMVMGNAQEDGISHLS  54



>ref|XP_010032696.1| PREDICTED: DELLA protein GAI [Eucalyptus grandis]
 gb|KCW52149.1| hypothetical protein EUGRSUZ_J01594 [Eucalyptus grandis]
Length=628

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +2

Query  377  MWEESEQDAG------MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MW E +QD        MDELLAVLGYKV++SDMAEVA KLEQLE VMGS Q D +S L+
Sbjct  48   MWGEDDQDPSGGGGGGMDELLAVLGYKVRSSDMAEVAQKLEQLEMVMGSAQEDGISHLS  106



>dbj|BAM14051.1| DELLA 1 sprice variant [Lactuca sativa]
Length=353

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E  EQDAG+DELLAVLGYKVK+SDMA+VA K+E LE V+G+   D LS LA
Sbjct  41   KMWDEVEEQDAGVDELLAVLGYKVKSSDMADVAQKIEHLEGVLGN--DDGLSQLA  93



>ref|XP_010502135.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=615

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M +E E  A MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS LA
Sbjct  36   MVKEEEDGANMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSQLA  88



>gb|ABO61516.1| GAI1 [Glycine max]
Length=523

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 4/54 (7%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             +WEE   + GMDELLAV+GYKV++SDMAEVA KLE+LEE MG+VQ DDL+ L+
Sbjct  25   NLWEE---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGNVQ-DDLTDLS  74



>ref|NP_001240948.1| DELLA protein GAI 1 [Glycine max]
 gb|ACA24488.1| gibberellin insensitive-like protein [Glycine max]
Length=523

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 4/54 (7%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             +WEE   + GMDELLAV+GYKV++SDMAEVA KLE+LEE MG+VQ DDL+ L+
Sbjct  25   NLWEE---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGNVQ-DDLTDLS  74



>gb|KHN07547.1| DELLA protein GAI1 [Glycine soja]
Length=145

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQDA--GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             MWEE +Q    GMDELLA LGYKV+ASDMA+VA KLEQLE VMG  Q + +S LA
Sbjct  8    NMWEEQQQQQQQGMDELLAALGYKVRASDMADVAQKLEQLEMVMGCAQEEGISHLA  63



>ref|XP_009594460.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=567

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K++EE + DAGMDELLAVLGYKVK+SD+AEVA +LEQLE  M ++  D +S L+
Sbjct  20   KIFEEEQPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCTILEDGISHLS  73



>ref|XP_009114228.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein RGA2-like [Brassica 
rapa]
Length=569

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  31   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  86



>gb|ADD71137.1| DELLA protein [Brassica napus]
Length=579

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  31   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  86



>sp|Q5BN22.1|RGA2_BRACM RecName: Full=DELLA protein RGA2; AltName: Full=BrRGA2; AltName: 
Full=RGA-like protein 2 [Brassica rapa]
 gb|AAX33298.1| DELLA protein [Brassica rapa]
Length=579

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  31   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  86



>dbj|BAG16380.1| GRAS family transcription factor [Brassica rapa var. perviridis]
Length=570

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  22   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  77



>emb|CDY04092.1| BnaA09g18700D [Brassica napus]
Length=534

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  31   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  86



>gb|KHN17945.1| DELLA protein GAI1 [Glycine soja]
Length=288

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 10/64 (16%)
 Frame = +2

Query  374  KMWEE----------SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDL  523
            KMWEE           +Q  GMDELLA LGYKV+ASDMA+VA KLEQLE VMG  Q D +
Sbjct  8    KMWEEEQQQQQQQQQQQQQQGMDELLAALGYKVRASDMADVAQKLEQLEMVMGCAQEDGI  67

Query  524  SSLA  535
            S LA
Sbjct  68   SHLA  71



>dbj|BAG71200.1| DELLA 1 [Lactuca sativa]
Length=569

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E  EQDAG+DELLAVLGYKVK+SDMA+VA K+E LE V+G+   D LS LA
Sbjct  41   KMWDEVEEQDAGVDELLAVLGYKVKSSDMADVAQKIEHLEGVLGN--DDGLSQLA  93



>ref|XP_006395878.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
 dbj|BAJ33650.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33164.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
Length=616

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS LA
Sbjct  42   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSHLA  97



>ref|XP_006826893.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
 gb|ERM94130.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
Length=556

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  386  ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            +  QDAG+DELLA LGY V+ASDMAEVA KLEQLE VMG+ Q D +S LA
Sbjct  23   QEPQDAGVDELLASLGYNVRASDMAEVAQKLEQLEMVMGTAQEDGISHLA  72



>emb|CDY64837.1| BnaC09g52270D [Brassica napus]
Length=542

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  31   KMMKVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  86



>ref|XP_010513881.1| PREDICTED: DELLA protein RGA isoform X1 [Camelina sativa]
 ref|XP_010513882.1| PREDICTED: DELLA protein RGA isoform X2 [Camelina sativa]
Length=611

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS LA
Sbjct  29   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSQLA  84



>dbj|BAG16374.1| GRAS family transcription factor [Brassica oleracea var. italica]
Length=569

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS+LA
Sbjct  31   KMMKVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSNLA  86



>ref|XP_010476569.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=533

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQDA--GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KM EE E D   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ  DLS LA
Sbjct  11   KMKEEEEDDCNNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQDHDLSHLA  66



>gb|AHB17742.1| GA repressor DELLA [Actinidia deliciosa]
Length=551

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE++     DELLAVLGY VKASDM EVA KLE LEEVMG  Q D L+ LA
Sbjct  29   KMWEEND-----DELLAVLGYNVKASDMNEVAQKLEHLEEVMGQAQEDGLTHLA  77



>gb|ABI34432.1| CRY [Pisum sativum]
Length=532

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E D GMDELLAV+GYKVK+SDMAEVA KLEQLE+ MG+ Q  D +++A
Sbjct  23   EDDGGMDELLAVVGYKVKSSDMAEVAQKLEQLEQAMGNFQDQDEATIA  70



>gb|AHB17743.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE++     DELLAVLGY VKASDM EVA KLE LEEVMG  Q D L+ LA
Sbjct  29   KMWEEND-----DELLAVLGYNVKASDMNEVAQKLEHLEEVMGQAQEDGLTHLA  77



>ref|XP_003531153.1| PREDICTED: DELLA protein GAI1-like [Glycine max]
Length=517

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 4/54 (7%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             +WEE   + GMDELLAV+GYKV++SDMAEVA KLE+LEE MG+VQ DDL  ++
Sbjct  25   NLWEE---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGNVQ-DDLPEIS  74



>ref|XP_006292324.1| hypothetical protein CARUB_v10018534mg [Capsella rubella]
 gb|EOA25222.1| hypothetical protein CARUB_v10018534mg [Capsella rubella]
Length=648

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS LA
Sbjct  34   MVKEEEDGNNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSHLA  86



>ref|XP_004503135.1| PREDICTED: DELLA protein GAI-like [Cicer arietinum]
Length=622

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMW-EESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             MW EE E   GMDE LA LGYKV++SDMA+VA KLEQLE VMG  Q D ++ L+
Sbjct  49   NMWREEKENSGGMDEFLAALGYKVRSSDMADVAQKLEQLEMVMGCAQEDGINHLS  103



>gb|KJB08563.1| hypothetical protein B456_001G089400 [Gossypium raimondii]
Length=548

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  374  KMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSL  532
            K+WEE     GMD ELLAVLGYKV++SDMA+VA KLE LE+VMG+ Q D +S L
Sbjct  24   KLWEEDPDAGGMDDELLAVLGYKVRSSDMADVAQKLEMLEKVMGTAQEDGISQL  77



>gb|ACM47244.1| putative gibberellin signaling DELLA protein [Sinningia speciosa]
Length=562

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 6/60 (10%)
 Frame = +2

Query  374  KMW----EESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD--LSSLA  535
            KMW    +  + D+G+DEL AVLGY VK+SDMA +A K+EQLEEVMGSVQ +D  LS LA
Sbjct  21   KMWCSEPDGQQNDSGVDELFAVLGYNVKSSDMASLAQKIEQLEEVMGSVQQEDGHLSQLA  80



>gb|AAY28970.1| GIA/RGA-like gibberellin response modulator [Gossypium hirsutum]
Length=548

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  374  KMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSL  532
            K+WEE     GMD ELLAVLGYKV++SDMA+VA KLE LE+VMG+ Q D +S L
Sbjct  24   KLWEEDPDAGGMDDELLAVLGYKVRSSDMADVAQKLEMLEKVMGTAQEDGISQL  77



>gb|EPS61323.1| hypothetical protein M569_13471, partial [Genlisea aurea]
Length=549

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  398  DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            D+G+DEL AVLGY V++SDMAEVA K++QLEE MG+VQ D LS LA
Sbjct  4    DSGVDELFAVLGYNVRSSDMAEVAQKIQQLEEAMGNVQRDGLSQLA  49



>sp|Q84TQ7.1|GAI_GOSHI RecName: Full=DELLA protein GAI; AltName: Full=GhGAI; AltName: 
Full=Gibberellic acid-insensitive mutant protein [Gossypium 
hirsutum]
 gb|AAO62757.1| GIA/RGA-like gibberellin response modulator [Gossypium hirsutum]
Length=537

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  374  KMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSL  532
            K+WEE     GMD ELLAVLGYKV++SDMA+VA KLE LE+VMG+ Q D +S L
Sbjct  24   KLWEEDPDAGGMDDELLAVLGYKVRSSDMADVAQKLEMLEKVMGTAQEDGISQL  77



>ref|XP_003538395.1| PREDICTED: DELLA protein GAI1 [Glycine max]
Length=595

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 10/64 (16%)
 Frame = +2

Query  374  KMWEE----------SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDL  523
            KMWEE           +Q  GMDELLA LGYKV+ASDMA+VA KLEQLE VMG  Q D +
Sbjct  33   KMWEEEQQQQQQQQQQQQQQGMDELLAALGYKVRASDMADVAQKLEQLEMVMGCAQEDGI  92

Query  524  SSLA  535
            S LA
Sbjct  93   SHLA  96



>ref|XP_003552980.1| PREDICTED: DELLA protein GAI-like [Glycine max]
 gb|ACJ61497.1| gibberellic acid-insensitive mutant protein [Glycine max]
Length=584

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  KMWEESEQDA-GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
             MWEE +Q   GMDELLA LGYKV+ASDMA+VA KLEQLE VMG  Q + +S LA
Sbjct  31   NMWEEQQQQQQGMDELLAALGYKVRASDMADVAQKLEQLEMVMGCAQEEGISHLA  85



>gb|EYU30084.1| hypothetical protein MIMGU_mgv1a027121mg [Erythranthe guttata]
Length=588

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 42/59 (71%), Gaps = 5/59 (8%)
 Frame = +2

Query  374  KMWEESEQDAG-----MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW     D G     +DEL AVLGY VK+SDMAEVA K+EQLEEVMGSV+ D LS LA
Sbjct  26   KMWPCDADDGGGGGGGVDELFAVLGYNVKSSDMAEVAHKIEQLEEVMGSVRQDGLSQLA  84



>ref|XP_004140302.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
Length=597

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 10/64 (16%)
 Frame = +2

Query  374  KMWEESEQD----------AGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDL  523
            KMW+  E+D           GMDELLAVLGYKV++SDMA+VA KLEQLE VMG+     +
Sbjct  33   KMWQPHEEDEGKDAKDGAAGGMDELLAVLGYKVRSSDMADVALKLEQLEMVMGTAYEHGI  92

Query  524  SSLA  535
            S LA
Sbjct  93   SHLA  96



>gb|EYU30908.1| hypothetical protein MIMGU_mgv1a024641mg [Erythranthe guttata]
Length=532

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD-LSSLA  535
            KMW  +E DAGMDELLAVLGYKVK+SDMA+VA KLEQLE  MG+   +D +SSL+
Sbjct  24   KMW--AEADAGMDELLAVLGYKVKSSDMADVAEKLEQLEVAMGTTAMEDGVSSLS  76



>gb|AEB36192.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>emb|CAA72178.1| RGA2 protein [Arabidopsis thaliana]
Length=532

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M  E +   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ DDLS LA
Sbjct  16   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLA  68



>emb|CAA75492.1| GAI [Arabidopsis thaliana]
Length=532

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M  E +   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ DDLS LA
Sbjct  16   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLA  68



>ref|NP_172945.1| DELLA protein GAI [Arabidopsis thaliana]
 sp|Q9LQT8.1|GAI_ARATH RecName: Full=DELLA protein GAI; AltName: Full=GRAS family protein 
3; Short=AtGRAS-3; AltName: Full=Gibberellic acid-insensitive 
mutant protein; AltName: Full=Restoration of growth 
on ammonia protein 2 [Arabidopsis thaliana]
 gb|AAF79228.1|AC006917_13 F10B6.34 [Arabidopsis thaliana]
 gb|AAL25607.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AAM98266.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AEE29242.1| DELLA protein GAI [Arabidopsis thaliana]
Length=533

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M  E +   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ DDLS LA
Sbjct  17   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLA  69



>ref|XP_004155733.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
 emb|CCG14221.1| gibberellin DELLA protein [Cucumis sativus]
 gb|KGN51056.1| hypothetical protein Csa_5G421370 [Cucumis sativus]
Length=603

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 10/64 (16%)
 Frame = +2

Query  374  KMWEESEQD----------AGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDL  523
            KMW+  E+D           GMDELLAVLGYKV++SDMA+VA KLEQLE VMG+     +
Sbjct  33   KMWQPHEEDEGKDAKDGAAGGMDELLAVLGYKVRSSDMADVALKLEQLEMVMGTAYEHGI  92

Query  524  SSLA  535
            S LA
Sbjct  93   SHLA  96



>gb|AEB36201.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>ref|XP_010424927.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=605

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +2

Query  371  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSL  532
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS L
Sbjct  33   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSQL  87



>ref|XP_002890081.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66340.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M  E +   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ DDLS LA
Sbjct  17   MMNEEDDANGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLA  69



>gb|AEB36183.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_002305198.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
 gb|EEE85709.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
Length=607

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K W E +QDAG MDELLAVLGYK+K+SDMA+VA KLEQLE V+GS  G  +S LA
Sbjct  30   KSWVEDDQDAGGMDELLAVLGYKIKSSDMADVAQKLEQLEMVLGSEDG--ISHLA  82



>ref|XP_010496659.1| PREDICTED: DELLA protein GAI [Camelina sativa]
Length=531

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  383  EESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            EE + + GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ  DLS LA
Sbjct  12   EEDDCNNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEHDLSHLA  62



>ref|XP_011021384.1| PREDICTED: DELLA protein GAI-like [Populus euphratica]
Length=608

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+W E +QDAG MDELLAVLGYK+K+S+MA+VA KLEQLE V+GS  G  +S LA
Sbjct  33   KLWVEDDQDAGGMDELLAVLGYKIKSSEMADVAQKLEQLEMVLGSEDG--ISHLA  85



>ref|XP_010459010.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=535

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  383  EESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            EE + + GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ  DLS LA
Sbjct  14   EEDDCNKGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEHDLSHLA  64



>ref|XP_010527787.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KM +  +  AGMDELLAVLGYKV +SDMAEVA KLEQLE++M  VQ D LS L+
Sbjct  26   KMLKVEDDGAGMDELLAVLGYKVMSSDMAEVAHKLEQLEQMMTHVQDDGLSLLS  79



>ref|XP_006383329.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
 gb|ERP61126.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
Length=619

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+W E +QDAG MDELLAVLGYK+K+S+MA+VA KLEQLE V+GS  G  +S LA
Sbjct  33   KLWVEDDQDAGGMDELLAVLGYKIKSSEMADVAQKLEQLEMVLGSEDG--ISHLA  85



>ref|XP_004504565.1| PREDICTED: DELLA protein GAI1-like [Cicer arietinum]
Length=537

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD  520
            E D GMDELLAV+GYKVK+SDMAEVA KLEQLE  MG+ Q  D
Sbjct  25   EDDGGMDELLAVVGYKVKSSDMAEVAQKLEQLEHAMGNFQDQD  67



>ref|XP_008229195.1| PREDICTED: DELLA protein GAI [Prunus mume]
Length=597

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  407  MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MDELLAVLGYKV+ASDMAEVA KLEQLE VMGS Q D +S L+
Sbjct  51   MDELLAVLGYKVRASDMAEVAEKLEQLEMVMGSAQEDGISQLS  93



>ref|XP_006307228.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
 gb|EOA40126.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
Length=528

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  383  EESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            +E +   GMDELLAVLGYKV++S+MA+VA KLEQLE +M +VQ DDLS LA
Sbjct  17   DEDDGSNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLA  67



>gb|AHX57850.1| DELLA [Prunus mume]
Length=597

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  407  MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MDELLAVLGYKV+ASDMAEVA KLEQLE VMGS Q D +S L+
Sbjct  51   MDELLAVLGYKVRASDMAEVAEKLEQLEMVMGSAQEDGISQLS  93



>gb|AEB36151.1| RGA-like 1, partial [Helianthus petiolaris]
Length=192

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|ABI30654.1| putative gibberellin signaling DELLA protein LA [Pisum sativum]
Length=592

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  KKMW-EESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            + +W EE E   GMDELLA LGYKV++SDM +VA KLEQLE VMGS Q + ++ LA
Sbjct  47   QSLWSEEKENSGGMDELLAALGYKVRSSDMLDVAQKLEQLEMVMGSAQEEGINHLA  102



>gb|AEB36150.1| RGA-like 1, partial [Helianthus petiolaris]
Length=193

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36147.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_009590329.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=560

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K++EE + DAGMDELLAVLGYKVK SDMAEVA KLEQLE  M +   D +S L+
Sbjct  20   KIFEE-QPDAGMDELLAVLGYKVKYSDMAEVAQKLEQLEMAMCTTLEDGISHLS  72



>ref|XP_008460522.1| PREDICTED: DELLA protein GAI-like [Cucumis melo]
Length=603

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 10/64 (16%)
 Frame = +2

Query  374  KMW----EESEQDA------GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDL  523
            KMW    EE+ +DA      GMDELLAVLGYKV++SDMA+VA KLEQLE VMG+     +
Sbjct  33   KMWHLQEEEAGEDAKDGAAGGMDELLAVLGYKVRSSDMADVALKLEQLEMVMGTAHEHGI  92

Query  524  SSLA  535
            S LA
Sbjct  93   SHLA  96



>gb|AEB36211.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36212.1| RGA-like 1, partial [Helianthus argophyllus]
Length=187

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36172.1| RGA-like 1, partial [Helianthus exilis]
 gb|AEB36174.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36338.1| RGA-like 1, partial [Helianthus annuus]
Length=185

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36307.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36308.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36336.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36337.1| RGA-like 1, partial [Helianthus annuus]
Length=185

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36175.1| RGA-like 1, partial [Helianthus exilis]
 gb|AEB36180.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36179.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36200.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>ref|XP_002876760.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53019.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = +2

Query  371  KKMWEESEQDAGM--DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G   DELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS LA
Sbjct  26   KMMMVKKEEDGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSHLA  82



>gb|AEB36153.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36196.1| RGA-like 1, partial [Helianthus tuberosus]
Length=192

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36327.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36328.1| RGA-like 1, partial [Helianthus annuus]
Length=187

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36202.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36217.1| RGA-like 1, partial [Helianthus argophyllus]
Length=197

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36197.1| RGA-like 1, partial [Helianthus tuberosus]
Length=195

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>ref|XP_006846116.1| hypothetical protein AMTR_s00012p00140520 [Amborella trichopoda]
 gb|ERN07791.1| hypothetical protein AMTR_s00012p00140520 [Amborella trichopoda]
Length=130

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  377  MWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            M E  + DAG+DELL  LGY  +A+DMAEVA KL+QLE VM + Q D +S LA
Sbjct  1    MQEPQDADAGVDELLVSLGYNFRATDMAEVAQKLQQLEIVMATAQEDGISHLA  53



>gb|AEB36184.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36185.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36187.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36188.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36191.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36198.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36199.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36186.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36207.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36208.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36209.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36210.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36213.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36214.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36215.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36216.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36218.1| RGA-like 1, partial [Helianthus argophyllus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36203.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36190.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36313.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36314.1| RGA-like 1, partial [Helianthus annuus]
Length=191

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36156.1| RGA-like 1, partial [Helianthus petiolaris]
Length=195

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36182.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36297.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36298.1| RGA-like 1, partial [Helianthus annuus]
Length=192

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36157.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36206.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36193.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36204.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36189.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>ref|XP_011002785.1| PREDICTED: DELLA protein GAI [Populus euphratica]
Length=603

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K W E +QDAG MDELLAVLGYK+K+SDMA VA KLEQLE V+GS  G  +S LA
Sbjct  30   KSWVEDDQDAGGMDELLAVLGYKIKSSDMAGVAQKLEQLEMVLGSEDG--ISHLA  82



>gb|AEB36154.1| RGA-like 1, partial [Helianthus petiolaris]
Length=193

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AHB17744.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 39/54 (72%), Gaps = 5/54 (9%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMWEE++     DELLAVLGY VKASDM  VA KLE LEEVMG  Q D L+ LA
Sbjct  29   KMWEEND-----DELLAVLGYNVKASDMNVVARKLEHLEEVMGQAQEDGLTHLA  77



>gb|AEB36152.1| RGA-like 1, partial [Helianthus petiolaris]
Length=191

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36149.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36148.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36176.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G  LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG--LSQMA  84



>gb|AEB36194.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36334.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36294.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36155.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36315.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36316.1| RGA-like 1, partial [Helianthus annuus]
Length=193

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_009779842.1| PREDICTED: DELLA protein GAI-like isoform X3 [Nicotiana sylvestris]
Length=567

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            + DAGMDELLAVLGYKVK+SD+AEVA +LEQLE  M +  GD +S L+
Sbjct  26   QPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCTTLGDGISHLS  73



>gb|AEB36311.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36312.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36324.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36325.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36326.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36333.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36304.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36309.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36178.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_009779840.1| PREDICTED: DELLA protein GAI-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779841.1| PREDICTED: DELLA protein GAI-like isoform X2 [Nicotiana sylvestris]
Length=567

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            + DAGMDELLAVLGYKVK+SD+AEVA +LEQLE  M +  GD +S L+
Sbjct  26   QPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCTTLGDGISHLS  73



>gb|AEB36330.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36305.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36293.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36219.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36220.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36221.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36222.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36223.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36224.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36225.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36226.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36227.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36228.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36229.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36230.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36231.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36232.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36233.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36234.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36235.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36236.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36237.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36238.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36239.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36240.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36241.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36242.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36243.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36244.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36245.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36246.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36247.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36248.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36249.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36250.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36251.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36252.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36253.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36254.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36255.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36256.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36257.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36258.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36259.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36260.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36261.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36262.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36263.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36264.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36265.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36266.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36267.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36268.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36269.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36270.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36271.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36272.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36273.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36274.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36275.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36276.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36277.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36278.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36279.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36280.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36281.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36282.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36283.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36284.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36285.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36286.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36287.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36288.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36289.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36290.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36291.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36292.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36295.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36296.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36299.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36300.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36301.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36302.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36303.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36306.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36310.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36317.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36318.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36319.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36320.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36321.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36322.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36323.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36332.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36335.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36158.1| RGA-like 1, partial [Helianthus petiolaris]
Length=187

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_006416958.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
 dbj|BAJ34426.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35311.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
Length=535

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  404  GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            GMDELLAVLGYKV++S+MAEVA KLEQLE +M +V+ DDLS LA
Sbjct  20   GMDELLAVLGYKVQSSEMAEVAQKLEQLEVMMSNVREDDLSQLA  63



>gb|AEB36177.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36205.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_009779843.1| PREDICTED: DELLA protein GAI-like isoform X4 [Nicotiana sylvestris]
Length=572

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            + DAGMDELLAVLGYKVK+SD+AEVA +LEQLE  M +  GD +S L+
Sbjct  26   QPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCTTLGDGISHLS  73



>ref|XP_002534030.1| DELLA protein GAI, putative [Ricinus communis]
 gb|EEF28350.1| DELLA protein GAI, putative [Ricinus communis]
Length=567

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  404  GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            GMDELLAVLGYKV++SDMAEVA KLEQLE VMG  Q D +S L+
Sbjct  38   GMDELLAVLGYKVRSSDMAEVAQKLEQLEMVMGIAQEDGISHLS  81



>gb|EYU45810.1| hypothetical protein MIMGU_mgv1a003644mg [Erythranthe guttata]
Length=572

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +2

Query  377  MWEESEQ-DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MW E  Q DAGMDEL AVLGYK+K++DMA+VA KLEQLE  MGS   D  S L+
Sbjct  28   MWAEQPQPDAGMDELFAVLGYKMKSTDMADVAEKLEQLEMAMGSTMEDGASVLS  81



>gb|AFR90187.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
floridanus]
Length=223

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AFR90188.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
debilis subsp. debilis]
Length=225

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AEB36329.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36331.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMIDVAQKIEHLEGVLSNDDG  79



>ref|XP_011099949.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI [Sesamum indicum]
Length=565

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  374  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KM  E +Q  DAGMDEL AVLGYKVK+SDMA+VA KLEQLE  MG+   D +S L+
Sbjct  25   KMLAEQQQQPDAGMDELFAVLGYKVKSSDMADVAEKLEQLEMAMGTTMEDGVSVLS  80



>dbj|BAG71201.1| DELLA 2 [Lactuca sativa]
Length=590

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = +2

Query  371  KKMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K MW+E  +QDAG+DELLAVLGYKVK+SDM +VA K+E LE V+G+   D LS +A
Sbjct  48   KNMWDEFDDQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLGN--DDGLSQIA  101



>gb|AEB36181.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G  LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG--LSQMA  84



>gb|AAY56749.1| DELLA protein [Malus domestica]
Length=580

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGSAQEDGVSQLS  90



>gb|ABS50250.1| DELLA protein [Malus hupehensis]
Length=580

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGSAQEDGVSQLS  90



>gb|AEX97110.1| spur-type DELLA protein [Malus domestica]
Length=580

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGSAQEDGVSQLS  90



>ref|XP_008381346.1| PREDICTED: DELLA protein GAI [Malus domestica]
Length=580

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGSAQEDGVSQLS  90



>gb|ABG35314.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35315.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|AFR90189.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|AFR90190.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=225

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ABG35340.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35341.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ABG35317.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35344.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35345.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ABG35324.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35325.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35333.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ABG35336.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35337.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=228

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ABG35316.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35318.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35319.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35320.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35321.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35322.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35323.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35326.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35327.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35328.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35329.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35330.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35331.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35332.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35334.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35335.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35342.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35343.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35346.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35347.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35348.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35349.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35350.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35351.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35352.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35353.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35354.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35355.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35356.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35357.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35358.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35359.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35360.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35361.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35362.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35363.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35364.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35365.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35366.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35367.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35368.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35369.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35370.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35371.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35372.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35373.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35374.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35375.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35376.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35377.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ABG35338.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35339.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|EYU25601.1| hypothetical protein MIMGU_mgv1a003589mg [Erythranthe guttata]
Length=576

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 39/55 (71%), Gaps = 4/55 (7%)
 Frame = +2

Query  374  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW  E+E  AG DEL AVLGYKV  SDMAEVA K++QLEE MG   G  LS LA
Sbjct  25   KMWSSEAEDSAGFDELFAVLGYKVNTSDMAEVALKIKQLEEAMG---GGGLSQLA  76



>dbj|BAF62636.1| DELLA protein [Phaseolus vulgaris]
Length=516

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQ  511
             +WE+   + GMDELLAV+GYKV++SDMAEVA KLE+LEE MG+VQ
Sbjct  25   NLWED---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGNVQ  67



>ref|XP_007156503.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 ref|XP_007156504.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 gb|ESW28497.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 gb|ESW28498.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
Length=517

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQ  511
             +WE+   + GMDELLAV+GYKV++SDMAEVA KLE+LEE MG+VQ
Sbjct  25   NLWED---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGNVQ  67



>gb|KEH34625.1| DELLA domain GRAS family transcription factor GAI [Medicago truncatula]
Length=547

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +2

Query  377  MWEESEQD--AGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            MW E ++    GMDELLA LGYKV++SDMA+VA KLEQLE VMGS Q + ++ L+
Sbjct  1    MWREEKETNGGGMDELLAALGYKVRSSDMADVAQKLEQLEMVMGSAQEEGINHLS  55



>gb|AEB36195.1| RGA-like 1, partial [Helianthus tuberosus]
Length=194

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEQDDGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36171.1| RGA-like 1, partial [Helianthus exilis]
 gb|AEB36173.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW E +EQDAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWGEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_010551797.1| PREDICTED: DELLA protein RGL1-like [Tarenaya hassleriana]
Length=553

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  371  KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K +  E ++  G+DELL VLGYKV++S MA+VA KLEQLE V+GSVQ D LS L+
Sbjct  33   KLLRSEDKETTGVDELLVVLGYKVRSSAMADVAEKLEQLEMVLGSVQNDGLSYLS  87



>gb|AEX97111.1| spur-type DELLA protein [Malus domestica]
Length=584

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = +2

Query  374  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGSAQEDGISQLS  93



>ref|XP_008343058.1| PREDICTED: DELLA protein GAI-like [Malus domestica]
Length=584

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = +2

Query  374  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGSAQEDGISQLS  93



>ref|XP_009334448.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=584

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = +2

Query  374  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGSAQEDGISQLS  93



>gb|AAY56750.1| DELLA protein [Malus domestica]
Length=584

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = +2

Query  374  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGSAQEDGISQLS  93



>gb|AEB36160.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36161.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36162.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36168.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36170.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36159.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36164.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36166.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36169.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36165.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>gb|AEB36163.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36167.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VA K+E LE V+ +  G
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSNDDG  79



>ref|XP_009370101.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=580

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  404  GMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            GMDELLAVLGYKV+  DMA+VA KLEQLE VMGS Q D +S L+
Sbjct  47   GMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGSAQEDGISQLS  90



>gb|KFK33379.1| rga1 protein [Arabis alpina]
Length=590

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  410  DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            DELLAVLGYKV++S+MAEVA KLEQLE +MG+VQ D LS LA
Sbjct  41   DELLAVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLSHLA  82



>ref|XP_010916517.1| PREDICTED: DELLA protein SLR1 isoform X1 [Elaeis guineensis]
 ref|XP_010916518.1| PREDICTED: DELLA protein SLR1 isoform X2 [Elaeis guineensis]
 ref|XP_010916519.1| PREDICTED: DELLA protein SLR1 isoform X3 [Elaeis guineensis]
Length=647

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD---LSSLA  535
            KM    EQD G+DELLA LGYKV++SDMA+VA KLEQLE  MGS    D   LS LA
Sbjct  27   KMTAMEEQDGGVDELLAALGYKVRSSDMADVALKLEQLEMAMGSSAAQDDAFLSHLA  83



>gb|AFR90185.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=225

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW+E +EQDAG DEL AVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDEFNEQDAGDDELPAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>ref|NP_178266.1| DELLA protein RGA [Arabidopsis thaliana]
 sp|Q9SLH3.1|RGA_ARATH RecName: Full=DELLA protein RGA; AltName: Full=GAI-related sequence; 
AltName: Full=GRAS family protein 10; Short=AtGRAS-10; 
AltName: Full=Repressor on the ga1-3 mutant; AltName: Full=Restoration 
of growth on ammonia protein 1 [Arabidopsis thaliana]
 gb|AAC67333.1| putative RGA1, giberellin repsonse modulation protein [Arabidopsis 
thaliana]
 gb|AAL06821.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
 gb|AAQ65090.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
 gb|AEC05469.1| DELLA protein RGA [Arabidopsis thaliana]
Length=587

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +2

Query  371  KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA
Sbjct  28   KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLA  85



>emb|CAA72177.1| RGA1 protein [Arabidopsis thaliana]
Length=587

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +2

Query  371  KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA
Sbjct  28   KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLA  85



>emb|CAA75493.1| GRS protein [Arabidopsis thaliana]
Length=587

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +2

Query  371  KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA
Sbjct  28   KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLA  85



>gb|AAK97709.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
Length=587

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +2

Query  371  KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA
Sbjct  28   KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLA  85



>gb|AHB17746.1| GA repressor DELLA [Actinidia deliciosa]
Length=581

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  374  KMWEESEQD-AGMDELLAVLGYKVKASDMAEVAXKLEQLEEVM  499
            KMW   + D  GMDELLAVLGYKVKASDM EVA KLEQLE VM
Sbjct  24   KMWTAEQADVGGMDELLAVLGYKVKASDMLEVAQKLEQLEMVM  66



>gb|KDP33169.1| hypothetical protein JCGZ_13434 [Jatropha curcas]
Length=1020

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQG  514
            K+W E +    +DELLAVLGYKV++SDMA+VA KLEQLE +  + QG
Sbjct  29   KLWNEEQDSGSIDELLAVLGYKVRSSDMADVAQKLEQLEILTDTAQG  75



>ref|XP_010528540.1| PREDICTED: DELLA protein RGL1 [Tarenaya hassleriana]
Length=546

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  386  ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E ++  G+DELL VLGYKV +SDMA+VA KLE+LE V+GSVQ D +S L+
Sbjct  42   EEKETTGVDELLVVLGYKVLSSDMADVAEKLEELEMVLGSVQDDGISHLS  91



>gb|AHB17745.1| GA repressor DELLA [Actinidia deliciosa]
Length=579

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  374  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAXKLEQLEEVM  499
            KMW   + D G MDELLAVLGYK+KASDM EVA KLEQLE VM
Sbjct  22   KMWAAEQADGGGMDELLAVLGYKIKASDMLEVAHKLEQLEMVM  64



>ref|XP_010066602.1| PREDICTED: DELLA protein GAIP-B-like [Eucalyptus grandis]
 gb|KCW64558.1| hypothetical protein EUGRSUZ_G02163 [Eucalyptus grandis]
Length=634

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  416  LLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            LLAVLGYKV++SDMAEVA KLEQLEEVM S Q D LS LA
Sbjct  41   LLAVLGYKVRSSDMAEVAQKLEQLEEVMFSAQEDGLSHLA  80



>ref|XP_008809806.1| PREDICTED: DELLA protein SLR1 [Phoenix dactylifera]
Length=656

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +2

Query  386  ESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD---LSSLA  535
            E E D G+DELLA LGYKV++SDMA+VA KLEQLE  MGS    D   LS LA
Sbjct  32   EEEHDGGVDELLAALGYKVRSSDMADVALKLEQLEMAMGSSAAQDDAFLSHLA  84



>emb|CDY36236.1| BnaC07g20900D [Brassica napus]
Length=556

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  410  DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            DELL VLGYKV++S+MAEVA KLEQLE +MG+VQ D L+ LA
Sbjct  42   DELLGVLGYKVRSSEMAEVALKLEQLETMMGNVQEDGLAHLA  83



>ref|XP_009390245.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis]
Length=612

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  389  SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGS  505
            +E+D G+DELLA LGYKV++SDMA+VA KLEQLE+ MGS
Sbjct  12   AEEDGGVDELLAALGYKVRSSDMADVAQKLEQLEKAMGS  50



>gb|AFR90186.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
ciliaris]
Length=223

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            KMW++ +E D G DELLAVLGYKVK+SDM +VA K+E LE V+ +   D LS +A
Sbjct  32   KMWDQFNEHDTGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN--DDGLSQMA  84



>gb|ADA84480.1| GRAS [Antirrhinum majus]
Length=528

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = +2

Query  371  KKMWEESEQDAG--MDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            K MW  S  +A   +DEL AVLGYKVK SDMA+VA K++QLE+VMG+  G  +S LA
Sbjct  24   KNMWPSSSCEATDEVDELFAVLGYKVKPSDMADVAIKIQQLEQVMGN--GAAVSDLA  78



>ref|XP_010470510.1| PREDICTED: DELLA protein RGL1 isoform X1 [Camelina sativa]
 ref|XP_010470511.1| PREDICTED: DELLA protein RGL1 isoform X2 [Camelina sativa]
Length=508

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 3/48 (6%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G   GD +S+L+
Sbjct  24   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG---GDGVSNLS  68



>ref|XP_010511563.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 3/48 (6%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G   GD +S+L+
Sbjct  24   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG---GDGVSNLS  68



>ref|XP_010415179.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 3/48 (6%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G   GD +S+L+
Sbjct  24   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG---GDGVSNLS  68



>gb|KFK26113.1| hypothetical protein AALP_AA8G204400 [Arabis alpina]
Length=528

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +2

Query  371  KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSL  532
            K M EE + + GMDELLAVLGYKVK+S+MA+VA +LE+L+ +M +V  DDLS L
Sbjct  10   KSMKEEDDGN-GMDELLAVLGYKVKSSEMADVAQRLEKLDVMMSNVGEDDLSQL  62



>ref|XP_010926472.1| PREDICTED: DELLA protein SLR1-like [Elaeis guineensis]
Length=651

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD---LSSLA  535
            KM    E+D G+DELLA LGYKV+ASDMA+VA KLEQLE  M S    D   LS LA
Sbjct  28   KMMGMEEEDGGVDELLAALGYKVRASDMADVAQKLEQLEMAMTSSAAQDDAFLSHLA  84



>emb|CDY17662.1| BnaA06g34810D [Brassica napus]
Length=572

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  410  DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            DELL VLGYKV++S+MAEVA KLEQLE +MG+ Q D L+ LA
Sbjct  42   DELLGVLGYKVRSSEMAEVALKLEQLETMMGNAQEDGLAHLA  83



>ref|XP_009101333.1| PREDICTED: DELLA protein RGA1 [Brassica rapa]
 sp|Q5BN23.1|RGA1_BRACM RecName: Full=DELLA protein RGA1; AltName: Full=BrRGA1; AltName: 
Full=RGA-like protein 1 [Brassica rapa]
 gb|AAX33297.1| DELLA protein [Brassica rapa]
Length=573

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  410  DELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            DELL VLGYKV++S+MAEVA KLEQLE +MG+ Q D L+ LA
Sbjct  42   DELLGVLGYKVRSSEMAEVALKLEQLETMMGNAQEDGLAHLA  83



>gb|ACJ83347.1| unknown [Medicago truncatula]
Length=232

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 4/54 (7%)
 Frame = +2

Query  380  WEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVM--GSVQGDDLSSLA  535
            WE+     GMDELLAV+GYKVK+SDMAEVA KLEQLE+ M   +    D S++A
Sbjct  23   WEDD--GGGMDELLAVVGYKVKSSDMAEVAQKLEQLEQAMMGNNFHDHDESTIA  74



>gb|AAM15902.1|AF492585_1 GIA/RGA-like gibberellin response modulator [Dubautia arborea]
Length=136

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  401  AGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMG  502
             GMDELL VLGYKVK++DMA+VA KLEQLE VMG
Sbjct  21   GGMDELLEVLGYKVKSTDMADVAQKLEQLEMVMG  54



>ref|XP_008782281.1| PREDICTED: DELLA protein SLR1-like [Phoenix dactylifera]
Length=649

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDD---LSSLA  535
            KM    ++D G+DELLA LGYKV++SDMA+VA KLEQLE  MGS    D   LS LA
Sbjct  28   KMVGMEDEDGGVDELLAALGYKVRSSDMADVAQKLEQLEMAMGSSATQDDAFLSHLA  84



>ref|XP_006400289.1| hypothetical protein EUTSA_v100155350mg, partial [Eutrema salsugineum]
 gb|ESQ41742.1| hypothetical protein EUTSA_v100155350mg, partial [Eutrema salsugineum]
Length=86

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  395  QDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGS  505
            +D  MDELLAVLGYKV++SDMA+VA KLEQLE V+ +
Sbjct  21   EDDNMDELLAVLGYKVRSSDMADVAQKLEQLEMVLSN  57



>gb|ADH53780.1| GAI1 [Malus domestica]
Length=570

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  422  AVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            AVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  1    AVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  38



>gb|ADH53779.1| GAI1 [Malus domestica]
Length=570

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  422  AVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            AVLGYKV++SDMAEVA KLEQLEE MG  Q D LS LA
Sbjct  1    AVLGYKVRSSDMAEVAQKLEQLEEFMGCAQEDGLSQLA  38



>ref|XP_002887024.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63283.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 4/48 (8%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+    GD +S+L+
Sbjct  26   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVL----GDGISNLS  69



>ref|NP_176809.1| DELLA protein RGL1 [Arabidopsis thaliana]
 sp|Q9C8Y3.1|RGL1_ARATH RecName: Full=DELLA protein RGL1; AltName: Full=GRAS family protein 
9; Short=AtGRAS-9; AltName: Full=RGA-like protein 1; 
Short=RGA-like protein [Arabidopsis thaliana]
 gb|AAG52171.1|AC020665_16 gibberellin regulatory protein, putative; 49974-51509 [Arabidopsis 
thaliana]
 gb|AAL05911.1| RGL1 protein [Arabidopsis thaliana]
 gb|AAL49792.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AAM20156.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AEE34499.1| DELLA protein RGL1 [Arabidopsis thaliana]
Length=511

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 4/48 (8%)
 Frame = +2

Query  392  EQDAGMDELLAVLGYKVKASDMAEVAXKLEQLEEVMGSVQGDDLSSLA  535
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+    GD +S+L+
Sbjct  26   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVL----GDGISNLS  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800