BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF013H20

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               178   5e-69   Nicotiana tomentosiformis
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               178   2e-68   Nicotiana sylvestris
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               169   3e-66   Sesamum indicum [beniseed]
emb|CAP58706.1|  putative polyol transporter protein 1                  170   1e-65   Hevea brasiliensis [jebe]
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           173   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               168   3e-65   Cicer arietinum [garbanzo]
gb|KHN39768.1|  Polyol transporter 5                                    172   4e-65   Glycine soja [wild soybean]
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               169   4e-65   Nicotiana sylvestris
gb|ACB56939.1|  mannitol transporter                                    164   7e-65   Artemisia annua [sweet Annie]
ref|XP_008350306.1|  PREDICTED: putative polyol transporter 1           168   7e-65   
gb|ABK29439.1|  sugar transport protein                                 169   7e-65   Coffea canephora [robusta coffee]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           171   8e-65   Pyrus x bretschneideri [bai li]
ref|NP_001281033.1|  polyol transporter 5-like                          168   8e-65   Malus domestica [apple tree]
gb|KDP46230.1|  hypothetical protein JCGZ_10070                         163   8e-65   Jatropha curcas
emb|CDO97075.1|  unnamed protein product                                169   8e-65   Coffea canephora [robusta coffee]
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               165   8e-65   Nicotiana tomentosiformis
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           171   2e-64   Malus domestica [apple tree]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           170   2e-64   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    166   3e-64   Pyrus pyrifolia [sha li]
gb|KHN25361.1|  Polyol transporter 5                                    172   4e-64   Glycine soja [wild soybean]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           166   4e-64   Pyrus x bretschneideri [bai li]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               172   4e-64   
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           166   4e-64   Pyrus x bretschneideri [bai li]
emb|CAP58707.1|  putative polyol transported protein 2                  163   7e-64   Hevea brasiliensis [jebe]
gb|AFI61955.1|  polyol transporter                                      171   7e-64   Camellia sinensis [black tea]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    165   8e-64   
ref|XP_002519083.1|  sugar transporter, putative                        161   9e-64   Ricinus communis
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     167   9e-64   Medicago truncatula
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               167   1e-63   Fragaria vesca subsp. vesca
ref|NP_001287655.1|  polyol transporter 5-like                          159   2e-63   Solanum lycopersicum
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               159   2e-63   Solanum tuberosum [potatoes]
gb|EPS69995.1|  sugar transport protein                                 159   5e-63   Genlisea aurea
emb|CAJ29291.1|  putative polyol transporter protein 4                  163   1e-62   Lotus japonicus
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                165   1e-62   
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    168   1e-62   
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               167   1e-62   Cucumis sativus [cucumbers]
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             160   2e-62   Phaseolus vulgaris [French bean]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           160   2e-62   Malus domestica [apple tree]
gb|KHG20989.1|  Polyol transporter 5 -like protein                      161   2e-62   Gossypium arboreum [tree cotton]
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg             162   2e-62   
gb|KJB32189.1|  hypothetical protein B456_005G228500                    160   3e-62   Gossypium raimondii
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    162   3e-62   Arabis alpina [alpine rockcress]
gb|ACC61047.1|  mannitol transporter                                    159   7e-62   Gossypium hirsutum [American cotton]
gb|KGN44323.1|  Sugar transporter                                       157   7e-62   Cucumis sativus [cucumbers]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             162   8e-62   Eutrema salsugineum [saltwater cress]
gb|AAM44082.1|  putative sorbitol transporter                           160   1e-61   Prunus cerasus [pie cherry]
gb|AGY96955.1|  polyol transporter 1                                    163   1e-61   Vitis vinifera
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    163   1e-61   Vitis vinifera
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               160   1e-61   Prunus mume [ume]
gb|AAT06053.2|  sorbitol transporter                                    169   2e-61   Malus domestica [apple tree]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             164   3e-61   Phaseolus vulgaris [French bean]
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like               163   3e-61   
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    155   3e-61   
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             158   4e-61   Citrus clementina [clementine]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               158   5e-61   Citrus sinensis [apfelsine]
ref|NP_001280902.1|  putative polyol transporter 1                      159   5e-61   Malus domestica [apple tree]
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               156   7e-61   Eucalyptus grandis [rose gum]
ref|NP_001289249.1|  polyol transporter 5-like                          154   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_010096202.1|  Polyol transporter 5                               157   1e-60   Morus notabilis
ref|XP_002313809.1|  putative sorbitol transporter family protein       155   1e-60   Populus trichocarpa [western balsam poplar]
ref|NP_001236592.1|  sorbitol-like transporter                          160   1e-60   
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           156   1e-60   Phoenix dactylifera
gb|ACB86853.1|  mannitol transporter                                    155   2e-60   Citrus sinensis [apfelsine]
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               155   2e-60   Tarenaya hassleriana [spider flower]
gb|EMS55536.1|  Polyol transporter 5                                    150   2e-60   Triticum urartu
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               157   2e-60   Populus euphratica
emb|CDY61985.1|  BnaC03g73840D                                          157   3e-60   Brassica napus [oilseed rape]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           155   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    157   3e-60   Brassica rapa
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    155   4e-60   Brassica rapa
emb|CDX95491.1|  BnaC01g33830D                                          155   5e-60   
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           152   5e-60   
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           152   5e-60   Pyrus x bretschneideri [bai li]
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    152   6e-60   Sesamum indicum [beniseed]
dbj|BAJ85302.1|  predicted protein                                      147   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           154   1e-59   Pyrus x bretschneideri [bai li]
gb|KJB12315.1|  hypothetical protein B456_002G011400                    159   1e-59   Gossypium raimondii
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             157   2e-59   Phaseolus vulgaris [French bean]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           155   2e-59   
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               154   2e-59   Eucalyptus grandis [rose gum]
emb|CDP10064.1|  unnamed protein product                                151   2e-59   Coffea canephora [robusta coffee]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           154   3e-59   
gb|KDP46229.1|  hypothetical protein JCGZ_10069                         144   4e-59   Jatropha curcas
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               155   4e-59   Citrus sinensis [apfelsine]
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           148   4e-59   Elaeis guineensis
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             155   4e-59   Citrus clementina [clementine]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               159   5e-59   Fragaria vesca subsp. vesca
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           152   5e-59   
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         146   5e-59   
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    145   5e-59   Cucumis melo [Oriental melon]
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         146   6e-59   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD58709.1|  polyol transporter                                     149   6e-59   Plantago major [cart-track plant]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               147   6e-59   Malus domestica [apple tree]
gb|AAO39267.1|AF482011_1  sorbitol transporter                          157   9e-59   Prunus cerasus [pie cherry]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           151   1e-58   Prunus mume [ume]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             156   1e-58   Prunus persica
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               144   1e-58   Sesamum indicum [beniseed]
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               146   1e-58   Eucalyptus grandis [rose gum]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               154   2e-58   Glycine max [soybeans]
gb|AAL85876.2|AF480069_1  mannitol transporter                          151   2e-58   Apium graveolens Dulce Group [celery]
gb|KCW55335.1|  hypothetical protein EUGRSUZ_I01255                     146   2e-58   Eucalyptus grandis [rose gum]
gb|AIU41385.1|  sorbitol transporter 1                                  155   2e-58   Prunus salicina [Japanese plum]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               149   2e-58   Nicotiana tomentosiformis
gb|KJB12316.1|  hypothetical protein B456_002G011500                    155   2e-58   Gossypium raimondii
gb|AEX55225.1|  sugar transporter                                       150   2e-58   Allium sativum
gb|EMT15230.1|  Polyol transporter 5                                    142   3e-58   
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           149   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           150   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             149   3e-58   Prunus persica
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           149   4e-58   
ref|XP_004148312.1|  PREDICTED: polyol transporter 5-like               144   4e-58   
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           153   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    152   5e-58   Populus euphratica
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               154   5e-58   Prunus mume [ume]
emb|CAD58710.1|  polyol transporter                                     149   6e-58   Plantago major [cart-track plant]
ref|XP_003603886.1|  Mannitol transporter                               149   8e-58   Medicago truncatula
gb|AAY86779.1|  putative sugar transporter protein                      151   8e-58   Noccaea caerulescens
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    145   8e-58   Sesamum indicum [beniseed]
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    142   9e-58   Setaria italica
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    151   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             150   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    151   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               147   1e-57   Solanum tuberosum [potatoes]
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              144   1e-57   
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    142   1e-57   
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    150   1e-57   Tarenaya hassleriana [spider flower]
ref|NP_188513.1|  polyol transporter 5                                  149   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               144   2e-57   Oryza brachyantha
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               149   2e-57   Cicer arietinum [garbanzo]
dbj|BAM66296.1|  sorbitol transporter                                   147   2e-57   Pyrus pyrifolia [sha li]
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          145   2e-57   Sorghum bicolor [broomcorn]
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               149   3e-57   Solanum tuberosum [potatoes]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    150   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               145   3e-57   Phoenix dactylifera
dbj|BAM66295.1|  sorbitol transporter                                   144   3e-57   Pyrus pyrifolia [sha li]
gb|ACJ85869.1|  unknown                                                 149   4e-57   Medicago truncatula
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               140   5e-57   Brachypodium distachyon [annual false brome]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               142   5e-57   Zea mays [maize]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               153   5e-57   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    153   5e-57   Pyrus pyrifolia [sha li]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           152   5e-57   Prunus mume [ume]
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840          141   5e-57   Amborella trichopoda
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               153   5e-57   Pyrus x bretschneideri [bai li]
gb|EYU42630.1|  hypothetical protein MIMGU_mgv1a0059091mg               159   6e-57   Erythranthe guttata [common monkey flower]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             144   6e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             144   8e-57   Capsella rubella
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           144   9e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001060108.1|  Os07g0582400                                       140   9e-57   
emb|CBI32562.3|  unnamed protein product                                147   1e-56   Vitis vinifera
dbj|BAC83310.1|  putative sorbitol transporter                          140   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           145   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           143   1e-56   Camelina sativa [gold-of-pleasure]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          140   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             146   1e-56   
ref|NP_001281036.1|  polyol transporter 5-like                          153   1e-56   Malus domestica [apple tree]
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             145   1e-56   
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           144   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             150   1e-56   Prunus persica
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   142   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             143   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             152   2e-56   Phaseolus vulgaris [French bean]
dbj|BAJ86526.1|  predicted protein                                      139   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002884156.1|  predicted protein                                  143   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             150   2e-56   
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               144   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP17996.1|  unnamed protein product                                149   2e-56   Coffea canephora [robusta coffee]
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             150   3e-56   Prunus persica
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               142   3e-56   
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          138   3e-56   Sorghum bicolor [broomcorn]
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           142   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           137   3e-56   Brachypodium distachyon [annual false brome]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    144   4e-56   Phoenix dactylifera
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           140   4e-56   Brassica rapa
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           142   4e-56   
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          142   4e-56   Sorghum bicolor [broomcorn]
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    142   4e-56   Arabis alpina [alpine rockcress]
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           142   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           142   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    145   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           142   6e-56   Camelina sativa [gold-of-pleasure]
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    142   6e-56   Arabis alpina [alpine rockcress]
ref|XP_009121242.1|  PREDICTED: putative polyol transporter 1           140   7e-56   
ref|NP_001147446.1|  sorbitol transporter                               141   7e-56   Zea mays [maize]
emb|CDY46218.1|  BnaA07g03520D                                          140   8e-56   Brassica napus [oilseed rape]
emb|CDP18000.1|  unnamed protein product                                147   1e-55   Coffea canephora [robusta coffee]
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   143   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         137   1e-55   Zea mays [maize]
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               148   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           146   1e-55   Phoenix dactylifera
dbj|BAJ93158.1|  predicted protein                                      139   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86116.1|  predicted protein                                      139   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001049269.1|  Os03g0197100                                       137   2e-55   
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               152   2e-55   Glycine max [soybeans]
gb|AAY88181.2|  mannitol transporter 1                                  139   2e-55   Olea europaea
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    140   2e-55   Brassica rapa
ref|NP_001281038.1|  polyol transporter 5-like                          137   2e-55   Malus domestica [apple tree]
gb|KHN25431.1|  Polyol transporter 5                                    152   2e-55   Glycine soja [wild soybean]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    138   2e-55   
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               143   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    138   2e-55   Setaria italica
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           142   2e-55   Prunus mume [ume]
emb|CDY46217.1|  BnaA07g03530D                                          140   3e-55   Brassica napus [oilseed rape]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               145   3e-55   Prunus mume [ume]
ref|NP_001150711.1|  LOC100284344                                       135   3e-55   Zea mays [maize]
ref|XP_002885281.1|  ATPLT5                                             141   4e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           140   5e-55   
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           141   6e-55   Camelina sativa [gold-of-pleasure]
gb|AAO88964.1|  sorbitol transporter                                    147   6e-55   Malus domestica [apple tree]
ref|XP_007200584.1|  hypothetical protein PRUPE_ppa007633mg             138   8e-55   
gb|AAN07021.1|  putative mannitol transporter                           137   1e-54   Phelipanche ramosa
ref|XP_003607077.1|  Sorbitol-like transporter                          152   1e-54   Medicago truncatula
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             139   1e-54   
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               135   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               135   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               140   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               142   2e-54   Cucumis melo [Oriental melon]
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               134   2e-54   Oryza brachyantha
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           134   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           134   2e-54   Pyrus x bretschneideri [bai li]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                152   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           134   3e-54   Pyrus x bretschneideri [bai li]
gb|KCW55336.1|  hypothetical protein EUGRSUZ_I01255                     132   3e-54   Eucalyptus grandis [rose gum]
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               132   3e-54   Setaria italica
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    137   3e-54   Phoenix dactylifera
gb|EMS50618.1|  Polyol transporter 5                                    136   4e-54   Triticum urartu
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    133   5e-54   
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           133   5e-54   Pyrus x bretschneideri [bai li]
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      136   5e-54   Setaria italica
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     134   5e-54   Medicago truncatula
ref|XP_006856085.1|  hypothetical protein AMTR_s00059p00123280          134   7e-54   
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               144   8e-54   Cucumis melo [Oriental melon]
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           135   8e-54   Brachypodium distachyon [annual false brome]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     137   1e-53   Eucalyptus grandis [rose gum]
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       140   1e-53   Cucumis sativus [cucumbers]
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               141   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               135   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               131   2e-53   
gb|EEE58504.1|  hypothetical protein OsJ_09775                          135   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          130   2e-53   Sorghum bicolor [broomcorn]
gb|EAY88906.1|  hypothetical protein OsI_10385                          135   2e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           134   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               138   2e-53   Phoenix dactylifera
ref|XP_010527168.1|  PREDICTED: putative polyol transporter 1           134   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           133   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               130   2e-53   Setaria italica
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      146   3e-53   
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               141   3e-53   Prunus mume [ume]
ref|XP_006827104.1|  hypothetical protein AMTR_s00010p00243760          128   4e-53   
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               135   4e-53   Sesamum indicum [beniseed]
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             132   5e-53   Capsella rubella
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           134   6e-53   Pyrus x bretschneideri [bai li]
emb|CDP17999.1|  unnamed protein product                                143   1e-52   Coffea canephora [robusta coffee]
ref|XP_008466921.1|  PREDICTED: putative polyol transporter 1           136   1e-52   Cucumis melo [Oriental melon]
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               134   1e-52   Oryza brachyantha
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               127   1e-52   Setaria italica
gb|ABX71752.1|  mannitol transporter                                    131   1e-52   Apium graveolens
gb|ACG47895.1|  polyol transporter protein 4                            126   2e-52   Zea mays [maize]
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      126   2e-52   
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               128   2e-52   
gb|KGN44326.1|  Mannitol transporter                                    141   3e-52   Cucumis sativus [cucumbers]
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               136   3e-52   Brachypodium distachyon [annual false brome]
dbj|BAK00091.1|  predicted protein                                      128   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP02097.1|  unnamed protein product                                138   5e-52   Coffea canephora [robusta coffee]
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               132   6e-52   Eucalyptus grandis [rose gum]
gb|KJB12318.1|  hypothetical protein B456_002G011700                    143   1e-51   Gossypium raimondii
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               126   2e-51   Solanum tuberosum [potatoes]
gb|EAZ04481.1|  hypothetical protein OsI_26630                          130   2e-51   Oryza sativa Indica Group [Indian rice]
dbj|BAJ93015.1|  predicted protein                                      127   4e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               131   5e-51   
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like               134   7e-51   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    135   7e-51   Tarenaya hassleriana [spider flower]
ref|XP_010497306.1|  PREDICTED: putative polyol transporter 1           138   8e-51   
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           131   1e-50   
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                127   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               126   1e-50   Phoenix dactylifera
gb|EMS55537.1|  Putative polyol transporter 1                           123   1e-50   Triticum urartu
ref|XP_010527595.1|  PREDICTED: polyol transporter 5-like               140   1e-50   Tarenaya hassleriana [spider flower]
gb|AAG43998.1|AF215837_1  mannitol transporter                          125   2e-50   Apium graveolens Dulce Group [celery]
ref|NP_001060109.2|  Os07g0582500                                       127   3e-50   
dbj|BAC83311.1|  putative sorbitol transporter                          127   3e-50   
gb|EMS52712.1|  Putative polyol transporter 2                           124   3e-50   
gb|EMT15229.1|  Putative polyol transporter 1                           122   4e-50   
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          122   4e-50   
emb|CAR82416.1|  polyol transporter                                     151   5e-50   
ref|XP_004163631.1|  PREDICTED: polyol transporter 5-like               131   9e-50   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               131   1e-49   
ref|XP_009780685.1|  PREDICTED: polyol transporter 5-like               151   2e-49   
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               118   2e-49   
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    130   2e-49   
gb|ABF94465.1|  Sugar transporter family protein, expressed             122   2e-49   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               139   2e-49   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               123   3e-49   
gb|KJB12317.1|  hypothetical protein B456_002G011600                    132   6e-49   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         133   1e-48   
ref|NP_001168177.1|  uncharacterized protein LOC100381931               130   2e-48   
ref|XP_004148302.1|  PREDICTED: polyol transporter 5-like               134   2e-48   
ref|XP_007208924.1|  hypothetical protein PRUPE_ppb008257mg             158   3e-48   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               129   4e-48   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    119   6e-48   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               123   7e-48   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               123   7e-48   
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       124   9e-48   
ref|XP_006827103.1|  hypothetical protein AMTR_s00010p00243630          115   9e-48   
gb|ABR16466.1|  unknown                                                 124   9e-48   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            126   9e-48   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      131   9e-48   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           127   1e-47   
ref|NP_001142160.1|  hypothetical protein                               110   1e-47   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           125   2e-47   
gb|KDP33673.1|  hypothetical protein JCGZ_07244                         125   2e-47   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           121   2e-47   
ref|XP_002514302.1|  sugar transporter, putative                        127   4e-47   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           132   4e-47   
ref|XP_002514303.1|  sugar transporter, putative                        122   5e-47   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      122   5e-47   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               120   7e-47   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           126   7e-47   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               125   7e-47   
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          125   8e-47   
ref|NP_001045505.2|  Os01g0966900                                       109   8e-47   
gb|EAY77363.1|  hypothetical protein OsI_05348                          109   9e-47   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           127   1e-46   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           125   1e-46   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           125   1e-46   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             125   1e-46   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           124   2e-46   
emb|CDY66291.1|  BnaCnng50240D                                          124   2e-46   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           122   2e-46   
ref|XP_004159155.1|  PREDICTED: polyol transporter 5-like               128   2e-46   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               114   2e-46   
emb|CDY66868.1|  BnaUnng01720D                                          124   3e-46   
gb|ACG35144.1|  proton myo-inositol cotransporter                       123   3e-46   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  123   3e-46   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               119   4e-46   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    118   6e-46   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             122   8e-46   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               129   9e-46   
gb|KGN44328.1|  hypothetical protein Csa_7G257320                       131   9e-46   
emb|CDP03333.1|  unnamed protein product                                118   9e-46   
gb|EMT00465.1|  Putative polyol transporter 1                           112   1e-45   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               120   1e-45   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               121   1e-45   
gb|KDP33672.1|  hypothetical protein JCGZ_07243                         116   1e-45   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     114   2e-45   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           128   2e-45   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           128   2e-45   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           124   2e-45   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             122   3e-45   
ref|XP_010095276.1|  putative polyol transporter 6                      124   3e-45   
ref|XP_010099586.1|  Polyol transporter 5                               118   3e-45   
ref|XP_003620669.1|  Myo-inositol transporter                           119   3e-45   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               115   3e-45   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    122   4e-45   
ref|XP_007152832.1|  hypothetical protein PHAVU_004G163600g             121   4e-45   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             124   4e-45   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               119   4e-45   
ref|XP_004148315.1|  PREDICTED: polyol transporter 5-like               128   7e-45   
gb|KDP27565.1|  hypothetical protein JCGZ_20028                         124   7e-45   
gb|KGN48817.1|  hypothetical protein Csa_6G502060                       122   1e-44   
ref|NP_179438.1|  putative polyol transporter 3                         119   1e-44   
ref|XP_007046983.1|  Major facilitator superfamily protein              123   1e-44   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           121   1e-44   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           134   2e-44   
gb|AFK48916.1|  unknown                                                 140   2e-44   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             124   2e-44   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    113   3e-44   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           121   3e-44   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           115   4e-44   
emb|CBI28072.3|  unnamed protein product                                113   4e-44   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           123   5e-44   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    119   6e-44   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           114   7e-44   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              105   9e-44   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           124   9e-44   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                115   9e-44   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like      115   1e-43   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    115   1e-43   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             113   1e-43   
gb|ACN26310.1|  unknown                                                 114   1e-43   
ref|XP_002531429.1|  sugar transporter, putative                        119   1e-43   
ref|XP_002886176.1|  predicted protein                                  115   1e-43   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           123   1e-43   
gb|ACN35873.1|  unknown                                                 114   2e-43   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             117   2e-43   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               114   3e-43   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like               112   4e-43   
ref|XP_004143580.1|  PREDICTED: probable polyol transporter 3-like      115   5e-43   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    117   6e-43   
ref|XP_010686555.1|  PREDICTED: probable polyol transporter 4           108   6e-43   
gb|KHG12832.1|  Polyol transporter 5 -like protein                      149   6e-43   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    113   6e-43   
ref|NP_001146002.1|  uncharacterized protein LOC100279532               107   7e-43   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               117   7e-43   
gb|AFW56602.1|  major myo-inositol transporter iolT                     107   8e-43   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           115   1e-42   
ref|NP_001141158.1|  hypothetical protein                               114   1e-42   
ref|XP_002310213.2|  mannitol transporter family protein                117   1e-42   
ref|XP_004134957.1|  PREDICTED: probable polyol transporter 4-like      103   1e-42   
gb|KJB77296.1|  hypothetical protein B456_012G130400                    106   1e-42   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      119   1e-42   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      113   2e-42   
gb|KJB64902.1|  hypothetical protein B456_010G071500                    116   2e-42   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           114   2e-42   
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...    120   2e-42   
ref|XP_002517946.1|  sugar transporter, putative                        103   2e-42   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           117   2e-42   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      114   2e-42   
gb|KJB31705.1|  hypothetical protein B456_005G202400                    105   3e-42   
ref|XP_004243120.1|  PREDICTED: polyol transporter 5-like               109   3e-42   
ref|XP_006827815.1|  hypothetical protein AMTR_s00009p00268230          103   3e-42   
emb|CCC58382.1|  polyol/monosaccharide transporter 4                    107   3e-42   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           120   3e-42   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    120   4e-42   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    113   5e-42   
emb|CBI17542.3|  unnamed protein product                                120   5e-42   
ref|XP_010242001.1|  PREDICTED: probable polyol transporter 4           104   5e-42   
gb|KHN00554.1|  Putative polyol transporter 3                           114   5e-42   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     113   5e-42   
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             152   6e-42   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    115   6e-42   
ref|XP_009773455.1|  PREDICTED: probable polyol transporter 4 iso...    107   7e-42   
ref|XP_002443259.1|  hypothetical protein SORBIDRAFT_08g016530          105   7e-42   
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      109   8e-42   
ref|XP_007211557.1|  hypothetical protein PRUPE_ppa004144mg             103   9e-42   
ref|XP_003593550.1|  hypothetical protein MTR_2g013310                  102   9e-42   
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      119   9e-42   
ref|XP_007148196.1|  hypothetical protein PHAVU_006G188100g             105   9e-42   
ref|XP_009773456.1|  PREDICTED: probable polyol transporter 4 iso...    107   9e-42   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      114   9e-42   
ref|XP_003618299.1|  Mannitol transporter                               105   1e-41   
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           117   1e-41   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           117   1e-41   
ref|XP_006833286.1|  hypothetical protein AMTR_s00109p00027810          102   1e-41   
gb|ACJ85829.1|  unknown                                                 115   1e-41   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  115   1e-41   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      112   1e-41   
ref|XP_008225034.1|  PREDICTED: probable polyol transporter 4           103   1e-41   
gb|KFK40451.1|  hypothetical protein AALP_AA3G374800                  99.4    1e-41   
ref|XP_009613014.1|  PREDICTED: probable polyol transporter 4           102   1e-41   
ref|XP_008439885.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    100   1e-41   
ref|XP_006350047.1|  PREDICTED: probable polyol transporter 4-like      102   1e-41   
tpg|DAA41237.1|  TPA: hypothetical protein ZEAMMB73_503211              107   1e-41   
ref|XP_003630795.1|  Polyol transporter                                 104   1e-41   
ref|XP_004251791.1|  PREDICTED: probable polyol transporter 4           102   1e-41   
dbj|BAO96228.1|  polyol/monosaccharide transporter 3                    102   1e-41   
ref|XP_009787559.1|  PREDICTED: probable polyol transporter 4           102   1e-41   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    114   2e-41   
ref|XP_004514460.1|  PREDICTED: probable polyol transporter 4-like      105   2e-41   
ref|XP_004232838.1|  PREDICTED: probable polyol transporter 4 iso...    106   2e-41   
ref|XP_008229167.1|  PREDICTED: probable polyol transporter 4           105   2e-41   
ref|XP_010035720.1|  PREDICTED: probable polyol transporter 4           104   2e-41   
ref|XP_006297425.1|  hypothetical protein CARUB_v10013450mg           99.8    2e-41   
ref|XP_007215837.1|  hypothetical protein PRUPE_ppa004119mg             104   2e-41   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      117   2e-41   
gb|EPS63014.1|  hypothetical protein M569_11773                         104   2e-41   
ref|XP_007043554.1|  Major facilitator superfamily protein              103   2e-41   
ref|XP_009335311.1|  PREDICTED: probable polyol transporter 4           107   2e-41   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               100   2e-41   
ref|NP_179671.2|  putative polyol transporter 4                       99.8    2e-41   
ref|XP_002886303.1|  hypothetical protein ARALYDRAFT_480914           99.8    3e-41   
ref|XP_011460253.1|  PREDICTED: probable polyol transporter 4           102   3e-41   
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           115   3e-41   
ref|XP_009624322.1|  PREDICTED: probable polyol transporter 4 iso...    107   3e-41   
ref|XP_006347075.1|  PREDICTED: probable polyol transporter 4-lik...    105   3e-41   
ref|XP_006395993.1|  hypothetical protein EUTSA_v10003989mg             100   3e-41   
ref|XP_011011702.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    114   3e-41   
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           112   3e-41   
gb|KDP24153.1|  hypothetical protein JCGZ_25810                         100   4e-41   
ref|XP_002519026.1|  sugar transporter, putative                        100   4e-41   
ref|XP_011096257.1|  PREDICTED: probable polyol transporter 4           103   4e-41   
ref|XP_008371338.1|  PREDICTED: probable polyol transporter 4           106   4e-41   
ref|XP_009121193.1|  PREDICTED: probable polyol transporter 4         98.6    4e-41   
ref|XP_010488992.1|  PREDICTED: probable polyol transporter 4         99.0    5e-41   
gb|KJB54071.1|  hypothetical protein B456_009G019700                    115   5e-41   
ref|XP_010467767.1|  PREDICTED: probable polyol transporter 4 iso...  99.0    5e-41   
gb|AFK37582.1|  unknown                                                 113   5e-41   
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                112   5e-41   
ref|XP_002972026.1|  hypothetical protein SELMODRAFT_441647             112   5e-41   
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             116   5e-41   
ref|XP_003543064.1|  PREDICTED: probable polyol transporter 4-lik...    100   5e-41   
ref|XP_003527443.1|  PREDICTED: probable polyol transporter 4-like      106   5e-41   
ref|XP_010099574.1|  putative polyol transporter 4                      103   6e-41   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  122   6e-41   
ref|XP_003545891.1|  PREDICTED: probable polyol transporter 4-lik...    100   6e-41   
gb|EPS74022.1|  hypothetical protein M569_00722                         101   7e-41   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like             97.4    7e-41   
ref|XP_007132713.1|  hypothetical protein PHAVU_011G118500g             105   7e-41   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg           97.4    7e-41   
ref|XP_011078372.1|  PREDICTED: polyol transporter 5-like               111   7e-41   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                 97.4    7e-41   
emb|CDY72252.1|  BnaCnng76720D                                        98.2    7e-41   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    116   7e-41   
ref|XP_002978711.1|  hypothetical protein SELMODRAFT_109547             106   8e-41   
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             115   8e-41   
gb|KHN08546.1|  Putative polyol transporter 4                           100   8e-41   
ref|NP_195385.1|  putative polyol transporter 6                         115   8e-41   
ref|XP_002984639.1|  hypothetical protein SELMODRAFT_181215             106   8e-41   
ref|XP_002319907.2|  mannitol transporter family protein                100   9e-41   
ref|XP_002972566.1|  hypothetical protein SELMODRAFT_148545             112   9e-41   
gb|ADP37150.1|  putative polyol/monosaccharide transporter              100   9e-41   



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   178 bits (451),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  231
            M D +  RNA  G +  AFDPPKK KRNKYA+A +FLASLASILLGYDIGVMSGA IYI+
Sbjct  1    MADKKQGRNAVCGQLQIAFDPPKKPKRNKYAVACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  232  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  411
            KDL IND QVEIL GILNLYSLIGS  AGRTSDWIGRR TMVVA+V+FFVGA+LMGF+TN
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGALLMGFATN  120

Query  412  YTFLMVGRFVAG  447
            Y FLM GRFVAG
Sbjct  121  YAFLMFGRFVAG  132


 Score =   110 bits (275),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HLSWRF
Sbjct  132  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPAHLSWRF  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   178 bits (452),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  231
            M D +  RNA  G +  AFDPPKK KRNKYA A +FLASLASILLGYDIGVMSGA IYI+
Sbjct  1    MADKKHGRNAVCGQLQIAFDPPKKPKRNKYATACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  232  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  411
            KDL IND QVEIL GILNLYSLIGS  AGRTSDWIGRR TMVVA+V+FFVGAILMGF+TN
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGAILMGFATN  120

Query  412  YTFLMVGRFVAG  447
            Y FLM GRFVAG
Sbjct  121  YAFLMFGRFVAG  132


 Score =   107 bits (268),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  +LSWRF
Sbjct  132  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPANLSWRF  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   169 bits (428),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA IYIQKDL+I+D Q E+++G
Sbjct  9    IPAFDPPQKPKRNKYAMACSFLASMTSILLGYDIGVMSGAIIYIQKDLQISDVQKEVIMG  68

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+YSL+GS  AGRTSDWIGRRYT+V A V+FF GA+LMGF+TNY FLMVGRFVAG
Sbjct  69   ILNVYSLLGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMVGRFVAG  125


 Score =   109 bits (273),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFINFGIL+GYVSNFAF  +   L WRF
Sbjct  125  GIGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNFAFSKLPTSLGWRF  184

Query  626  ML  631
            ML
Sbjct  185  ML  186



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   170 bits (430),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D  P        +  FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  9    DVNPSSQPAEKTLADFDPPKKPKRNKFALACAALASMTSILLGYDIGVMSGAAIYIKDDL  68

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+DTQVEIL+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+TNY F
Sbjct  69   KISDTQVEILVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGGIFFVGALLMGFATNYAF  128

Query  421  LMVGRFVAG  447
            LMVGRF+AG
Sbjct  129  LMVGRFIAG  137


 Score =   107 bits (266),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA++IAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HL WRF
Sbjct  137  GIGVGYAVVIAPVYTAEVSPASSRGFLTSFPEVFINSGILIGYVSNFAFSKLPTHLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   173 bits (439),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D    +  GSG +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DL
Sbjct  8    DNAVSQQPGSGGLSEFDPPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDL  67

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+D ++EILLGI+N+YSLIGS  AGRTSDWIGRRYT+V+A  +FF GAILMGF+TNY F
Sbjct  68   KISDVEIEILLGIINVYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFTGAILMGFATNYVF  127

Query  421  LMVGRFVAG  447
            LMVGRFVAG
Sbjct  128  LMVGRFVAG  136


 Score =   103 bits (256),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +   L WR 
Sbjct  136  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPTDLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   168 bits (425),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M + + V       +  FDP KK KRN YA A A LAS+ SILLGYDIGVMSGAAIYIQ+
Sbjct  1    MSEGKVVEAKAPQTLHDFDPQKKPKRNMYAFACAMLASMTSILLGYDIGVMSGAAIYIQR  60

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLK++D Q+EILLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A V+FF GA+LMGFS NY
Sbjct  61   DLKVSDVQIEILLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGVIFFAGALLMGFSPNY  120

Query  415  TFLMVGRFVAG  447
            +FLM GRFVAG
Sbjct  121  SFLMFGRFVAG  131


 Score =   107 bits (268),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GILVGY+SN+AF  +S+HL WR 
Sbjct  131  GVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILVGYISNYAFSKLSLHLGWRM  190

Query  626  ML  631
            ML
Sbjct  191  ML  192



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   172 bits (437),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D Q+EILLGI+N
Sbjct  19   FDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDEQIEILLGIIN  78

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM GRFVAG
Sbjct  79   LYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFGRFVAG  132


 Score =   102 bits (255),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  +++ + WR 
Sbjct  132  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILIGYISNYAFSKLTLKVGWRM  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   169 bits (427),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M + +   N G   I      FDPPKK KRNKYAIA +FLASLASILLGYDIGVMSGA I
Sbjct  1    MAEEKLASNNGQPQIVTSIQDFDPPKKPKRNKYAIACSFLASLASILLGYDIGVMSGAII  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            YI+KDL I DTQVEIL+GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF
Sbjct  61   YIKKDLHITDTQVEILVGILNIYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGF  120

Query  403  STNYTFLMVGRFVAG  447
            +T Y FLMVGRFVAG
Sbjct  121  ATTYAFLMVGRFVAG  135


 Score =   106 bits (265),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALM+APVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  +LSWRF
Sbjct  135  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSRLPTNLSWRF  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   164 bits (416),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSG---HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  225
            M D +P  N  S     +  FDPPK  KRNKYA A A LAS+ S+LLGYDIGVMSGA IY
Sbjct  1    MADQKPEENGVSSKTKELADFDPPKAPKRNKYAFACAMLASMTSVLLGYDIGVMSGAQIY  60

Query  226  IQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFS  405
            I++DL  +D Q++IL+GILNLYSL+GS  AGRTSDWIGRRYT+V+A V+FF GAILMGF+
Sbjct  61   IKRDLHCSDNQIQILVGILNLYSLVGSAAAGRTSDWIGRRYTIVLAGVIFFTGAILMGFA  120

Query  406  TNYTFLMVGRFVAG  447
            TNY FLM GRFVAG
Sbjct  121  TNYAFLMFGRFVAG  134


 Score =   110 bits (274),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  + +HL WRF
Sbjct  134  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINAGILLGYVSNFAFSKLPLHLGWRF  193

Query  626  ML  631
            ML
Sbjct  194  ML  195



>ref|XP_008350306.1| PREDICTED: putative polyol transporter 1, partial [Malus domestica]
Length=282

 Score =   168 bits (425),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDL  66

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+D +VEILLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY F
Sbjct  67   KISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAF  126

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  127  LMFGRFVAG  135


 Score =   106 bits (265),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  135  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTHLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   169 bits (429),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 110/136 (81%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRN-AGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            MG  +P  N   SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAA
Sbjct  1    MGTRKPAENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            IYI++D K++D +VEIL+GILNLYSL+GS  AGRTSDWIGRR T+V AS +FF GA+LMG
Sbjct  61   IYIKRDFKLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            FSTNY FLMVGRFVAG
Sbjct  121  FSTNYAFLMVGRFVAG  136


 Score =   105 bits (261),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+ F  +  HL WRF
Sbjct  136  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKLPPHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   171 bits (434),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK+KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D Q+EILLGILN
Sbjct  23   FDPPKKLKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGILN  82

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLMVGRFVAG
Sbjct  83   VYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAG  136


 Score =   103 bits (256),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   168 bits (425),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDL  66

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+D +VE+LLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY+F
Sbjct  67   KISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYSF  126

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  127  LMFGRFVAG  135


 Score =   106 bits (265),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  135  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTHLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   163 bits (412),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
            +N     +  FDPPKK K NK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D 
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLKISDL  77

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T Y FLMVGR
Sbjct  78   QVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGR  137

Query  436  FVAG  447
            FVAG
Sbjct  138  FVAG  141


 Score =   111 bits (277),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HLSWRF
Sbjct  141  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPTHLSWRF  200

Query  626  ML  631
            ML
Sbjct  201  ML  202



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   169 bits (429),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 110/136 (81%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRN-AGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            MG  +P  N   SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAA
Sbjct  1    MGTRKPAENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            IYI++D K++D +VEIL+GILNLYSL+GS  AGRTSDWIGRR T+V AS +FF GA+LMG
Sbjct  61   IYIKRDFKLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            FSTNY FLMVGRFVAG
Sbjct  121  FSTNYAFLMVGRFVAG  136


 Score =   105 bits (261),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+ F  +  HL WRF
Sbjct  136  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKLPPHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   165 bits (417),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK K NKYAIA +FLASLASILLGYDIGVMSGA IYIQKDL I D QVEIL+GILN
Sbjct  24   FDPPKKPKTNKYAIACSFLASLASILLGYDIGVMSGAIIYIQKDLHITDIQVEILVGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLMVGRFVAG
Sbjct  84   VYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGFATTYAFLMVGRFVAG  137


 Score =   109 bits (273),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALM+APVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HLSWRF
Sbjct  137  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSRLPTHLSWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   171 bits (432),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
            +  GS  +  FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D 
Sbjct  14   QQTGSRGLSDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDV  73

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            ++EILLGI+N+YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGFSTNY FLMVGR
Sbjct  74   EIEILLGIINVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSTNYAFLMVGR  133

Query  436  FVAG  447
            FVAG
Sbjct  134  FVAG  137


 Score =   102 bits (255),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR 
Sbjct  137  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLGWRL  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   170 bits (430),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D Q+EILLGILN
Sbjct  23   FDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGILN  82

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLMVGRFVAG
Sbjct  83   VYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAG  136


 Score =   103 bits (256),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   166 bits (421),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLG  78

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAG
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAG  135


 Score =   105 bits (263),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  135  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   172 bits (435),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = +1

Query  73   VRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  246
            +  A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK+
Sbjct  6    IVEAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKV  65

Query  247  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  426
            +D Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM
Sbjct  66   SDVQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLM  125

Query  427  VGRFVAG  447
             GRFVAG
Sbjct  126  FGRFVAG  132


 Score =   100 bits (249),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +++ + WR 
Sbjct  132  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKVGWRM  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   166 bits (420),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKITDVEVEVLLG  78

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAG
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAG  135


 Score =   105 bits (263),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  135  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   172 bits (435),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK++D Q+EILLGI+N
Sbjct  19   FDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSDVQIEILLGIIN  78

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM GRFVAG
Sbjct  79   LYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFGRFVAG  132


 Score =   100 bits (249),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +++ + WR 
Sbjct  132  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKVGWRM  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   166 bits (420),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLG  78

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAG
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAG  135


 Score =   105 bits (263),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  135  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   163 bits (412),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP KK KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI+K+LKI+DTQVEIL G LN
Sbjct  25   FDPQKKPKRNKFAFACAILASMTSILLGYDIGVMSGAAIYIKKNLKISDTQVEILAGTLN  84

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSL+GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TNY FLMVGRFVAG
Sbjct  85   IYSLVGSAAAGRTSDWIGRRYTIVMAGGIFFVGALLMGFATNYAFLMVGRFVAG  138


 Score =   108 bits (269),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  +LSWRF
Sbjct  138  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPANLSWRF  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   171 bits (432),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSG----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D +P  N  SG    HIPA DPP+K KRNKYA A A LAS+ SILLGYD GVMSGAA+
Sbjct  1    MADRKPQNNGFSGQTQTHIPALDPPQKPKRNKYAFACAILASMTSILLGYDGGVMSGAAL  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I+ DLKI+D Q+E+L+GI++LYSL+G   AGRTSDW+GRRYT+V+A+ +FFVGAILMGF
Sbjct  61   FIKDDLKISDVQLEVLMGIMSLYSLLGCYAAGRTSDWVGRRYTIVIAAAIFFVGAILMGF  120

Query  403  STNYTFLMVGRFVAG  447
            +TNY FLMVGRFVAG
Sbjct  121  ATNYAFLMVGRFVAG  135


 Score =   100 bits (249),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYAL+IAPVYTAEV+PA+ RGFLTSFPEVFIN G+L+GYVSN+AF  + ++L WR 
Sbjct  135  GIGVGYALLIAPVYTAEVSPAASRGFLTSFPEVFINAGVLLGYVSNYAFSKLPLYLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   165 bits (418),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLG DIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGLDIGVMSGAAIYIKDDL  66

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+D +VEILLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY F
Sbjct  67   KISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAF  126

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  127  LMFGRFVAG  135


 Score =   105 bits (263),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  135  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTHLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   161 bits (408),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  70   PVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  249
            P+ N     I  FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ + +++
Sbjct  14   PISNK---TIADFDPPKKPKRNKFALACAILASMTSILLGYDIGVMSGAAIYIKDEFRLS  70

Query  250  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  429
            D QVEIL+G LNLYSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T+Y FLMV
Sbjct  71   DLQVEILVGTLNLYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATSYAFLMV  130

Query  430  GRFVAG  447
            GRFVAG
Sbjct  131  GRFVAG  136


 Score =   109 bits (273),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HL WRF
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   167 bits (422),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M + + V      ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++
Sbjct  1    MSEGKIVEAKAQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKR  60

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY
Sbjct  61   DLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNY  120

Query  415  TFLMVGRFVAG  447
             FLM GRFVAG
Sbjct  121  NFLMFGRFVAG  131


 Score =   103 bits (258),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  +S+ L WR 
Sbjct  131  GVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYISNYAFSKLSLKLGWRM  190

Query  626  ML  631
            ML
Sbjct  191  ML  192



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   167 bits (423),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA SG      I  FDP  K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEENAVSGQPTQKAIADFDPAPKPKRNKYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            I+I+ DLKI+D QVE+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IFIKDDLKISDVQVEVLMGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+TNY+FLM GRFVAG
Sbjct  121  FATNYSFLMFGRFVAG  136


 Score =   103 bits (256),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  ++++L WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNWAFSELALNLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   159 bits (402),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
              I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA +YI+KDL I D QVEIL
Sbjct  10   ARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAILYIKKDLHITDVQVEIL  69

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLM GRFVAG
Sbjct  70   VGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAG  128


 Score =   111 bits (277),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALM+APVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN  F  +S HLSWRF
Sbjct  128  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVVFSKLSTHLSWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   159 bits (403),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
              I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA IYI+KDL I D QVEIL
Sbjct  36   ARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAIIYIKKDLHITDVQVEIL  95

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLM GRFVAG
Sbjct  96   VGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAG  154


 Score =   110 bits (275),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALM+APVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN AF  +  HLSWRF
Sbjct  154  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVAFSKLPTHLSWRF  213

Query  626  ML  631
            ML
Sbjct  214  ML  215



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   159 bits (402),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK KRNKYA+A AFLAS+ SILLGYDIGVMSGA IYI++D+++ D Q E+++GILN
Sbjct  19   FDPPKKPKRNKYALACAFLASMTSILLGYDIGVMSGAIIYIRRDIRMTDVQQEVIMGILN  78

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYSLIGS +AGRTSDW+GRRYT+++A  +FF GA+LMGF+TNY FLMVGRFVAG
Sbjct  79   LYSLIGSALAGRTSDWLGRRYTIILAGAIFFFGALLMGFATNYAFLMVGRFVAG  132


 Score =   109 bits (272),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFINFGIL+GYVSN+ F  +  HL WRF
Sbjct  132  GIGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNYGFSKIPQHLGWRF  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   163 bits (413),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
             NA   ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D 
Sbjct  11   ENANQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDV  70

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            ++EILLGI+NLYSLIGS +AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY FLM GR
Sbjct  71   KIEILLGIINLYSLIGSGLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYWFLMFGR  130

Query  436  FVAG  447
            F+AG
Sbjct  131  FIAG  134


 Score =   103 bits (258),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SNFAF  +S+ + WR 
Sbjct  134  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNFAFSKLSLKVGWRM  193

Query  626  ML  631
            ML
Sbjct  194  ML  195



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   165 bits (417),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            F+P KK KRNK+A A A LASL SILLGYDIGVMSGA IYI+ DLKIND QVEIL+GILN
Sbjct  25   FEPAKKPKRNKFAFACAILASLTSILLGYDIGVMSGAVIYIKDDLKINDVQVEILVGILN  84

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LY L+GSC AGRTSDWIGRRYT+V A  +FFVGA+LMGF+TNY FLMVGRFVAG
Sbjct  85   LYCLVGSCAAGRTSDWIGRRYTIVFACAIFFVGALLMGFATNYAFLMVGRFVAG  138


 Score =   102 bits (254),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  ++ WR 
Sbjct  138  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKLPTNIGWRL  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score =   168 bits (425),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D +++DT++EIL+G
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEILVG  79

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF GA+LMGF+T+Y+FLM GRFVAG
Sbjct  80   ILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAG  136


 Score = 99.4 bits (246),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMS--VHLSW  619
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+ F  +S  V + W
Sbjct  136  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKVSDPVKMGW  195

Query  620  RFML  631
            R+ML
Sbjct  196  RYML  199



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   167 bits (424),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D +++DT++EIL+G
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEILVG  79

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF GA+LMGF+T+Y+FLM GRFVAG
Sbjct  80   ILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAG  136


 Score = 99.4 bits (246),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMS--VHLSW  619
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+ F  +S  V + W
Sbjct  136  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKVSDPVKMGW  195

Query  620  RFML  631
            R+ML
Sbjct  196  RYML  199



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   160 bits (404),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            F+  KK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYI++DLK++D Q+EIL+GI+N
Sbjct  16   FNSSKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIKRDLKVSDVQIEILMGIIN  75

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYSLIGSC+AGRTSDWIGRRYT+V A  +FF GA+LMGFS NY FLM GRFVAG
Sbjct  76   LYSLIGSCLAGRTSDWIGRRYTIVFAGTIFFAGALLMGFSPNYLFLMFGRFVAG  129


 Score =   106 bits (265),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  M++ L WR 
Sbjct  129  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKMTLKLGWRM  188

Query  626  ML  631
            ML
Sbjct  189  ML  190



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   160 bits (405),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D    +  GS  +  FD PKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DL
Sbjct  8    DNAVSQQPGSRGLSEFDSPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDL  67

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+D ++EILLGI+N+YSLIGS  AGRTSD IGRRYT+V+A  +FF GA+LMGF+TNY F
Sbjct  68   KISDVEIEILLGIINVYSLIGSAAAGRTSDRIGRRYTIVLAGAIFFTGALLMGFATNYVF  127

Query  421  LMVGRFVAG  447
            LMVGRFVAG
Sbjct  128  LMVGRFVAG  136


 Score =   106 bits (264),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL WR 
Sbjct  136  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPTHLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   161 bits (408),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 108/130 (83%), Gaps = 2/130 (2%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  237
             TRPV  A + +   F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+D
Sbjct  12   STRPVM-ADNRNFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQED  70

Query  238  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  417
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  418  FLMVGRFVAG  447
            FLMVGRFVAG
Sbjct  131  FLMVGRFVAG  140


 Score =   105 bits (261),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +   L WRF
Sbjct  140  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKLPTDLGWRF  199

Query  626  ML  631
            ML
Sbjct  200  ML  201



>ref|XP_007200585.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01784.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=361

 Score =   162 bits (410),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAG-SGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA  SG     I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADERAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+ NY FLM GRF+AG
Sbjct  121  FAPNYAFLMFGRFIAG  136


 Score =   103 bits (258),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVSN+ F  +  HL WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVSNYGFSKLPTHLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   160 bits (406),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  237
             TRPV  A +     F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+D
Sbjct  12   STRPVM-ADNRSFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQED  70

Query  238  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  417
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  418  FLMVGRFVAG  447
            FLMVGRFVAG
Sbjct  131  FLMVGRFVAG  140


 Score =   105 bits (261),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +   L WRF
Sbjct  140  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKLPTDLGWRF  199

Query  626  ML  631
            ML
Sbjct  200  ML  201



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   162 bits (409),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  70   PVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  249
            P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYIQ+DLKI 
Sbjct  12   PPPAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIQRDLKIT  71

Query  250  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  429
            D QV IL GILN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM 
Sbjct  72   DIQVGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMF  131

Query  430  GRFVAG  447
            GRFVAG
Sbjct  132  GRFVAG  137


 Score =   104 bits (259),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF N  + L WRF
Sbjct  137  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSNFPLKLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>gb|ACC61047.1| mannitol transporter [Gossypium hirsutum]
Length=392

 Score =   159 bits (403),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 2/130 (2%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  237
             TRPV  A + +   F+P  KK KRNK+A A A LASL SILLGYDIGV+SGA IYIQ+D
Sbjct  12   STRPVM-ADNRNFADFEPAVKKPKRNKFASACAILASLTSILLGYDIGVISGAIIYIQED  70

Query  238  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  417
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  418  FLMVGRFVAG  447
            FLMVGRFVAG
Sbjct  131  FLMVGRFVAG  140


 Score =   105 bits (261),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +   L WRF
Sbjct  140  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKLPTDLGWRF  199

Query  626  ML  631
            ML
Sbjct  200  ML  201



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   157 bits (397),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +IND Q E+++G++NLY+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYA  73

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIG+  AGRTSDWIGRRYTMV+A V+FF+GAILMGF+TNY FLM GRFVAG
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAG  124


 Score =   107 bits (267),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMI+PVYTAEV+PAS RGFLTSFPEVFINFG+L+GY+SNF F  + +HL WRF
Sbjct  124  GIGVGYALMISPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSKLPLHLGWRF  183

Query  626  ML  631
            ML
Sbjct  184  ML  185



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   162 bits (409),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  85   GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
            G+ H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ 
Sbjct  17   GTKHVPELGPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIG  76

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            IL GILN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVA
Sbjct  77   ILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVA  136

Query  445  G  447
            G
Sbjct  137  G  137


 Score =   102 bits (254),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRF
Sbjct  137  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   160 bits (405),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNA-----GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA        +I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADRRAEYNAVVSGQPQKNIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAV  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+ NY FLM GRFVAG
Sbjct  121  FAPNYAFLMFGRFVAG  136


 Score =   103 bits (257),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVSN+ F  +  HL WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVSNYGFSKLPTHLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   163 bits (413),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI+D +VEIL+G
Sbjct  19   VTEFDAPKKKGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVG  78

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+Y L GS  AGRTSDWIGRRYT+V+ASV+FF+GA+LMGF+TNY FLMVGRFVAG
Sbjct  79   ILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAG  135


 Score =   100 bits (250),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RGF+TSFPEVFIN GIL GY+SN+AF  +  +L WRF
Sbjct  135  GIGVGYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSKLPTNLGWRF  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   163 bits (412),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI+D +VEIL+G
Sbjct  19   VTEFDAPKKNGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVG  78

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+Y L GS  AGRTSDWIGRRYT+V+ASV+FF+GA+LMGF+TNY FLMVGRFVAG
Sbjct  79   ILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAG  135


 Score =   100 bits (250),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RGF+TSFPEVFIN GIL GY+SN+AF  +  +L WRF
Sbjct  135  GIGVGYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSKLPTNLGWRF  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   160 bits (404),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAG-SGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA  SG     I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGGIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+ NY FLM GRF+AG
Sbjct  121  FAPNYAFLMFGRFIAG  136


 Score =   103 bits (257),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVSN+ F  +  HL WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVSNYGFSKLPTHLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   169 bits (427),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D   V +     I  FDPP+K KRNKYA A A LAS+ SIL+GYDIGVMSGA+IYI+KDL
Sbjct  7    DDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILMGYDIGVMSGASIYIEKDL  66

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            K+ DTQ+EI++G++ +YSLIGS MAG+TSDW+GRRYT+V++  +FF+GAILMGFSTNYTF
Sbjct  67   KVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISGAIFFIGAILMGFSTNYTF  126

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  127  LMCGRFVAG  135


 Score = 94.4 bits (233),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYAL IAPVY+AEV+P S RGFLTSFPEVF+N GIL+GY+SN+AF    + L WR 
Sbjct  135  GIGVGYALTIAPVYSAEVSPTSSRGFLTSFPEVFVNIGILLGYLSNYAFSFCPLDLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   164 bits (416),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK K NKYA   A LAS   ILLGYDIGVM+GAAIYI++DLK++D Q+EILLGI+N
Sbjct  16   FDPPKKHKTNKYAFGCAILASTTCILLGYDIGVMTGAAIYIKRDLKVSDVQIEILLGIIN  75

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYSLIGSC+AGRTSDW+GRRYT+V A  +FF GA+LMGFS NY+FLM GRFVAG
Sbjct  76   LYSLIGSCVAGRTSDWLGRRYTIVFAGTIFFAGALLMGFSPNYSFLMFGRFVAG  129


 Score = 98.2 bits (243),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMI PVY+AEV+PAS RGFLTSF EVFIN GIL+GY+SN+AF  M++ L WR 
Sbjct  129  GIGIGYALMIGPVYSAEVSPASYRGFLTSFTEVFINGGILLGYISNYAFSKMTLKLGWRM  188

Query  626  ML  631
            ML
Sbjct  189  ML  190



>ref|XP_003539021.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=312

 Score =   163 bits (413),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +1

Query  106  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            FDPP KK KRN YA A A LA+  SILLGYDIGVMSGAAIYI+KDLK++D Q+EIL+GI 
Sbjct  21   FDPPIKKPKRNTYAFACAMLATTTSILLGYDIGVMSGAAIYIKKDLKVSDVQIEILIGIF  80

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            NLYSLIGSC+AGRTSDWIGRRYT+V A  +FF GAILMGFS NY FLM GRFVAG
Sbjct  81   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFAGAILMGFSPNYAFLMFGRFVAG  135


 Score = 99.0 bits (245),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GY LMIAPVYT+EV+PAS RGFLTSF EVFIN GIL+GY+SN+AF  M++ L WR 
Sbjct  135  GIGMGYGLMIAPVYTSEVSPASSRGFLTSFTEVFINVGILLGYISNYAFSKMTLKLGWRM  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score =   155 bits (391),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+ D +IND Q E+++G++NLY+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKXDFQINDVQEEVMIGVINLYA  73

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIG+  AGRTSDWIGRRYTMV+A V+FF+GAILMGF+TNY FLM GRFVAG
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAG  124


 Score =   107 bits (267),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMI+PVYTAEV+PAS RGFLTSFPEVFINFG+L+GY+SNF F  + +HL WRF
Sbjct  124  GIGVGYALMISPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSKLPLHLGWRF  183

Query  626  ML  631
            ML
Sbjct  184  ML  185



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   158 bits (399),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DTQ+EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAG  137


 Score =   103 bits (258),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR 
Sbjct  137  GVGVGYALMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRM  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   158 bits (399),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DTQ+EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAG  137


 Score =   103 bits (258),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR 
Sbjct  137  GVGVGYALMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRM  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   159 bits (402),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA +G      I  FDPP K K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDPPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            +YIQK+LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LYIQKNLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+TNY FLMVGRFVAG
Sbjct  121  FATNYAFLMVGRFVAG  136


 Score =   102 bits (254),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++N+AF  + +HL WRF
Sbjct  136  GVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSKLPLHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   156 bits (395),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  94   HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  273
             I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI+KDLKI+D +VEIL 
Sbjct  23   SIEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKKDLKISDVEVEILT  82

Query  274  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            GIL +YSL+GS MAGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAG
Sbjct  83   GILAVYSLLGSAMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAG  140


 Score =   105 bits (261),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  + ++L WR 
Sbjct  140  GIGVGYALMIAPVYTAEVSPASTRGFLTSFPEVFINIGILLGYISNYAFSKLRLNLGWRM  199

Query  626  ML  631
            ML
Sbjct  200  ML  201



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   154 bits (390),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R    A +G      I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+
Sbjct  3    MTDRRAEDKAITGQAQNTSIADFDPPKKAKTKKFAIACGVLASMTSILLGYDIGVMSGAS  62

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            ++I+++LKI+D QVEIL G LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GA+LMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGALLMG  122

Query  400  FSTNYTFLMVGRFVAG  447
            F+ NY FLM GRFVAG
Sbjct  123  FAPNYAFLMFGRFVAG  138


 Score =   106 bits (265),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+AF  + +HL+WR 
Sbjct  138  GVGVGYALMIAPVYTAEISPASYRGFLTSFPEVFVNIGILLGYVSNYAFSKLPIHLNWRI  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   157 bits (396),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D +   N  SG     I  FDPPK+ ++N +AIA A LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRKAEVNGISGQTQKTIADFDPPKRPRKNIFAIACAVLASMTSILLGYDIGVMSGAVI  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I++DLKI+D +VEIL GILNLYSL+GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF
Sbjct  61   FIKEDLKISDVKVEILTGILNLYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGF  120

Query  403  STNYTFLMVGRFVAG  447
            +TNY FLM GRFVAG
Sbjct  121  ATNYAFLMFGRFVAG  135


 Score =   103 bits (258),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  +L WR 
Sbjct  135  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSKLPTYLGWRL  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   155 bits (392),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +1

Query  58   GDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  237
            GD  P + A    +  FDP KK KRNK+A A A LAS+ S+LLGYDIGVMSGA IYIQ D
Sbjct  9    GDANPSQPALDRTLADFDPVKKPKRNKFAFACAILASMTSVLLGYDIGVMSGANIYIQDD  68

Query  238  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  417
            LKI+D QV +L+G LNLYSL+GS  AGRTSD IGRRYT+V+A  +FF+G+ILMGF+TNY 
Sbjct  69   LKISDLQVALLVGTLNLYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSILMGFATNYA  128

Query  418  FLMVGRFVAG  447
            FLMVGRFVAG
Sbjct  129  FLMVGRFVAG  138


 Score =   105 bits (261),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  +L WRF
Sbjct  138  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSKLPTNLGWRF  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   160 bits (404),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D Q+EILLGI+N
Sbjct  19   FDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDEQIEILLGIIN  78

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYSLIGSC+AGRTSDWIGRRYT+ +   +F VG+ LMGF  +Y+FLM GRFVAG
Sbjct  79   LYSLIGSCLAGRTSDWIGRRYTIGLGGAIFLVGSTLMGFYPHYSFLMCGRFVAG  132


 Score =   100 bits (249),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +++ + WR 
Sbjct  132  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKVGWRM  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   156 bits (394),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKV-----KRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D +P     +  +P    P+ V     ++NKYA   A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVASQVPHDSLPEAVAPRPRRKNKYAFGCAMLASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            I+IQ DL + DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG
Sbjct  61   IFIQDDLHVTDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  400  FSTNYTFLMVGRFVAG  447
             + NY FLMVGRFVAG
Sbjct  121  LAPNYAFLMVGRFVAG  136


 Score =   104 bits (259),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAPAS RGFLTSF EVFIN GIL+GYVSNFAF  +  HL+WR 
Sbjct  136  GVGVGYALMIAPVYTAEVAPASSRGFLTSFAEVFINSGILLGYVSNFAFSKLPEHLAWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   155 bits (391),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ DLK++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRF AG
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFGAG  137


 Score =   104 bits (260),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR 
Sbjct  137  GIGVGYALMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRM  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   155 bits (391),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +P    P K KRNK+A A A LAS+ SILLGYDIGVMSGA IYI++DLKI D ++++L G
Sbjct  19   VPEMSMPAKPKRNKFAFACAILASMTSILLGYDIGVMSGAIIYIKRDLKIGDGKIQVLTG  78

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN++SLIGSC AGRTSDWIGRRYT+V+A  +FFVGAILMGF+TNY FLM GRFVAG
Sbjct  79   ILNIFSLIGSCAAGRTSDWIGRRYTIVLAGAIFFVGAILMGFATNYAFLMFGRFVAG  135


 Score =   104 bits (260),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFL SFPEVFIN GIL+GYVSN+AF  +  +LSWRF
Sbjct  135  GIGVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGILLGYVSNYAFSKLPENLSWRF  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   150 bits (378),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +PA   PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKINDTQ+E+L+G
Sbjct  6    LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  65

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+YSLIGS  AGRTSDWIGRR+T+V A+V+FF GA++MGFS NY  LM GRFVAG
Sbjct  66   ILNVYSLIGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGFSVNYAMLMFGRFVAG  122


 Score =   109 bits (273),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSNFAF  +S+ L WR 
Sbjct  122  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRLGWRI  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   157 bits (396),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +1

Query  58   GDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  237
            GD  P + A    +  FDP KK KRNK+A A A +AS+ S+LLGYDIGVMSGA IYIQ D
Sbjct  9    GDANPSQPALDRKLADFDPAKKPKRNKFAFACASIASMTSVLLGYDIGVMSGANIYIQDD  68

Query  238  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  417
            LKIND QV +L+G LN+YSL+GS  AGRTSD IGRRYT+V+A  +FF+G++LMGF+TNY 
Sbjct  69   LKINDLQVALLVGTLNIYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSVLMGFATNYA  128

Query  418  FLMVGRFVAG  447
            FLMVGRFVAG
Sbjct  129  FLMVGRFVAG  138


 Score =   102 bits (255),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  +L WR 
Sbjct  138  GVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTNLGWRI  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   157 bits (396),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  94   HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  273
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ IL 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  274  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            GILN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAG
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAG  143


 Score =   102 bits (254),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRF
Sbjct  143  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRF  202

Query  626  ML  631
            ML
Sbjct  203  ML  204



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   155 bits (391),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  228
            M D +P     SG   I  FDPPK  K  K+A+A A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPEDTEASGQKTIADFDPPKAAKTKKFAVACAILASMTSILLGYDIGVMSGASLFI  62

Query  229  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  408
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  409  NYTFLMVGRFVAG  447
            NY FLM GRF+AG
Sbjct  123  NYAFLMFGRFIAG  135


 Score =   104 bits (259),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+A   + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNYALAKLPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   157 bits (396),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  94   HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  273
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ IL 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  274  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            GILN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAG
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAG  143


 Score =   102 bits (254),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRF
Sbjct  143  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRF  202

Query  626  ML  631
            ML
Sbjct  203  ML  204



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   155 bits (393),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
             T P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D 
Sbjct  9    QTVPTTAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDF  68

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI D QV IL GILN++SLIGSC AG+TSDWIGRR T+V A  +FF GAILMG + NY F
Sbjct  69   KITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYAF  128

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  129  LMFGRFVAG  137


 Score =   103 bits (256),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRF
Sbjct  137  GVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   155 bits (392),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
             T P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D 
Sbjct  9    QTVPTTAPATKHVPELGPPLKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDF  68

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI D QV IL GILN++SLIGSC AG+TSDWIGRR T+V A  +FF GAILMG + NY F
Sbjct  69   KITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYDF  128

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  129  LMFGRFVAG  137


 Score =   103 bits (256),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRF
Sbjct  137  GVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   152 bits (384),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI+D QVEIL G
Sbjct  22   IADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQVEILNG  81

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GAILMG + NY FLM GRFVAG
Sbjct  82   TLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRFVAG  138


 Score =   106 bits (264),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+AF  + +HL+WR 
Sbjct  138  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVSNYAFSKLPIHLNWRV  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   152 bits (384),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI+D QVEIL G
Sbjct  22   IADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQVEILNG  81

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GAILMG + NY FLM GRFVAG
Sbjct  82   TLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRFVAG  138


 Score =   106 bits (264),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+AF  + +HL+WR 
Sbjct  138  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVSNYAFSKLPIHLNWRV  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   152 bits (384),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P K KRNKYA+A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+YS
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGYDTGVMSGATIYIKRDLKISDVQIEILVGTINIYS  90

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GS +AGRTSDWIGRRYT+V AS +FF GAILMGF+ NY FLMVGRFVAG
Sbjct  91   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAG  141


 Score =   106 bits (264),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSN+AF  + + L WR 
Sbjct  141  GIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAKLPLKLGWRL  200

Query  626  ML  631
            ML
Sbjct  201  ML  202



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   147 bits (370),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +PA   PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKINDTQ+E+L+G
Sbjct  37   LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  96

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+YSL+GS  AGRTSDWIGRR+T+V A+V+FF GA++MG S NY  LM GRFVAG
Sbjct  97   ILNVYSLVGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGLSVNYAMLMFGRFVAG  153


 Score =   110 bits (275),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSNFAF  +S+ L WR 
Sbjct  153  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRLGWRI  212

Query  626  ML  631
            ML
Sbjct  213  ML  214



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   154 bits (390),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA +G      I  FDPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADQRVNDNAVTGGPQNTSIEDFDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            ++I+++LKI+D QVEIL G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LFIKENLKISDVQVEILAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+TNY FLM GRFVAG
Sbjct  121  FATNYAFLMFGRFVAG  136


 Score =   102 bits (254),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++N+AF  + +HL WRF
Sbjct  136  GVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSKLPLHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   159 bits (401),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  261
            AG+  +  F+  KK KRNK+A A + LASLASILLGYDIGVMSGA IYI+ DLKI+D QV
Sbjct  17   AGNKTVADFEVSKKPKRNKFAFACSILASLASILLGYDIGVMSGAIIYIKDDLKISDVQV  76

Query  262  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  441
            EIL+GILNLY LIG+  AGRTSDWIGRRYT+VVA+ +FFVGA+LMGF+TNY FLMVGRFV
Sbjct  77   EILVGILNLYCLIGAYAAGRTSDWIGRRYTIVVAAAIFFVGALLMGFATNYAFLMVGRFV  136

Query  442  AG  447
            AG
Sbjct  137  AG  138


 Score = 98.2 bits (243),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+AL+IAPVYTAEV+PAS RGFL SFPEVFIN G+L+GYVSN+AF  +   L WR 
Sbjct  138  GIGVGFALLIAPVYTAEVSPASSRGFLNSFPEVFINIGLLLGYVSNYAFSKLRADLGWRV  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   157 bits (396),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
            + A    +  FDP K  KRNK+A A A LAS+ SILLGYD+GVMSGA IYI++DLK+ D 
Sbjct  5    KAAAQKSLEDFDPKKAPKRNKFAFACAILASMTSILLGYDVGVMSGAVIYIKRDLKLTDV  64

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            Q+EI++GI+NLYSLIGSC+AGRTSDWIGRRYT+V+A  +FF+GAILMGFS NY FLM  R
Sbjct  65   QIEIVVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGGIFFMGAILMGFSPNYPFLMFAR  124

Query  436  FVAG  447
            FVAG
Sbjct  125  FVAG  128


 Score =   100 bits (248),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYTAEV+P S RGFLTSFPEVF+N GIL+GY+SN+ F  + +H+ WR 
Sbjct  128  GVGIGYALMIAPVYTAEVSPPSCRGFLTSFPEVFVNGGILLGYISNYGFSKLPLHMGWRM  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   155 bits (392),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  228
            M D +P     SG   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAXKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  229  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  408
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  409  NYTFLMVGRFVAG  447
            NY FLM GRF+AG
Sbjct  123  NYAFLMFGRFIAG  135


 Score =   101 bits (252),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RG LTSFPEVF+N GIL+GYVSN+A   + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYALSXLPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   154 bits (389),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  94   HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  273
             I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI++DLKI+D +VEIL 
Sbjct  23   SIEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKEDLKISDVEVEILT  82

Query  274  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            GIL +YSL+GS MAGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAG
Sbjct  83   GILAVYSLLGSPMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAG  140


 Score =   102 bits (254),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFL SFPEVFIN GIL+GY+SN+AF  + + L WR 
Sbjct  140  GIGVGYALMIAPVYTAEVSPASTRGFLNSFPEVFINIGILLGYISNYAFSKLRLSLGWRM  199

Query  626  ML  631
            ML
Sbjct  200  ML  201



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   151 bits (382),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            IP F PP + KRNKY++A A LAS+ SILLGYD GVMSGA +YI++DL ++D Q+EIL+G
Sbjct  17   IPDFGPPPRPKRNKYSLACALLASMTSILLGYDTGVMSGATLYIKQDLHVSDVQIEILVG  76

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +N+YSL+GS +AG+TSD +GRRYT+V+A+VVFFVGA LMGF+TNY FLM GRFVAG
Sbjct  77   TINIYSLVGSAIAGKTSDMVGRRYTIVIAAVVFFVGAFLMGFATNYAFLMFGRFVAG  133


 Score =   104 bits (260),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP+S RGFLTSFPEVFINFG+L+GYVSN+ F  + V+L WRF
Sbjct  133  GIGVGYALMIAPVYTAEVAPSSSRGFLTSFPEVFINFGVLLGYVSNYFFAKLPVNLGWRF  192

Query  626  ML  631
            M+
Sbjct  193  MM  194



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   154 bits (390),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  228
            M D +P     SG   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAPKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  229  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  408
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  409  NYTFLMVGRFVAG  447
            NY FLM GRF+AG
Sbjct  123  NYAFLMFGRFIAG  135


 Score =   101 bits (252),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RG LTSFPEVF+N GIL+GYVSN+A   + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYALSXLPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   144 bits (364),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+ DLKI+D QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA 
Sbjct  27   GYDIGVMSGAAIYIKDDLKISDLQVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAG  86

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FFVGA+LMGF+T Y FLMVGRFVAG
Sbjct  87   AIFFVGALLMGFATTYAFLMVGRFVAG  113


 Score =   111 bits (277),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HLSWRF
Sbjct  113  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPTHLSWRF  172

Query  626  ML  631
            ML
Sbjct  173  ML  174



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   155 bits (391),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ++SLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAG  137


 Score =   100 bits (249),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYA +IAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR 
Sbjct  137  GVGVGYAALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRM  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   148 bits (373),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPP----KKVKRNK-YaiaaaflaslasillGYDIGVMSGAA  219
            M D +P     +   P+   P     +++RNK +A A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MSDRKPEATKVASQGPSVSLPYAVTPRLRRNKRFAFACAMLASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            I+I+ DL ++DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FF+GAI+MG
Sbjct  61   IFIKDDLHVSDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFIGAIMMG  120

Query  400  FSTNYTFLMVGRFVAG  447
             + NY FLMVGRFVAG
Sbjct  121  LAPNYAFLMVGRFVAG  136


 Score =   107 bits (267),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HL+WR 
Sbjct  136  GVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNFAFARLPQHLNWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   155 bits (391),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ++SLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAG  137


 Score =   100 bits (249),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYA +IAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR 
Sbjct  137  GVGVGYAALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRM  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   159 bits (403),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   N          I  FDP  K KRN+YA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEENGQPTQSTKKAIEDFDPAPKPKRNRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            I+I+ DLKI+D QVE+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IFIKDDLKISDVQVEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+TNY+FLM GRFVAG
Sbjct  121  FATNYSFLMFGRFVAG  136


 Score = 95.5 bits (236),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYT EV+PAS RGFLTSF ++FIN GIL+GY+SN+AF  ++++L WR 
Sbjct  136  GIGVGYALMIAPVYTVEVSPASSRGFLTSFADMFINAGILLGYISNWAFSKLALNLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   152 bits (385),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA +       I   DPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADQRANENAVTSGPQNTSIEDIDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            ++I+++LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+TNY FLMVGRFVAG
Sbjct  121  FATNYAFLMVGRFVAG  136


 Score =   102 bits (254),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++N+AF  + +HL WRF
Sbjct  136  GVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSKLPLHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   146 bits (369),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 3/132 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  231
            M D  P     S  I  FDP KK  KRNK+A A A LAS+ S+LLGYDIGVMSGA IY++
Sbjct  9    MSDPPP--TTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLK  66

Query  232  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  411
            +D  I+DTQ+ +L+GILN+Y L GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TN
Sbjct  67   EDWHISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATN  126

Query  412  YTFLMVGRFVAG  447
            Y FLMVGRFV G
Sbjct  127  YAFLMVGRFVTG  138


 Score =   108 bits (270),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN AF ++  HLSWRF
Sbjct  138  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFSSLPTHLSWRF  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   145 bits (367),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  130  RNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSC  309
            RNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +I D Q E+++G++NLY+LIG+ 
Sbjct  19   RNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFEITDVQEEVMIGVINLYALIGAA  78

Query  310  MAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             AGRTSDWIGRRYTMV+A V+FF+GA+LMGF+TNY FLM GRFVAG
Sbjct  79   AAGRTSDWIGRRYTMVLAGVIFFLGAVLMGFATNYGFLMFGRFVAG  124


 Score =   109 bits (272),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMI+PVYTAEV+PAS RGFLTSFPEVFINFG+++GY+SNFAF  + +HL WRF
Sbjct  124  GIGVGYALMISPVYTAEVSPASSRGFLTSFPEVFINFGVMLGYISNFAFSKLPLHLGWRF  183

Query  626  ML  631
            ML
Sbjct  184  ML  185



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   146 bits (369),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 3/132 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  231
            M D  P     S  I  FDP KK  KRNK+A A A LAS+ S+LLGYDIGVMSGA IY++
Sbjct  9    MSDPPP--TTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLK  66

Query  232  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  411
            +D  I+DTQ+ +L+GILN+Y L GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TN
Sbjct  67   EDWHISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATN  126

Query  412  YTFLMVGRFVAG  447
            Y FLMVGRFV G
Sbjct  127  YAFLMVGRFVTG  138


 Score =   108 bits (270),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN AF ++  HLSWRF
Sbjct  138  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFSSLPTHLSWRF  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   149 bits (375),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K +KRNKYA+A + LAS+ S+LLGYD GVMSGA  +IQ+DL I D QVE+L+G +N+Y
Sbjct  33   PKKPLKRNKYALAISILASMTSVLLGYDCGVMSGATQFIQEDLIITDVQVELLVGTINIY  92

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SL+GS +AGRTSDW+GRRYT+V AS +FF+GAILMGF+TNY FLMVGRFVAG
Sbjct  93   SLVGSAVAGRTSDWVGRRYTIVFASTIFFLGAILMGFATNYAFLMVGRFVAG  144


 Score =   106 bits (264),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSNFAF  + + L WR 
Sbjct  144  GIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNFAFAKLPLTLGWRM  203

Query  626  ML  631
            ML
Sbjct  204  ML  205



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   147 bits (372),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D     N  SG     I  FDPP K K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQAADNNVVSGQPQNSIADFDPPTKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  403  STNYTFLMVGRFVAG  447
            + NY FLM GRF+AG
Sbjct  121  APNYAFLMFGRFIAG  135


 Score =   107 bits (266),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNFAF  + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFAFAKLPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   157 bits (396),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQK
Sbjct  1    MTDRRAQDNAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQK  57

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLKI+D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMG +TNY
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGLATNY  117

Query  415  TFLMVGRFVAG  447
             FLMVGRFVAG
Sbjct  118  AFLMVGRFVAG  128


 Score = 97.4 bits (241),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF  + + L WR 
Sbjct  128  GIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFSGLPIDLGWRL  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   151 bits (382),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKIND Q++IL G
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTG  79

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             LN+YSLIGS +AGRTSDWIGRRYT+V++  +FFVGAILMG +  Y FLM GRFVAG
Sbjct  80   TLNIYSLIGSALAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAG  136


 Score =   102 bits (255),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL+WRF
Sbjct  136  GIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHLAWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   156 bits (395),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEANAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  415  TFLMVGRFVAG  447
             FLMVGRFVAG
Sbjct  118  AFLMVGRFVAG  128


 Score = 97.4 bits (241),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF  + + L WR 
Sbjct  128  GIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFSGLPIDLGWRL  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   144 bits (362),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 103/136 (76%), Gaps = 8/136 (6%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D    RN  S       IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA 
Sbjct  1    MADGMSARNGVSSAPSHLPIPAFDPPRKPKRNKYALACSFLASMTSILLGYDIGVMSGAI  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            IYI+K++ + D Q E+++GILNLYSL+GS  AGRTSD    RYT++ A  +FF GA+LMG
Sbjct  61   IYIRKNIHMTDVQKEVIMGILNLYSLLGSAAAGRTSDC---RYTIIFAGAIFFAGALLMG  117

Query  400  FSTNYTFLMVGRFVAG  447
            F+T+Y FLMVGRFVAG
Sbjct  118  FATSYAFLMVGRFVAG  133


 Score =   110 bits (274),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFINFGIL+GYVSN+AF  +  +L WRF
Sbjct  133  GIGVGYALMIAPVYTAEVAPASTRGFLTSFPEVFINFGILLGYVSNYAFSKLPTNLGWRF  192

Query  626  ML  631
            ML
Sbjct  193  ML  194



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   146 bits (369),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K+  RNKYA A A LAS+ SILLGYDIGVMSGAAI I+K L +ND +VE+L+GI+NLY
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SL+GS +AGRTSDW+GRRYTMV+A  +FFVGAILM F+ NY FLM GRFVAG
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAG  139


 Score =   107 bits (266),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFG+L+GYVSN+ F  + ++L WRF
Sbjct  139  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINLGWRF  198

Query  626  ML  631
            ML
Sbjct  199  ML  200



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   154 bits (390),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
            + A    +  FDP K  +RNKYA A A LAS+ SILLGYD+GVMSGA IYI++DLK+ D 
Sbjct  5    KTATQKSLQDFDPQKTPRRNKYAFACAILASMTSILLGYDVGVMSGAIIYIKRDLKLTDV  64

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            Q+EIL+GI+NLYSLIGSC+AGRTSDWIGRRYT+V+A  +FF GAILMG S NY FLM  R
Sbjct  65   QIEILVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGAILMGISPNYPFLMFAR  124

Query  436  FVAG  447
            F+AG
Sbjct  125  FIAG  128


 Score = 99.0 bits (245),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYT EV+P S RGFLTSFPEVFIN GIL+GY+SN+ F  +S+ L WR 
Sbjct  128  GVGIGYALMIAPVYTTEVSPPSCRGFLTSFPEVFINGGILLGYISNYGFSKLSLELGWRM  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   151 bits (382),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D+   ++ GS  I  FD  KK KRNKYA   A LAS+ S+LLGYDIGVMSGAAIYI+  L
Sbjct  11   DSGGSKDVGSPVI--FDAVKKPKRNKYAFGCAILASMTSVLLGYDIGVMSGAAIYIKDQL  68

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
             ++D ++EI++GI+N +SL+GS +AGRTSDWIGRRYTMV+A  +FFVGAILMGF+TNY+F
Sbjct  69   HVSDVKLEIVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAGAIFFVGAILMGFATNYSF  128

Query  421  LMVGRFVAG  447
            LM GRFVAG
Sbjct  129  LMFGRFVAG  137


 Score =   102 bits (253),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+ AS RGFLTSFPEVFIN G+L+GYVSN+AF  +  +L WRF
Sbjct  137  GIGVGYALMIAPVYTAEVSSASSRGFLTSFPEVFINIGVLLGYVSNYAFSKLPANLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>gb|KCW55335.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=467

 Score =   146 bits (369),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K+  RNKYA A A LAS+ SILLGYDIGVMSGAAI I+K L +ND +VE+L+GI+NLY
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SL+GS +AGRTSDW+GRRYTMV+A  +FFVGAILM F+ NY FLM GRFVAG
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAG  139


 Score =   107 bits (266),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFG+L+GYVSN+ F  + ++L WRF
Sbjct  139  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINLGWRF  198

Query  626  ML  631
            ML
Sbjct  199  ML  200



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   155 bits (393),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M D R   +A SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLKI+D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TNY
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNY  117

Query  415  TFLMVGRFVAG  447
             FLMVGRFVAG
Sbjct  118  AFLMVGRFVAG  128


 Score = 97.4 bits (241),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF  + ++L WR 
Sbjct  128  GIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFSGLPINLGWRL  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   149 bits (376),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K  KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+Y
Sbjct  25   PCKNPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SL+G+ +AGRTSDWIGRRYT++ AS +FF GAILMGF+TNY FLM GRFVAG
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAG  136


 Score =   104 bits (259),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGF TSFPEVFIN G+L+GYVSN+AF  +   L WRF
Sbjct  136  GIGVGYALMIAPVYTAEVAPASCRGFFTSFPEVFINGGVLLGYVSNYAFSKLPTKLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   155 bits (391),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            F+  KK KRNK+A A A LASLASILLGYDIGVMSGA +YI+ DLKI+D QVEIL+GILN
Sbjct  25   FEVLKKPKRNKFAFACAILASLASILLGYDIGVMSGAILYIKDDLKISDVQVEILVGILN  84

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LY LIG+ +AGRTSDWIGRRYT+VVA+ +FFVGA+LMGF+TNYTFLMVGRFV G
Sbjct  85   LYCLIGAYVAGRTSDWIGRRYTIVVAASIFFVGALLMGFATNYTFLMVGRFVTG  138


 Score = 98.2 bits (243),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+AL+IAPVYTAEV+PAS RGFL SFPEVFIN G+L+GYVSN+AF  +   L WR 
Sbjct  138  GIGVGFALLIAPVYTAEVSPASARGFLNSFPEVFINAGLLLGYVSNYAFSKLRADLGWRV  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   150 bits (378),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%), Gaps = 3/126 (2%)
 Frame = +1

Query  79   NAGSGHIP---AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  249
            N  S  IP   A  PP+  K  ++A A A LAS+ SILLGYDIGVMSGAA++I+ DL ++
Sbjct  5    NLDSNIIPNEKADGPPRTKKNTRFASACALLASMTSILLGYDIGVMSGAALFIKDDLNVS  64

Query  250  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  429
            DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG S NY FLMV
Sbjct  65   DTQIEILLGILNLYSLLGSFAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLSPNYAFLMV  124

Query  430  GRFVAG  447
            GRFVAG
Sbjct  125  GRFVAG  130


 Score =   103 bits (256),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPE+FIN GIL+GYVSNFAF  +  H  WR 
Sbjct  130  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEMFINLGILLGYVSNFAFKGLPRHYGWRV  189

Query  626  ML  631
            ML
Sbjct  190  ML  191



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   142 bits (359),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
             YDIGVMSGA++YIQKDLKINDTQ+E+L+GILN+YSLIGS  AGRTSDWIGRR+T+V A+
Sbjct  45   AYDIGVMSGASLYIQKDLKINDTQLEVLMGILNVYSLIGSFAAGRTSDWIGRRFTIVFAA  104

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
            V+FF GA++MGFS NY  LM GRFVAG
Sbjct  105  VIFFAGALIMGFSVNYAMLMFGRFVAG  131


 Score =   110 bits (274),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSNFAF  +S+ L WR 
Sbjct  131  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRLGWRI  190

Query  626  ML  631
            ML
Sbjct  191  ML  192



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   149 bits (376),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 102/132 (77%), Gaps = 5/132 (4%)
 Frame = +1

Query  52   IMGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  231
            +MGD +P  N      PA     K +   +A A A LAS+ASILLGYDIGVMSGAAI+I+
Sbjct  49   VMGDQKPEANIMEAVAPA-----KSRNKMFAFACAVLASMASILLGYDIGVMSGAAIFIK  103

Query  232  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  411
             DLKI+D QVEILLGILNLYSL+GS  AG TSDWIGRRYT+V A+ +FFVGAILMGF+TN
Sbjct  104  DDLKISDVQVEILLGILNLYSLVGSYAAGFTSDWIGRRYTIVFAAGIFFVGAILMGFATN  163

Query  412  YTFLMVGRFVAG  447
            Y FLM GRFVAG
Sbjct  164  YAFLMAGRFVAG  175


 Score =   103 bits (256),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAE+APAS RGFLTSFPEVFIN GIL+GYVSN+ F ++   L WRF
Sbjct  175  GIGVGYALMIAPVYTAEIAPASSRGFLTSFPEVFINSGILLGYVSNYGFAHLRQSLGWRF  234

Query  626  ML  631
            ML
Sbjct  235  ML  236



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   150 bits (379),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            PP K   NKYA   A LASLASILLGYDIGVMSGA ++I+ DLK+NDTQ+EILLG+LNLY
Sbjct  19   PPPKRGYNKYATGCAMLASLASILLGYDIGVMSGAELFIKDDLKLNDTQIEILLGVLNLY  78

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SL+GS  AG TSDWIGRRYT+V A+ +FF GA+LMGF+TNY FLMVGRFVAG
Sbjct  79   SLVGSFAAGFTSDWIGRRYTIVFAATIFFTGALLMGFATNYAFLMVGRFVAG  130


 Score =   102 bits (253),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAP YTAEVAPAS RGFLTSFPEVFIN GIL+GYVSN+AF ++   L WR 
Sbjct  130  GIGVGYALMIAPTYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYAFSHLRESLGWRL  189

Query  626  ML  631
            ML
Sbjct  190  ML  191



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   149 bits (377),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKIND Q++IL G
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTG  79

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             LN+YSL+GS +AGRTSDWIGRRYT+V++  +FFVGAILMG +  Y FLM GRFVAG
Sbjct  80   TLNIYSLVGSGLAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAG  136


 Score =   102 bits (255),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL+WRF
Sbjct  136  GIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHLAWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   149 bits (376),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            I  FD PKK K +K+AIA A LA   SILLG+DIGVMSGA+++I+++LKI+D QVE+L G
Sbjct  20   IEDFDHPKKPKTSKFAIACALLACTTSILLGFDIGVMSGASLFIKENLKISDVQVEVLAG  79

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             LN+YSL+GS +AGRTSDWIGR+YT+V+A V+F VGA+LMGF+TNY FLMVGRFVAG
Sbjct  80   TLNIYSLLGSALAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMVGRFVAG  136


 Score =   103 bits (256),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++N+AF  + +HL+WRF
Sbjct  136  GVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFAKLPLHLAWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_004148312.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=492

 Score =   144 bits (364),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYD+GVMSGAAIYI+KD +IND Q E+++G++NLY+LIG+  AGRTSDWIGRRYTMV+A 
Sbjct  14   GYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYALIGAAAAGRTSDWIGRRYTMVLAG  73

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
            V+FF+GAILMGF+TNY FLM GRFVAG
Sbjct  74   VIFFLGAILMGFATNYEFLMFGRFVAG  100


 Score =   107 bits (267),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMI+PVYTAEV+PAS RGFLTSFPEVFINFG+L+GY+SNF F  + +HL WRF
Sbjct  100  GIGVGYALMISPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSKLPLHLGWRF  159

Query  626  ML  631
            ML
Sbjct  160  ML  161



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   153 bits (386),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D R   NA +G      I  FD P K K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDRPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            ++I+++LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+FFVGA+LMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFFVGALLMG  120

Query  400  FSTNYTFLMVGRFVAG  447
            F+TNY FLMVGRFVAG
Sbjct  121  FATNYAFLMVGRFVAG  136


 Score = 99.0 bits (245),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVG+ +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++N+A   + +HL WRF
Sbjct  136  GVGVGFGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYALSKLPLHLGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   152 bits (383),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D  P +      +  FDP KK KRNKYA A A LAS+ASILLGYDIGVMSGA  YIQ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKRNKYAFACAILASVASILLGYDIGVMSGAKDYIQTDL  69

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            K++D QV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDVQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFTGALLMGFSTNYAF  129

Query  421  LMVGRFVAG  447
            LMV RFVAG
Sbjct  130  LMVARFVAG  138


 Score = 99.8 bits (247),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYT EV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  +L WR 
Sbjct  138  GIGVGFALMIAPVYTTEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSKLPTNLGWRI  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   154 bits (389),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M D R   +A SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDRRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  415  TFLMVGRFVAG  447
             FLMVGRFVAG
Sbjct  118  AFLMVGRFVAG  128


 Score = 97.4 bits (241),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF  + ++L WR 
Sbjct  128  GIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFSGLPINLGWRL  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   149 bits (376),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K V RNKYA+A + LAS+ S+LLGYD GVMSGA +YI+ DLKI+D QVE+L+G +N+Y
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINIY  93

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SL+GS +AGRTSDW+GRRYT V ASVVFFVGAILMG +TNY FLM GRFVAG
Sbjct  94   SLVGSAVAGRTSDWVGRRYTTVFASVVFFVGAILMGIATNYVFLMAGRFVAG  145


 Score =   102 bits (254),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEVAPAS RGFLTSFPEVFINFG+L+G+VSN+AF    + L WR 
Sbjct  145  GIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGFVSNYAFAKFPLKLGWRM  204

Query  626  ML  631
            ML
Sbjct  205  ML  206



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   149 bits (375),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FD  KK + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK+++ Q+EIL+GI+N
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GA+LMGFS N+ FLM  RF+AG
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAG  129


 Score =   102 bits (254),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +S+ L WR 
Sbjct  129  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLSLRLGWRV  188

Query  626  ML  631
            ML
Sbjct  189  ML  190



>gb|AAY86779.1| putative sugar transporter protein [Noccaea caerulescens]
Length=253

 Score =   151 bits (382),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +1

Query  94   HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            H+P +  PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLK  D Q+ IL
Sbjct  20   HLPESGPPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKCTDLQIGIL  79

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             G LN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGFS NY FLM GRFVAG
Sbjct  80   AGSLNIYSLVGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSPNYAFLMFGRFVAG  138


 Score = 99.8 bits (247),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GI++GYVSN AF    + + WR 
Sbjct  138  GVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKVGWRL  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   145 bits (365),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P K KRNKYA+A + LAS+ S+LLGY  GVMSGA IYI++DLKI+D Q+EIL+G +N+YS
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGY--GVMSGATIYIKRDLKISDVQIEILVGTINIYS  88

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GS +AGRTSDWIGRRYT+V AS +FF GAILMGF+ NY FLMVGRFVAG
Sbjct  89   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAG  139


 Score =   106 bits (264),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSN+AF  + + L WR 
Sbjct  139  GIGVGYALMIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAKLPLKLGWRL  198

Query  626  ML  631
            ML
Sbjct  199  ML  200



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   142 bits (358),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  261
            A  G +P    PKK    ++A A A LAS+ SILLGYDIGVMSGAA++I++DL+I+D +V
Sbjct  13   ASDGRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEV  72

Query  262  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  441
            EILLGILNLYSLIGS  AGRTSDWIGRR T+++A+ +FFVGA +MGFS NY  LM GRFV
Sbjct  73   EILLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFV  132

Query  442  AG  447
            AG
Sbjct  133  AG  134


 Score =   108 bits (270),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ L WR 
Sbjct  134  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKLGWRL  193

Query  626  ML  631
            ML
Sbjct  194  ML  195



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   151 bits (381),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAG  128


 Score = 99.8 bits (247),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G GVG+A MIAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRF
Sbjct  128  GFGVGFAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   150 bits (379),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D  P +      +  FDP KK KRNK+A A A  AS+ASILLGYDIGVMSGA  YIQ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKRNKFAFACAITASVASILLGYDIGVMSGAKDYIQTDL  69

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            K++D QV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDVQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAF  129

Query  421  LMVGRFVAG  447
            LMV RFVAG
Sbjct  130  LMVARFVAG  138


 Score =   100 bits (248),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYT EV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  +L WR 
Sbjct  138  GIGVGFALMIAPVYTTEVSPASSRGFLTSFPEVFINVGILLGYVSNYAFSKLPTNLGWRI  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   151 bits (381),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAG  128


 Score = 99.8 bits (247),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G GVG+A MIAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRF
Sbjct  128  GFGVGFAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   147 bits (371),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            K  KRNKYA+A + LAS+ SILLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+YSL
Sbjct  10   KSPKRNKYALACSLLASMTSILLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIYSL  69

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +G+ +AGRTSDWIGRRYT+++AS++FFVGAILMGF+ NY FLM GRFVAG
Sbjct  70   VGAAIAGRTSDWIGRRYTIILASLIFFVGAILMGFAPNYWFLMFGRFVAG  119


 Score =   103 bits (257),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGF TSFPEVFIN G+L+GY+SN+AF  +   L WRF
Sbjct  119  GIGVGYALMIAPVYTAEVAPASCRGFFTSFPEVFINGGVLLGYISNYAFSKLPTKLGWRF  178

Query  626  ML  631
            ML
Sbjct  179  ML  180



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   144 bits (362),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
            R A  G      PP+K    ++A A A LAS+ SILLGYDIGVMSGAA++I++DLKI+D 
Sbjct  11   RVASDGLPDGVAPPRKKSNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKISDV  70

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            +VE+LLGILNLYSLIGS  AGRTSDWIGRR T+++A+V+FFVGA +MGFS NY  LM GR
Sbjct  71   EVEVLLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLMAGR  130

Query  436  FVAG  447
            FVAG
Sbjct  131  FVAG  134


 Score =   106 bits (265),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ + WR 
Sbjct  134  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKVGWRL  193

Query  626  ML  631
            ML
Sbjct  194  ML  195



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   142 bits (358),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  261
            A  G +P    PKK    ++A A A LAS+ SILLGYDIGVMSGAA++I++DL+I+D +V
Sbjct  13   ASDGRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEV  72

Query  262  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  441
            EILLGILNLYSLIGS  AGRTSDWIGRR T+++A+ +FFVGA +MGFS NY  LM GRFV
Sbjct  73   EILLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFV  132

Query  442  AG  447
            AG
Sbjct  133  AG  134


 Score =   108 bits (269),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ L WR 
Sbjct  134  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKLGWRL  193

Query  626  ML  631
            ML
Sbjct  194  ML  195



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   150 bits (380),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAG  128


 Score = 99.8 bits (247),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G GVG+A MIAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRF
Sbjct  128  GFGVGFAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   149 bits (377),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +1

Query  94   HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            H+P +  P K  KRN YA A A LAS+ SILLGYDIGVMSGA IYI++DLKIND Q+ IL
Sbjct  19   HVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGIL  78

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             G LN+YSLIGSC AGRTSDWIGRRYT+V+A  +FF GAILMG S NY FLM GRF+AG
Sbjct  79   AGSLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAG  137


 Score =   100 bits (250),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFL SFPEVFIN GI++GYVSN AF N+ + + WR 
Sbjct  137  GIGVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGIMLGYVSNLAFSNLPLKVGWRL  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   144 bits (362),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            S  +P    PKK    K+A A A L+S+ SILLGYDIGVMSGA++YI+KDLK++D +VE+
Sbjct  3    SAALPEAVAPKKKGNFKFAFACAILSSMTSILLGYDIGVMSGASLYIKKDLKLSDGKVEV  62

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA+LMGFS N+  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALLMGFSVNFGMLMFGRFVAG  122


 Score =   106 bits (264),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + + L WR 
Sbjct  122  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRLGWRV  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   149 bits (377),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +1

Query  106  FDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            FDP KK  + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK++D Q+EIL+GI+
Sbjct  19   FDPQKKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIRRDLKLSDVQIEILVGII  78

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            NL+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GAILMGFS N+ FLM  RF+AG
Sbjct  79   NLFSLIGSCLAGRTSDWIGRRYTIVLAGAIFFAGAILMGFSPNFPFLMFARFIAG  133


 Score =   100 bits (248),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  + + L WR 
Sbjct  133  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLPLELGWRV  192

Query  626  ML  631
            ML
Sbjct  193  ML  194



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   147 bits (371),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  190  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  369
            YDIGVMSGAAIYIQKDLKI+D Q+EILLGILN+YSL GS  AGRTSDWIGRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIQKDLKISDVQIEILLGILNVYSLFGSAAAGRTSDWIGRRYTIVLAGA  60

Query  370  VFFVGAILMGFSTNYTFLMVGRFVAG  447
            +FF GA+LMGF+TNY FLMVGRFVAG
Sbjct  61   IFFAGALLMGFATNYVFLMVGRFVAG  86


 Score =   102 bits (254),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR 
Sbjct  86   GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLGWRL  145

Query  626  ML  631
            ML
Sbjct  146  ML  147



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   145 bits (365),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +1

Query  70   PVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  246
            P   A S  +P    PP+K    ++A A A LAS+ SILLGYDIGVMSGAA++I++DLKI
Sbjct  8    PTNRAASDGLPDGVAPPRKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKI  67

Query  247  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  426
            +D +VE+LLGILNLYSL+GS  AGRTSDWIGRR T+++A+V+FFVGA +MGFS NY  LM
Sbjct  68   SDVEVEVLLGILNLYSLLGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLM  127

Query  427  VGRFVAG  447
             GRFVAG
Sbjct  128  AGRFVAG  134


 Score =   104 bits (260),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF ++S+ + WR 
Sbjct  134  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINIGILLGYVSNYAFSHLSLKVGWRL  193

Query  626  ML  631
            ML
Sbjct  194  ML  195



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   149 bits (377),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            S  IP F P KK KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D  +E+
Sbjct  13   SNKIPEFVPLKKPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVAIEV  72

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+G +N+YSL+G+ +AGRTSDWIGRRYT+++AS +F VGA+LMGF+ NY FLM GRFVAG
Sbjct  73   LVGTINIYSLVGAAIAGRTSDWIGRRYTIILASGIFLVGALLMGFAPNYWFLMFGRFVAG  132


 Score =   100 bits (248),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGF TSFPEVFIN G+L+GY++N+AF  + + L WR 
Sbjct  132  GIGVGYALMIAPVYTAEVAPASCRGFCTSFPEVFINAGVLLGYIANYAFSMLPLKLGWRL  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   150 bits (379),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAG  128


 Score = 99.0 bits (245),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G GVG+A MIAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRF
Sbjct  128  GFGVGFAGMIAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   145 bits (366),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIP----AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D +P   A S   P    A + PKK  RNKYA+A A LAS+ SIL GYD+ VMSGA++
Sbjct  1    MDDQKPRAPAISDPPPNQTLALEKPKKPPRNKYALACATLASMTSILSGYDVAVMSGASV  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +IQKDL+INDTQ+EIL GI+N++SL+GS  AGRTSDWIGRRYT++ A+ +FF GA+LMG 
Sbjct  61   FIQKDLEINDTQIEILAGIINIFSLVGSVAAGRTSDWIGRRYTIIFAAAIFFAGALLMGL  120

Query  403  STNYTFLMVGRFVAG  447
            +TNY FLMVGRFVAG
Sbjct  121  ATNYAFLMVGRFVAG  135


 Score =   103 bits (258),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RGFLTSFPEVFIN G+L+GYVSNFAF  +  HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSNFAFAKLPDHLNWRI  194

Query  626  M  628
            M
Sbjct  195  M  195



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   144 bits (363),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  190  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  369
            YDIGVMSGAAIYI+ DLKI+D +VE+LLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGA  60

Query  370  VFFVGAILMGFSTNYTFLMVGRFVAG  447
            +FFVGA+LMGF+TNY FLM GRFVAG
Sbjct  61   IFFVGALLMGFATNYAFLMFGRFVAG  86


 Score =   105 bits (261),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR 
Sbjct  86   GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRL  145

Query  626  ML  631
            ML
Sbjct  146  ML  147



>gb|ACJ85869.1| unknown [Medicago truncatula]
 gb|AFK48997.1| unknown [Medicago truncatula]
Length=434

 Score =   149 bits (375),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FD  KK + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK+++ Q+EIL+GI+N
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GA+LMGFS N+ FLM  RF+AG
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAG  129


 Score =   100 bits (248),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  + + L WR 
Sbjct  129  GIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLPLRLGWRV  188

Query  626  ML  631
            ML
Sbjct  189  ML  190



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   140 bits (353),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            PKK    ++A A A LAS+ SILLGYDIGVMSGA+++I+KDL+I+D QVE+L+GILN+YS
Sbjct  12   PKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLFIKKDLQISDVQVEVLMGILNVYS  71

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIGS  AGRTSDWIGRRYT+V A+V+FF GA++MGFS NY  LM GRFVAG
Sbjct  72   LIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALVMGFSVNYLMLMFGRFVAG  122


 Score =   108 bits (270),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  +S+ L WR 
Sbjct  122  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLSLRLGWRV  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   142 bits (358),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  85   GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
             S  +PA   P K    K+A A A LAS+ SILLGYDIGVMSGA++YI+KDLKI+D ++E
Sbjct  2    ASAPLPAAIEPGKKGNVKFAFACAILASMTSILLGYDIGVMSGASLYIKKDLKISDVKLE  61

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            IL+GILN+YSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVA
Sbjct  62   ILMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYWMLMFGRFVA  121

Query  445  G  447
            G
Sbjct  122  G  122


 Score =   106 bits (264),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + + L WR 
Sbjct  122  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRLGWRV  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   153 bits (387),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF GAILMG STNYTFLM GRFVAG
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAG  93


 Score = 95.5 bits (236),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF+N GIL+GY+SN+AF   ++ L WR 
Sbjct  93   GLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVFVNVGILLGYISNYAFSFCALDLGWRL  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   153 bits (387),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF GAILMG STNYTFLM GRFVAG
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAG  93


 Score = 95.5 bits (236),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF+N GIL+GY+SN+AF   ++ L WR 
Sbjct  93   GLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVFVNVGILLGYISNYAFSFCALDLGWRL  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   152 bits (384),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  216
            M D R   NA SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDNAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  217  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  396
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  397  GFSTNYTFLMVGRFVAG  447
            G +  Y FLM GRFVAG
Sbjct  121  GLAPGYAFLMFGRFVAG  137


 Score = 96.3 bits (238),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR+
Sbjct  137  GIGVGYGLMIAPVYTVEISPTLSRGFLTSFPEVFVNLGILLGYVSNYAFSKLPTNLGWRY  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_006856084.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   141 bits (355),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            +K KRNKYA+A AFLAS+ SILLGYDIGVMSGA I+I++DL+I+D +VEIL+G LN+Y L
Sbjct  17   EKPKRNKYALACAFLASMTSILLGYDIGVMSGAVIFIKEDLRISDVEVEILVGSLNIYCL  76

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            IGS  AGRTSDWIGRRYT+V AS +FFVGA++MGF+ NY FLM GR VAG
Sbjct  77   IGSFAAGRTSDWIGRRYTIVFASAIFFVGALMMGFAPNYAFLMAGRVVAG  126


 Score =   107 bits (266),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GIL GYVSNFAF  + +HL WR 
Sbjct  126  GIGVGYALMIAPVYTAEVAPASCRGFLTSFPEVFINAGILFGYVSNFAFERLPLHLGWRT  185

Query  626  ML  631
            ML
Sbjct  186  ML  187



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   153 bits (386),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISR  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF GAILMG STNYTFLM GRFVAG
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAG  93


 Score = 95.5 bits (236),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF+N GIL+GY+SN+AF   ++ L WR 
Sbjct  93   GLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVFVNVGILLGYISNYAFSFCALDLGWRL  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>gb|EYU42630.1| hypothetical protein MIMGU_mgv1a0059091mg, partial [Erythranthe 
guttata]
Length=189

 Score =   159 bits (401),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            IP FDPPKK KRN YA+A +FLAS+ SILLGYDIGVMSGA IYIQ++  I   Q E+++G
Sbjct  18   IPGFDPPKKPKRNMYALACSFLASMTSILLGYDIGVMSGAIIYIQEEFGITSVQKEVVMG  77

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+YSL+GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TNY FLMVGRFVAG
Sbjct  78   ILNVYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVAG  134


 Score = 89.7 bits (221),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXN  598
            GIGVGYALMIAPVYTAEVAPAS RGFL+SFPEVFINFG  +GYVSNFAF  
Sbjct  134  GIGVGYALMIAPVYTAEVAPASSRGFLSSFPEVFINFGTQLGYVSNFAFSK  184



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   144 bits (364),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQFEILMGILNI  74

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YSLIGS MAGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  75   YSLIGSGMAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_006299557.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
 gb|EOA32455.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
Length=511

 Score =   144 bits (363),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAVPEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_010468639.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   144 bits (363),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   140 bits (354),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  70   SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  129

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  130  LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  189


 Score =   107 bits (266),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + ++L WR 
Sbjct  189  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRI  248

Query  626  ML  631
            ML
Sbjct  249  ML  250



>emb|CBI32562.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   147 bits (372),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+KDLKI+D +VEIL+GILN+Y L GS  AGRTSDWIGRRYT+V+AS
Sbjct  7    GYDIGVMSGAAIYIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRYTIVLAS  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
            V+FF+GA+LMGF+TNY FLMVGRFVAG
Sbjct  67   VIFFLGALLMGFATNYVFLMVGRFVAG  93


 Score =   100 bits (248),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVY AEV+PAS RGF+TSFPEVFIN GIL GY+SN+AF  +  +L WRF
Sbjct  93   GIGVGYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSKLPTNLGWRF  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   140 bits (354),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122


 Score =   107 bits (266),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + ++L WR 
Sbjct  122  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRI  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_010516958.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   145 bits (367),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            +PP+   R +YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRTQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YSLIGS  AGRTSDWIGRRYT+V+A V FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGVFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   102 bits (253),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+G+VSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGFVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_010484928.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=512

 Score =   143 bits (360),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +   +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+G
Sbjct  12   VTELEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMG  70

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  71   ILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   104 bits (259),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GY+SN+ F  +  HLSWRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYLSNYFFSKLPEHLSWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   140 bits (354),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122


 Score =   106 bits (265),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + ++L WR 
Sbjct  122  GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRI  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score =   146 bits (368),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPP+K KRNK+AIA + +A   SILLGYDIGVMSGA ++IQ DLKIND Q++IL G LN
Sbjct  9    FDPPQKPKRNKFAIACSLMACTTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTGTLN  68

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YS++GS +AGRTSDWIGRRYT  ++  +F VGAILMG +  YTFLM GRFVAG
Sbjct  69   IYSVLGSALAGRTSDWIGRRYTAFLSGAIFSVGAILMGVAQGYTFLMFGRFVAG  122


 Score =   101 bits (251),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL WRF
Sbjct  122  GIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHLYWRF  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   153 bits (387),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF GAILMG STNYTFLM GRFVAG
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAG  93


 Score = 94.0 bits (232),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF+N GIL+GY+SN+AF   ++ + WR 
Sbjct  93   GLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVFVNVGILLGYISNYAFSFCALDVGWRL  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   145 bits (365),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
            D  P +      +  FDP KK K NK+A A A LAS+ASILLGYDIGVMSGA  YI+ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKGNKFAFACAILASMASILLGYDIGVMSGAKDYIKIDL  69

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            K++DTQV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDTQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAF  129

Query  421  LMVGRFVAG  447
            LMV RFV G
Sbjct  130  LMVARFVTG  138


 Score =   102 bits (253),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  +L WR 
Sbjct  138  GIGVGFALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILIGYVSNYAFSKLPTNLGWRI  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   144 bits (362),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
             G + A   P +  RN++A A A LAS+ SI+LGYDIGV+SGAAI+I+ DLK++D Q+EI
Sbjct  8    QGVVVAEPEPPRGNRNRFAFACAILASMTSIILGYDIGVISGAAIFIKDDLKLSDVQLEI  67

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GILN+YS+IGS +AGRTSDWIGRRYT+V+A   FF GAILMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSIIGSGVAGRTSDWIGRRYTIVLAGAFFFCGAILMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   150 bits (380),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  216
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEESAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  217  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  396
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  397  GFSTNYTFLMVGRFVAG  447
            G +  Y FLM GRFVAG
Sbjct  121  GLAPGYAFLMFGRFVAG  137


 Score = 96.3 bits (238),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR+
Sbjct  137  GIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYVSNYAFSKLPTNLGWRY  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|NP_179209.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
 sp|Q9XIH7.1|PLT1_ARATH RecName: Full=Putative polyol transporter 1 [Arabidopsis thaliana]
 gb|AAD26954.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06467.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
Length=511

 Score =   142 bits (357),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGA+I+I+ DLK++D Q+EIL
Sbjct  9    GVVIAESEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSL+GS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   104 bits (260),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFLTSFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_002886203.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62462.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   143 bits (360),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVIADSEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDWIGRR+T+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRFTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   152 bits (384),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  103  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            A    K +K N Y  A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D ++EIL+GI 
Sbjct  13   AHQTRKNLKLNNYTFACAILASITSILLGYDIGVMSGAAIYIKRDLKLSDVKIEILVGIF  72

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            NLYSL+GSC+AGRTSDWIGRRYT+V A  +FFVGAILMGFS NY FLM GRFVAG
Sbjct  73   NLYSLVGSCLAGRTSDWIGRRYTIVFAGAIFFVGAILMGFSPNYAFLMFGRFVAG  127


 Score = 94.4 bits (233),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYTAE++P S RGFLTSF +VFIN GIL+GY+SN+A   M++ L WR 
Sbjct  127  GVGMGYALMIAPVYTAELSPPSSRGFLTSFTDVFINVGILLGYISNYALSKMTLKLGWRM  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>dbj|BAJ86526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   139 bits (351),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  103  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL GI+
Sbjct  11   AMAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGII  70

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ++YSL+GS MAG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAG
Sbjct  71   SIYSLLGSLMAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAG  125


 Score =   107 bits (266),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP S RGFLT+FPEVF NFGIL+GYVSNFAF  + VHLSWR 
Sbjct  125  GIGVGYALMIAPVYTAEVAPTSSRGFLTTFPEVFNNFGILLGYVSNFAFARLPVHLSWRA  184

Query  626  M  628
            M
Sbjct  185  M  185



>ref|XP_002884156.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60415.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   143 bits (360),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVADSEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   150 bits (378),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  216
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  217  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  396
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  397  GFSTNYTFLMVGRFVAG  447
            G +  Y FLM GRFVAG
Sbjct  121  GLAPGYAFLMFGRFVAG  137


 Score = 96.3 bits (238),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR+
Sbjct  137  GIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYVSNYAFSKLPTNLGWRY  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   144 bits (364),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P K K  ++A A A LAS+ SILLGYDIGVMSGAAI+I+ DLKI+DTQVEILLGILNLYS
Sbjct  17   PAKRKSKRFAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLKISDTQVEILLGILNLYS  76

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GS  AG TSDWIGRRYT+V A+ +FFVGA+LMGF+ NY FLM GRFVAG
Sbjct  77   LVGSYAAGFTSDWIGRRYTIVFAAGIFFVGALLMGFAVNYAFLMFGRFVAG  127


 Score =   101 bits (252),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSN+ F  +   L WR 
Sbjct  127  GIGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYGFARLRESLGWRL  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   149 bits (377),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +1

Query  61   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  240
             +R V        P F PP K  +NKYA+A A LA ++S+LLGYD GVMSG  IYIQ+DL
Sbjct  5    QSRAVTRGVESSNPDFGPPPKATKNKYALACALLACMSSVLLGYDTGVMSGGMIYIQRDL  64

Query  241  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  420
            KI+D Q E+L+G +N+YSL+GS +AGRT DW+GRRYT+ +A V+FFVGA LM F+TNY F
Sbjct  65   KISDVQKEVLVGTINVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFVGAFLMAFATNYAF  124

Query  421  LMVGRFVAG  447
            LMVGRFVAG
Sbjct  125  LMVGRFVAG  133


 Score = 96.7 bits (239),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVY+AE++P S+RGF+TSF EVFINFG+L+GYVSN+ F  +  +L WRF
Sbjct  133  GIGVGYAMMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAKLPTNLGWRF  192

Query  626  ML  631
            M+
Sbjct  193  MM  194



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   150 bits (378),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  216
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  217  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  396
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  397  GFSTNYTFLMVGRFVAG  447
            G +  Y FLM GRFVAG
Sbjct  121  GLAPGYAFLMFGRFVAG  137


 Score = 96.3 bits (238),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR+
Sbjct  137  GIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYVSNYAFSKLPTNLGWRY  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   142 bits (359),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            + PKK  RNKYA+A A LAS+ SILLGYDI VMSGA+++I+KDLKINDTQ+EIL GI+N+
Sbjct  2    EKPKKPPRNKYALACATLASMTSILLGYDIAVMSGASVFIKKDLKINDTQIEILAGIINI  61

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +SL+GS  AGRTSDWIGRRYT++ A+ +FF GA+LMGF+TNY FLMVGRF+AG
Sbjct  62   FSLVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGFATNYAFLMVGRFIAG  114


 Score =   103 bits (256),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RGFLTSFPEVFIN G+L+GYVSNFAF  +  HL+WR 
Sbjct  114  GVGVGYALMIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSNFAFAKLPYHLNWRI  173

Query  626  M  628
            M
Sbjct  174  M  174



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   138 bits (348),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            S  +P    P K    ++A A A LAS+ SILLGYDIGVMSGA++YI+KDL I D Q+EI
Sbjct  3    SAALPEAVEPGKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDLGITDVQLEI  62

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+GILN+YSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYGMLMFGRFVAG  122


 Score =   107 bits (268),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ L WR 
Sbjct  122  GVGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSHLSLRLGWRV  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   142 bits (359),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
             +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN
Sbjct  15   LEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILN  73

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  74   IYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (256),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPDHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_003558585.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=526

 Score =   137 bits (344),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  103  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++
Sbjct  16   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  75

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAG
Sbjct  76   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAG  130


 Score =   108 bits (271),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR 
Sbjct  130  GIGVGYALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRA  189

Query  626  M  628
            M
Sbjct  190  M  190



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   144 bits (362),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 101/136 (74%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFD-----PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D +P     +  +P         P+     +YA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVAPQVPHDSLLEAVAPRPRHNKRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            ++++ DL +NDTQ+EILLGILNL+S++GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG
Sbjct  61   LFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  400  FSTNYTFLMVGRFVAG  447
             + NY FLMVGRFVAG
Sbjct  121  LAPNYAFLMVGRFVAG  136


 Score =   101 bits (252),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYAL+IAPVYT E+APAS RGFLTSFPEVFIN GIL+GYVSNFAF  + V+L WR 
Sbjct  136  GVGVGYALVIAPVYTTELAPASSRGFLTSFPEVFINSGILLGYVSNFAFSKLPVNLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   140 bits (354),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL
Sbjct  9    GVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   104 bits (260),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  + VHL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSKLPVHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_010442571.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=518

 Score =   142 bits (358),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YS+IGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (256),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   142 bits (357),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P+K    KYA   A LAS+A I++GYDIGVMSGAAIYI+KDL I D Q+EI++GILN+YS
Sbjct  7    PRKKSNVKYASMCAILASMAVIIVGYDIGVMSGAAIYIKKDLNITDVQLEIVMGILNIYS  66

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIGS  AGRTSDWIGRR+T+V A+V+FF G++LMGF+ NY  LM GRFVAG
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVFAAVIFFAGSLLMGFAVNYAMLMAGRFVAG  117


 Score =   103 bits (257),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYA+MIAPVYTAE++PA+VRGFLTSFPEVFIN GIL+GYVSNFAF  + ++L WR 
Sbjct  117  GVGVGYAIMIAPVYTAEISPAAVRGFLTSFPEVFINVGILLGYVSNFAFARLPLYLGWRV  176

Query  626  ML  631
            ML
Sbjct  177  ML  178



>gb|KFK40045.1| hypothetical protein AALP_AA3G322700 [Arabis alpina]
Length=487

 Score =   142 bits (357),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AG
Sbjct  75   YSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFIAG  127


 Score =   103 bits (257),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_010495901.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=511

 Score =   142 bits (357),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWMGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_010472919.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   142 bits (357),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAG  127


 Score =   103 bits (256),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   145 bits (365),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI DTQ+ IL G LN+Y
Sbjct  27   PAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKITDTQIGILAGSLNIY  86

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AG
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAG  138


 Score = 99.8 bits (247),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFL SFPEVFIN GI++GYVSN AF    + L WR 
Sbjct  138  GIGVGYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRL  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_010472942.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   142 bits (357),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAG  127


 Score =   103 bits (256),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>gb|KFK41272.1| hypothetical protein AALP_AA2G108500 [Arabis alpina]
Length=444

 Score =   142 bits (359),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  75   YSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   102 bits (254),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  H+ WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_009121242.1| PREDICTED: putative polyol transporter 1, partial [Brassica rapa]
Length=247

 Score =   140 bits (353),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL
Sbjct  9    GVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   104 bits (259),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  + VHL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSKLPVHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   141 bits (356),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  231
            M +++    A  G IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA ++++
Sbjct  1    MSNSKQHDAADDGGIPAPEAPAKRPPLNKYALACAVLASMNSILLGYDVSVMSGAQLFMK  60

Query  232  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  411
            +DLKI DTQ+EIL GI+N+YSL+GS  AGRTSDW+GRRYTMV+A+ +FF GA++MG + +
Sbjct  61   QDLKITDTQIEILAGIINIYSLVGSLAAGRTSDWLGRRYTMVLAAAIFFAGALIMGLAPS  120

Query  412  YTFLMVGRFVAG  447
            YT LM+GRFVAG
Sbjct  121  YTILMLGRFVAG  132


 Score =   103 bits (256),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEV+P S RG LTSFPEVFIN G+L+GYVSN+AF  + VHLSWR 
Sbjct  132  GVGVGYALMIAPVYTAEVSPTSARGLLTSFPEVFINTGVLLGYVSNYAFHGLPVHLSWRV  191

Query  626  M  628
            M
Sbjct  192  M  192



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   140 bits (354),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL
Sbjct  9    GVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   103 bits (257),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  + VH+ WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAKLPVHIGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   147 bits (370),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  100  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGI  279
            P   PP K KRNKYA+A A LA ++S+LLGYD GVMSGA IYIQ+DLKIND Q EIL+G 
Sbjct  18   PDSVPPPKPKRNKYALACALLACMSSVLLGYDTGVMSGAMIYIQRDLKINDVQKEILVGT  77

Query  280  LNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +N+YSL+GS +AGRT DWIGRRYT+ +A V+FF GAILM  +TNY FLM GRFVAG
Sbjct  78   INVYSLLGSAIAGRTCDWIGRRYTIAMAGVIFFAGAILMACATNYAFLMFGRFVAG  133


 Score = 97.1 bits (240),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVY+AE++P S+RGF+TSF EVFINFG+L+GYVSN+ F  ++ +L WRF
Sbjct  133  GLGVGYALMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAKLATNLGWRF  192

Query  626  ML  631
            M+
Sbjct  193  MM  194



>ref|NP_179210.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
 sp|Q9XIH6.1|PLT2_ARATH RecName: Full=Putative polyol transporter 2 [Arabidopsis thaliana]
 gb|AAD26955.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06468.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
Length=511

 Score =   143 bits (361),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   100 bits (250),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYT EVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  H+ WRF
Sbjct  127  GIGVGYAMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|XP_008668471.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA43976.1| TPA: hypothetical protein ZEAMMB73_311171 [Zea mays]
Length=524

 Score =   137 bits (345),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  103  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++
Sbjct  11   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  70

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMGF+  Y FLMVGRFVAG
Sbjct  71   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGFAPGYGFLMVGRFVAG  125


 Score =   107 bits (266),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR 
Sbjct  125  GIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRA  184

Query  626  M  628
            M
Sbjct  185  M  185



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   148 bits (374),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGA++YI+KDLK+ DTQ+EILLGIL +YSLIGS MAG+TSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGASLYIEKDLKVTDTQIEILLGILEIYSLIGSAMAGKTSDWVGRRYTIVISG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FFVGAILMG STNYTFLM GRFVAG
Sbjct  67   AIFFVGAILMGLSTNYTFLMCGRFVAG  93


 Score = 95.5 bits (236),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYAL IAPVY+AEVAPAS RGFLTSFPEVF+N GI++GY+SN+AF    + L WR 
Sbjct  93   GIGVGYALTIAPVYSAEVAPASSRGFLTSFPEVFVNIGIVLGYLSNYAFSFCPLDLGWRL  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   146 bits (369),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P+     +YA A A LAS+ SI+LGYDIGVMSGAA++I+ DL +NDTQ+EILLGILNLYS
Sbjct  26   PRPRHNKRYACACAMLASMTSIILGYDIGVMSGAALFIEDDLHVNDTQIEILLGILNLYS  85

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ++GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG + NY FLMVGRFVAG
Sbjct  86   IVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLAPNYAFLMVGRFVAG  136


 Score = 97.4 bits (241),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYA +IA VYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  +L WR 
Sbjct  136  GVGVGYAAVIAAVYTAEVAPASSRGFLTSFPEVFINCGILLGYVSNFAFSKLPENLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>dbj|BAJ93158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   139 bits (349),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  88   SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
            +  IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E
Sbjct  6    AADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIE  65

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            IL GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVA  125

Query  445  G  447
            G
Sbjct  126  G  126


 Score =   104 bits (260),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GY+SNFAF  + VHLSWR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAFHGLPVHLSWRA  185

Query  626  M  628
            M
Sbjct  186  M  186



>dbj|BAJ86116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   139 bits (349),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  88   SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
            +  IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E
Sbjct  6    AADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIE  65

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            IL GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVA  125

Query  445  G  447
            G
Sbjct  126  G  126


 Score =   104 bits (260),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GY+SNFAF  + VHLSWR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAFHGLPVHLSWRA  185

Query  626  M  628
            M
Sbjct  186  M  186



>ref|NP_001049269.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|ABF94464.1| mannitol transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11183.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|EAY88905.1| hypothetical protein OsI_10384 [Oryza sativa Indica Group]
 gb|EAZ25930.1| hypothetical protein OsJ_09774 [Oryza sativa Japonica Group]
 dbj|BAG91937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=517

 Score =   137 bits (346),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  103  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            A  P K+   NKYA   A LAS+ S+LLGYDI VMSGA I++++DLKI DTQ+EIL G++
Sbjct  10   AVAPAKRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVI  69

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAG
Sbjct  70   NIYSLFGSLAAGMTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAG  124


 Score =   105 bits (263),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP S RGFLTSFPEVF N GIL+GYVSNFAF  + VHLSWR 
Sbjct  124  GIGVGYALMIAPVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFARLPVHLSWRA  183

Query  626  M  628
            M
Sbjct  184  M  184



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   152 bits (384),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  27   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINL  86

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YS +GS +AGRTSDWIGRRYT+V+A  +FFVGAILMGFS NY FLM GRF AG
Sbjct  87   YSPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAG  139


 Score = 91.3 bits (225),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+G+A +IAPVYT+E++P+S RGFLTS PEVF+N GIL+GY+SN+ F  +++ L WR 
Sbjct  139  GVGIGFAFLIAPVYTSEISPSSSRGFLTSLPEVFLNGGILIGYISNYGFSKLALRLGWRL  198

Query  626  ML  631
            ML
Sbjct  199  ML  200



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   139 bits (349),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGAAIYI+  L ++D ++EI++GI+N +SL+GS +AGRTSDWIGRRYTMV+A 
Sbjct  7    GYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FFVGAILMGF+TNY+FLM GRFVAG
Sbjct  67   AIFFVGAILMGFATNYSFLMFGRFVAG  93


 Score =   104 bits (260),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN G+L+GYVSN+AF  +  +L WRF
Sbjct  93   GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINIGVLLGYVSNYAFSKLPANLGWRF  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   140 bits (353),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  127  KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGS  306
             R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS
Sbjct  21   NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGS  80

Query  307  CMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
              AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  81   GAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   102 bits (255),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYV N+ F  + VHL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVXNYFFSKLPVHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   137 bits (345),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGA+++I+++LKI+D QVEI+ G LNLYSLIGS +AGRTSDWIGRRYT+V+A 
Sbjct  7    GYDIGVMSGASLFIKENLKISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF+GA+LMGF+ NY FLM GRFVAG
Sbjct  67   TIFFIGALLMGFAPNYAFLMFGRFVAG  93


 Score =   105 bits (263),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+AF  + +HL+WR 
Sbjct  93   GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVSNYAFSKLPIHLNWRI  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   152 bits (384),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  14   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINL  73

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YS +GS +AGRTSDWIGRRYT+V+A  +FFVGAILMGFS NY FLM GRF AG
Sbjct  74   YSPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAG  126


 Score = 90.9 bits (224),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+G+A +IAPVYT+E++P+S RGFLTS PEVF+N GIL+GY+SN+ F  +++ L WR 
Sbjct  126  GVGIGFAFLIAPVYTSEISPSSSRGFLTSLPEVFLNGGILIGYISNYGFSKLALRLGWRL  185

Query  626  ML  631
            ML
Sbjct  186  ML  187



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   138 bits (348),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKR-NKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  252
            +   S  IPA + P K +  NKYA+A A LAS+ SILLGYD+ VMSGA +++++DLKI D
Sbjct  3    KQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITD  62

Query  253  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  432
            TQ+EIL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+ +FF GA++MG + +Y  LM+G
Sbjct  63   TQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLG  122

Query  433  RFVAG  447
            RFVAG
Sbjct  123  RFVAG  127


 Score =   104 bits (260),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSN+AF ++ VHLSWR 
Sbjct  127  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPVHLSWRV  186

Query  626  M  628
            M
Sbjct  187  M  187



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   143 bits (361),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = +1

Query  94   HIPAF--DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            H+P+    P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DL I DTQ+ I
Sbjct  19   HVPSELGVPAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLDITDTQIGI  78

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L G LN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AG
Sbjct  79   LAGSLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAG  138


 Score = 99.8 bits (247),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFL SFPEVFIN GI++GYVSN AF    + L WR 
Sbjct  138  GIGVGYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRL  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   138 bits (348),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +1

Query  76   RNAGSGHIPAFDPPKKVKR-NKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  252
            +   S  IPA + P K +  NKYA+A A LAS+ SILLGYD+ VMSGA +++++DLKI D
Sbjct  3    KQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITD  62

Query  253  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  432
            TQ+EIL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+ +FF GA++MG + +Y  LM+G
Sbjct  63   TQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLG  122

Query  433  RFVAG  447
            RFVAG
Sbjct  123  RFVAG  127


 Score =   104 bits (260),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSN+AF ++ VHLSWR 
Sbjct  127  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPVHLSWRV  186

Query  626  M  628
            M
Sbjct  187  M  187



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   142 bits (358),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D +   NA SG      I  FDPP+K   NK+AIA A LA + SILLGYDIGVMSGA 
Sbjct  4    MTDQKVEDNAVSGEPQNKRIADFDPPEKPNANKFAIACATLACMTSILLGYDIGVMSGAN  63

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            I+I+ DLKI D QVEIL G LN+YSLIGS +AG TSDWIGRRYT+V++  +FFVGAILMG
Sbjct  64   IFIKDDLKITDVQVEILAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFVGAILMG  123

Query  400  FSTNYTFLMVGRFVAG  447
             +  Y  LM GRFVAG
Sbjct  124  VAPGYGLLMFGRFVAG  139


 Score =   100 bits (250),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGY LMIAPVYT E++PA  RGFLTSFPEVF+N GIL+GYVSN+AF  + VH+ WRF
Sbjct  139  GVGVGYGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPVHMGWRF  198

Query  626  ML  631
            ML
Sbjct  199  ML  200



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   140 bits (354),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  127  KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGS  306
             R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS
Sbjct  22   NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGS  81

Query  307  CMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
              AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  82   GAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  128


 Score =   102 bits (253),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  128  GIGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAKLPGHLGWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   145 bits (367),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDP  K KRNK+AIA + LA   SILLGYDIGVMSGA + IQ DLKIND Q++IL G LN
Sbjct  9    FDPSLKPKRNKFAIACSLLACTPSILLGYDIGVMSGANLSIQDDLKINDVQIQILTGTLN  68

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YS+IGS +AGRTSDWIGRRYT V++  +FFVGAILMGF+  Y FLM GRFVAG
Sbjct  69   IYSVIGSALAGRTSDWIGRRYTAVLSGAIFFVGAILMGFAPGYAFLMFGRFVAG  122


 Score = 96.7 bits (239),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +   L WRF
Sbjct  122  GIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAPLYWRF  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|NP_001150711.1| LOC100284344 [Zea mays]
 gb|ACG40102.1| polyol transporter protein 4 [Zea mays]
 gb|AFW89354.1| polyol transporter protein 4 [Zea mays]
Length=531

 Score =   135 bits (341),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  79   NAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  255
            + G+  +P A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DT
Sbjct  2    STGTDAVPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDT  61

Query  256  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  435
            Q+EIL G++N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y FLM GR
Sbjct  62   QIEILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGFLMAGR  121

Query  436  FVAG  447
            FVAG
Sbjct  122  FVAG  125


 Score =   107 bits (266),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR 
Sbjct  125  GIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRA  184

Query  626  M  628
            M
Sbjct  185  M  185



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   141 bits (356),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +1

Query  94   HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            H+P +  P K  KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D ++ IL
Sbjct  19   HVPESVLPAKPPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLEIGIL  78

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             G LN+YSLIGSC AG+TSD IGRRYT+V+A  +FF GAILMG + NY FLM GRFVAG
Sbjct  79   AGSLNIYSLIGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAG  137


 Score =   100 bits (250),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WR 
Sbjct  137  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRL  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_010905473.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=523

 Score =   140 bits (353),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  97   IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  276
            +P    P+  + NK+A+A   LAS+ +I+LGYDIGVMSGAAI+IQ D  ++DT++EILLG
Sbjct  20   LPTAVAPQPWRNNKFAMACGALASMTTIVLGYDIGVMSGAAIFIQDDFHVSDTEIEILLG  79

Query  277  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            ILN+ SLIGS  AGRT+DWIGRRYT+V A+ +FFVGAILMG + NY FLMVGRF+ G
Sbjct  80   ILNISSLIGSLAAGRTADWIGRRYTIVFAAGIFFVGAILMGLAPNYAFLMVGRFITG  136


 Score =   101 bits (252),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA +IA VYTAEVAPAS RGFL SFPEVFINFGILVGY+SNFAF  +  HLSWR 
Sbjct  136  GIGVGYAGVIAAVYTAEVAPASSRGFLVSFPEVFINFGILVGYLSNFAFARLPEHLSWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_010445995.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   141 bits (355),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  91   GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  270
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+E+L
Sbjct  9    GVVVAEPKPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEVL  68

Query  271  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GILN+YS+IGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  69   MGILNIYSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127


 Score =   100 bits (249),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+MIAPVYTAEVAPAS RGFL+ FPE+FIN GIL+GYVSN+ F  +  HL WRF
Sbjct  127  GIGVGYAMMIAPVYTAEVAPASSRGFLSFFPEIFINIGILLGYVSNYFFSKLPEHLGWRF  186

Query  626  ML  631
            ML
Sbjct  187  ML  188



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   147 bits (371),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGA+IYI+KDLK+ DTQ+EI++G++ +YSLIGS MAG+TSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGASIYIEKDLKVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISG  66

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF+GAILMGFSTNYTFLM GRFVAG
Sbjct  67   AIFFIGAILMGFSTNYTFLMCGRFVAG  93


 Score = 94.0 bits (232),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYAL IAPVY+AEV+P S RGFLTSFPEVF+N GIL+GY+SN+AF    + L WR 
Sbjct  93   GIGVGYALTIAPVYSAEVSPTSSRGFLTSFPEVFVNIGILLGYLSNYAFSFCPLDLGWRL  152

Query  626  ML  631
            ML
Sbjct  153  ML  154



>ref|XP_007200584.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01783.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=335

 Score =   138 bits (347),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  193  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  372
            DIGVMSGAAIYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +
Sbjct  26   DIGVMSGAAIYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAI  85

Query  373  FFVGAILMGFSTNYTFLMVGRFVAG  447
            FF GA+LMGF+ NY FLM GRF+AG
Sbjct  86   FFAGALLMGFAPNYAFLMFGRFIAG  110


 Score =   103 bits (256),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVSN+ F  +  HL WR 
Sbjct  110  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVSNYGFSKLPTHLGWRL  169

Query  626  ML  631
            ML
Sbjct  170  ML  171



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   137 bits (344),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            SG  P      K K+N YA+  + +AS+ SILLGYD GVMSGA +YI+KDLKI D QVEI
Sbjct  14   SGGSPTKALINKPKKNMYALLISVMASMTSILLGYDTGVMSGATLYIKKDLKITDVQVEI  73

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L+G++N+YSLIGS +AGRTSD++GRR T+V+ASV+FFVGA +MG + NY  LMVGRFVAG
Sbjct  74   LVGLINIYSLIGSAVAGRTSDYLGRRITIVIASVIFFVGAAVMGLANNYAVLMVGRFVAG  133


 Score =   103 bits (258),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVY AEVAPAS RGFLTSFPEVFINFG+L+GY+SN+AF   S+ L WR 
Sbjct  133  GLGVGYALMIAPVYAAEVAPASSRGFLTSFPEVFINFGVLLGYLSNYAFAKFSLKLGWRL  192

Query  626  ML  631
            ML
Sbjct  193  ML  194



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   152 bits (385),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            F P KK+KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI++DLK+ D Q+EILLGI+N
Sbjct  15   FGPQKKLKRNKFACACAILASMTSILLGYDIGVMSGAAIYIKRDLKVTDVQIEILLGIIN  74

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LYS IGS +AGR SDWIGRRYT+V+A ++FFVGA+LMG S NY FLM GRF AG
Sbjct  75   LYSPIGSYIAGRLSDWIGRRYTIVLAGLIFFVGAVLMGLSPNYAFLMFGRFFAG  128


 Score = 88.2 bits (217),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+G+A +IAPVYT+EV+P S RGFLTS PEVF+N GILVGY+SN+ F  + +   WR 
Sbjct  128  GVGIGFAFLIAPVYTSEVSPTSSRGFLTSLPEVFLNGGILVGYISNYGFSKLPLRYGWRV  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   139 bits (349),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  219
            M D +   NA SG      I  FDPP+K   +K+AIA A LA + SILLGYDIGVMSGA 
Sbjct  1    MTDRKVEDNAVSGEPQNKRIADFDPPEKPNASKFAIACATLACMTSILLGYDIGVMSGAN  60

Query  220  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  399
            I+I+ DLKI D QVE+L G LN+YSLIGS +AG TSDWIGRRYT+V++  +FF+GAILMG
Sbjct  61   IFIKDDLKITDVQVEVLAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFIGAILMG  120

Query  400  FSTNYTFLMVGRFVAG  447
             +  Y  LM GRFVAG
Sbjct  121  VAPGYGLLMFGRFVAG  136


 Score =   101 bits (252),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMIAPVYT E++PA  RGFLTSFPEVF+N GIL+GYVSN+AF  + VH+ WRF
Sbjct  136  GIGVGYGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPVHMGWRF  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   135 bits (339),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P+K KRN YA+  + LAS+ SI+ GYD+ VMSGA ++I+ DLKI+DT++EIL GI+N+YS
Sbjct  4    PEKPKRNMYALGCSCLASMTSIVSGYDVAVMSGANLFIKNDLKIDDTKIEILAGIINVYS  63

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +IGS  AGRTSDWIGRRYTM++A  +FF GA++M  + NY  LM GRFVAG
Sbjct  64   IIGSIAAGRTSDWIGRRYTMILACAIFFTGALVMALAPNYAILMAGRFVAG  114


 Score =   105 bits (261),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYA MIAPVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSNFAF  +  HLSWR 
Sbjct  114  GVGVGYAFMIAPVYAAEVAPASSRGFLTSFPEVFINFGVLLGYVSNFAFAGLPEHLSWRM  173

Query  626  M  628
            M
Sbjct  174  M  174



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   135 bits (339),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            P K +  ++A+A A +AS+ SILLGYDIGVMSGA I+I+ +L I DTQVEIL+G+ +LYS
Sbjct  18   PAKRQNKRFAMACATIASMVSILLGYDIGVMSGAVIFIKDNLHITDTQVEILVGVFHLYS  77

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIGS  AGRTSDWIGRR T++ A+V+FFVGA++MG + NY FLMVGRFVAG
Sbjct  78   LIGSTAAGRTSDWIGRRCTIIFAAVIFFVGALMMGLAPNYAFLMVGRFVAG  128


 Score =   105 bits (261),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP S RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL+WR 
Sbjct  128  GIGVGYALMIAPVYTAEVAPTSCRGFLTSFPEVFINGGILLGYVSNYAFAGLPNHLNWRL  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   140 bits (352),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  112  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  291
            P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D ++ +L G LN+Y
Sbjct  27   PGKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDFEIGVLAGSLNIY  86

Query  292  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            SLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AG
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAG  138


 Score =   100 bits (248),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFL SFPEVFIN GI++GYVSN AF    + L WR 
Sbjct  138  GIGVGYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRL  197

Query  626  ML  631
            ML
Sbjct  198  ML  199



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   142 bits (358),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M D +   ++ S H  A  P  K KRN YA A + +AS+AS+LLGYDIGVMSGA I+IQK
Sbjct  1    MSDRQHETSSISYH-SAPPPATKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            D KI+D ++EIL+GI++LY+++G+  AGRTSDWIGRRYTM +A+  FFVGAILMG STNY
Sbjct  60   DFKISDVKLEILVGIISLYAILGTAAAGRTSDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  415  TFLMVGRFVAG  447
            +FLM GRF AG
Sbjct  120  SFLMFGRFFAG  130


 Score = 97.4 bits (241),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+G+A +IAPVYT E++PA+ RG  TSFPE+FIN GIL+GYVSNFAF  +  HLSWRF
Sbjct  130  GIGIGFASLIAPVYTTEISPAASRGCFTSFPEIFINVGILLGYVSNFAFSKLPTHLSWRF  189

Query  626  ML  631
            ML
Sbjct  190  ML  191



>ref|XP_006649563.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=521

 Score =   134 bits (336),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            K+   NKYA   A LAS+ S+LLGYDI VMSGA I++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVINIYSL  75

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAG
Sbjct  76   FGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAG  125


 Score =   105 bits (263),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP S RGFLTSFPEVF N GIL+GYVSNFAF  + VHLSWR 
Sbjct  125  GIGVGYALMIAPVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFARLPVHLSWRA  184

Query  626  M  628
            M
Sbjct  185  M  185



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   134 bits (338),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D R   N   G     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  403  STNYTFLMVGRFVAG  447
            + NY FLM GRF+AG
Sbjct  121  APNYAFLMFGRFIAG  135


 Score =   105 bits (261),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNFA   + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAKLPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   134 bits (338),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D R   N   G     I  FDPPKK K  K+AIA A LAS+ SILLGYDIGVMSGA++
Sbjct  3    MADQRAENNVVFGQHQNSIADFDPPKKPKTKKFAIACAVLASMTSILLGYDIGVMSGASL  62

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  403  STNYTFLMVGRFVAG  447
            + NY FLM GRF+AG
Sbjct  123  APNYAFLMFGRFIAG  137


 Score =   105 bits (261),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNFA   + +HL+WR 
Sbjct  137  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAKLPIHLNWRI  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   152 bits (384),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
             K K NKYA+A + LAS+ SILLGYDIGVMSGA IYIQKDLKI D Q E+++GILNLYSL
Sbjct  4    SKAKTNKYALACSILASMTSILLGYDIGVMSGAIIYIQKDLKITDVQTEVVMGILNLYSL  63

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            IGS  AGRTSDWIGRRYT+V A V+FF GA+LMGF+TNY FLM GRFVAG
Sbjct  64   IGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMAGRFVAG  113


 Score = 87.0 bits (214),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVG+A+MIAPVY AEV+P + RG  TS PEVFIN GIL+GYVSN AF  + + + WR 
Sbjct  113  GVGVGFAMMIAPVYAAEVSPPASRGLFTSLPEVFINIGILLGYVSNVAFSGLPLDIGWRL  172

Query  626  ML  631
            ML
Sbjct  173  ML  174



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   134 bits (338),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D R   N   G     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  403  STNYTFLMVGRFVAG  447
            + NY FLM GRF+AG
Sbjct  121  APNYAFLMFGRFIAG  135


 Score =   105 bits (261),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNFA   + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAKLPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>gb|KCW55336.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=425

 Score =   132 bits (333),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            G +IGVMSGAAI I+K L +ND +VE+L+GI+NLYSL+GS +AGRTSDW+GRRYTMV+A 
Sbjct  11   GTNIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLYSLLGSAVAGRTSDWVGRRYTMVIAG  70

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FFVGAILM F+ NY FLM GRFVAG
Sbjct  71   AIFFVGAILMAFAFNYAFLMFGRFVAG  97


 Score =   106 bits (265),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFG+L+GYVSN+ F  + ++L WRF
Sbjct  97   GIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINLGWRF  156

Query  626  ML  631
            ML
Sbjct  157  ML  158



>ref|XP_004985339.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=523

 Score =   132 bits (332),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            K+   NKYA A+A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRAPINKYAFASALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y  LMVGRFVAG
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYALLMVGRFVAG  125


 Score =   107 bits (266),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR 
Sbjct  125  GIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRA  184

Query  626  M  628
            M
Sbjct  185  M  185



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   137 bits (346),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  193  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  372
            DIGVMSGAA++++ DL +NDTQ+EILLGILNL+S++GS  AGRTSDWIGRRYT+V A+V+
Sbjct  17   DIGVMSGAALFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVI  76

Query  373  FFVGAILMGFSTNYTFLMVGRFVAG  447
            FFVGAI+MG + NY FLMVGRFVAG
Sbjct  77   FFVGAIMMGLAPNYAFLMVGRFVAG  101


 Score =   101 bits (251),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYAL+IAPVYT E+APAS RGFLTSFPEVFIN GIL+GYVSNFAF  + V+L WR 
Sbjct  101  GVGVGYALVIAPVYTTELAPASSRGFLTSFPEVFINSGILLGYVSNFAFSKLPVNLGWRL  160

Query  626  ML  631
            ML
Sbjct  161  ML  162



>gb|EMS50618.1| Polyol transporter 5 [Triticum urartu]
Length=311

 Score =   136 bits (343),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  97   IPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  273
            IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E+L 
Sbjct  9    IPAGEAPAKRAPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLHITDTQIEVLA  68

Query  274  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG +  Y  LM+GRFVAG
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPGYAVLMLGRFVAG  126


 Score =   102 bits (254),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GY+SN+AF  + VHLSWR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNYAFHGLPVHLSWRA  185

Query  626  M  628
            M
Sbjct  186  M  186



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   133 bits (335),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  222
            M D R   N  SG     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMS A++
Sbjct  1    MADQRAENNVVSGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSXASL  60

Query  223  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  402
            +I+++L I+D QVE+L G  N+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTXNIYSLIGSALAGKTSDWIGRRYTIVLAETIFFIGALLMGF  120

Query  403  STNYTFLMVGRFVAG  447
            + NY FLM GRF+AG
Sbjct  121  APNYAFLMFGRFIAG  135


 Score =   105 bits (261),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNFA   + +HL+WR 
Sbjct  135  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAELPIHLNWRI  194

Query  626  ML  631
            ML
Sbjct  195  ML  196



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   133 bits (335),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGA+++I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A 
Sbjct  51   GYDIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAG  110

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF+GA+LMGF+ NY FLM GRF+AG
Sbjct  111  TIFFIGALLMGFAPNYAFLMFGRFIAG  137


 Score =   105 bits (261),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNFA   + +HL+WR 
Sbjct  137  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAKLPIHLNWRI  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_004958139.1| PREDICTED: putative polyol transporter 1-like [Setaria italica]
Length=508

 Score =   136 bits (342),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            PKK     YA   + LAS+ASI+LGYDIGVMSGAA+YI+KDLKI D Q+EIL+GILN YS
Sbjct  7    PKKKSNVTYAFICSILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNFYS  66

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIGS  AGRTSDWIGRR+T+VVA+  FF GA+LMG + +Y  LM GRFVAG
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVVAAAFFFSGALLMGLAGDYATLMFGRFVAG  117


 Score =   102 bits (254),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGY LMIAPVYTAEV+PAS RGFLTSF EVFIN GIL+GYVSN+AF  + +HL WR 
Sbjct  117  GVGVGYGLMIAPVYTAEVSPASARGFLTSFSEVFINIGILLGYVSNYAFARLPLHLGWRV  176

Query  626  ML  631
            ML
Sbjct  177  ML  178



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   134 bits (338),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  205  MSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVG  384
            MSGAAIYI++DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +FFVG
Sbjct  1    MSGAAIYIKRDLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVG  60

Query  385  AILMGFSTNYTFLMVGRFVAG  447
            A+LMGFS NY FLM GRFVAG
Sbjct  61   ALLMGFSPNYNFLMFGRFVAG  81


 Score =   103 bits (257),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  +S+ L WR 
Sbjct  81   GVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYISNYAFSKLSLKLGWRM  140

Query  626  ML  631
            ML
Sbjct  141  ML  142



>ref|XP_006856085.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
 gb|ERN17552.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
Length=513

 Score =   134 bits (336),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            +K +RNKYA+A A LAS+ SILLGYDIGVMSGA ++I+ DL IND +VEIL+G LN++SL
Sbjct  14   EKPQRNKYALACATLASMTSILLGYDIGVMSGAILFIKDDLHINDVEVEILVGSLNIFSL  73

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            IGS  AGRTSD+IGRRYT+V A  +FFVGA++MGF+ NY FLM GR VAG
Sbjct  74   IGSAAAGRTSDYIGRRYTIVFAGGIFFVGALMMGFAPNYAFLMAGRVVAG  123


 Score =   104 bits (259),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSN+ F  +   LSWR 
Sbjct  123  GIGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINLGILLGYVSNYVFARLPEDLSWRL  182

Query  626  ML  631
            ML
Sbjct  183  ML  184



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   144 bits (362),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
             PP   KRN YA   + +AS+AS+LLGYDIGVMSGAAI+IQ+D +I+D +VEIL+GI++L
Sbjct  27   SPPPAAKRNNYAFVCSTMASMASVLLGYDIGVMSGAAIFIQEDFRISDLEVEILVGIISL  86

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            YS++GS  AGRTSDWIGRRYTM +A+  F VGA+LMG +TNY FLM GRF AG
Sbjct  87   YSILGSVAAGRTSDWIGRRYTMGIAAAFFLVGAVLMGLATNYAFLMFGRFFAG  139


 Score = 94.0 bits (232),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G G+A +IAPVYTAE++PA+ RG  T+FPE+FIN GIL+GYVSNFAF     HLSWRF
Sbjct  139  GVGTGFAGLIAPVYTAEISPAASRGCFTTFPEIFINVGILLGYVSNFAFSKFPTHLSWRF  198

Query  626  ML  631
            ML
Sbjct  199  ML  200



>ref|XP_010229631.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=520

 Score =   135 bits (340),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  94   HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  273
             +P    PKK    KYA   A +AS+ASI+LGYDIGV+SGA++YI+KDLKI D Q+EIL+
Sbjct  5    ELPEAVEPKKKSNLKYAFICAIVASMASIVLGYDIGVISGASLYIKKDLKITDAQLEILV  64

Query  274  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            GIL++YSLIGS  AGRTSDWIGRR+T+V  S  FF GA+LMGF+ +Y  LM GRFVAG
Sbjct  65   GILSIYSLIGSFAAGRTSDWIGRRFTVVFVSAFFFAGALLMGFAGSYAMLMFGRFVAG  122


 Score =   102 bits (254),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA++IAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+AF  + + L WRF
Sbjct  122  GIGVGYAMVIAPVYTAEISPASARGFLTSFPEVFINVGILLGYVSNYAFARLPLSLGWRF  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   137 bits (345),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            K  ++NKYA A A LAS+ S+LLGYD+GVMSGA I++ ++LKIN  +VE+L+G++NLYSL
Sbjct  20   KSPRKNKYAFACAILASMTSVLLGYDVGVMSGAIIFVVEELKINHVEVEVLMGVINLYSL  79

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +GS MAGRTSDWIGRRYT+V++  +FF GA+LMG + NY FLM GRFVAG
Sbjct  80   VGSAMAGRTSDWIGRRYTIVLSGAIFFAGALLMGLAPNYAFLMFGRFVAG  129


 Score =   100 bits (248),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMIAPVYTAEV+P S RGFLTSFPEVFIN G+L+GY+SN+AF  + + L WR 
Sbjct  129  GIGVGYGLMIAPVYTAEVSPVSSRGFLTSFPEVFINLGVLLGYISNYAFSKLPLKLGWRL  188

Query  626  ML  631
            ML
Sbjct  189  ML  190



>gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   140 bits (352),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            M D +   ++ S H  A  P  K KRN YA A + +AS+AS+LLGYDIGVMSGA I+IQK
Sbjct  1    MADRQHETSSISYH-SAPPPTNKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            D +I+D ++EIL+GI++LY++IG+  AGR SDWIGRRYTM +A+  FFVGAILMG STNY
Sbjct  60   DFQISDVKLEILVGIISLYAIIGTAAAGRISDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  415  TFLMVGRFVAG  447
            +FLM GRF AG
Sbjct  120  SFLMFGRFFAG  130


 Score = 97.1 bits (240),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG+G+A +IAPVYT E++PA+ RG  TSFPE+FIN GIL+GYVSNFAF  +  HLSWRF
Sbjct  130  GIGIGFASLIAPVYTTEISPAASRGCFTSFPEIFINVGILLGYVSNFAFSKLPTHLSWRF  189

Query  626  ML  631
            ML
Sbjct  190  ML  191



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   141 bits (355),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  67   RPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  246
            + +  +    I   + P K +R K+A+  A LAS+ SILLGYD GVMSGA I+I+ DLKI
Sbjct  6    QKIETSAVHEILEIESPNKYRRKKFALTCATLASMISILLGYDTGVMSGAIIFIKDDLKI  65

Query  247  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  426
            NDTQ+E+L+GI+NL SL+GS  AGRTSDWIGRRYT+V A+V+FFVGA+LMG + NY  LM
Sbjct  66   NDTQIEVLVGIINLCSLVGSVAAGRTSDWIGRRYTIVFAAVIFFVGALLMGLAPNYAVLM  125

Query  427  VGRFVAG  447
             GR VAG
Sbjct  126  AGRIVAG  132


 Score = 95.9 bits (237),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G GVGYALMIAPVYTAE+APA  RG LTSF E+FIN G+L+GYVSNFAF  +  HL WR 
Sbjct  132  GFGVGYALMIAPVYTAELAPALSRGLLTSFTEIFINAGVLLGYVSNFAFSKLPEHLGWRL  191

Query  626  ML  631
            ML
Sbjct  192  ML  193



>ref|XP_003562818.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=514

 Score =   135 bits (339),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +1

Query  85   GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
             S  +P    PKK    KYA   + LAS+A+I+LGYD+GVMSGA++YI+KDL+I D QVE
Sbjct  7    ASASLPEAVEPKK-SNFKYAFTCSILASMATIVLGYDVGVMSGASLYIKKDLQITDVQVE  65

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            IL+GIL+LY+L+GS  A RTSDWIGRR T+V A+ +FF G++LMGF+ NY  LMVGRFV 
Sbjct  66   ILIGILSLYALVGSFAASRTSDWIGRRVTVVFAATIFFTGSLLMGFAVNYAMLMVGRFVT  125

Query  445  G  447
            G
Sbjct  126  G  126


 Score =   102 bits (253),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYA+M+APVYTAEV+PAS RGFLTSF EVFINFGIL+GYVSN+AF  + + L WR 
Sbjct  126  GIGVGYAIMVAPVYTAEVSPASARGFLTSFTEVFINFGILLGYVSNYAFARLPLRLGWRV  185

Query  626  ML  631
            ML
Sbjct  186  ML  187



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   131 bits (329),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 5/131 (4%)
 Frame = +1

Query  67   RPVRNAGSGHIP----AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  234
            +P + A S  +P      + PK    NKYA+A A LAS+ S LLGYDI VMSGA+++IQK
Sbjct  3    KPKQPAVSDPLPNQTLGLEKPKP-PTNKYALACATLASMTSTLLGYDIAVMSGASVFIQK  61

Query  235  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  414
            DLK++DTQ+EIL G++NLYSLIGS  AGRTSDWIGRRYT++ A+ +FF GA+LMG + NY
Sbjct  62   DLKVSDTQIEILAGVINLYSLIGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGLAPNY  121

Query  415  TFLMVGRFVAG  447
              LMVGRFVAG
Sbjct  122  AILMVGRFVAG  132


 Score =   105 bits (263),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEVAP S RGFLTSFPEVFIN G+L+GYVSNFAF  +S H++WR 
Sbjct  132  GIGVGYALMIAPVYTAEVAPTSARGFLTSFPEVFINSGVLLGYVSNFAFSKLSYHINWRI  191

Query  626  M  628
            M
Sbjct  192  M  192



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   135 bits (340),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  88   SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
            S  +PA + P K+   NKYA+A A LAS+ SILLGYDI VMSGA  +++KDL I+D +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            +L GI+N+YSL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  445  G  447
            G
Sbjct  126  G  126


 Score =   101 bits (251),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSNFAF  + +H+ WR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYRLPLHIGWRV  185

Query  626  M  628
            M
Sbjct  186  M  186



>ref|XP_002468337.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
 gb|EER95335.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
Length=524

 Score =   130 bits (326),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y  LMVGRFVAG
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGLLMVGRFVAG  125


 Score =   106 bits (265),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR 
Sbjct  125  GIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRA  184

Query  626  M  628
            M
Sbjct  185  M  185



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   135 bits (340),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  88   SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  264
            S  +PA + P K+   NKYA+A A LAS+ SILLGYDI VMSGA  +++KDL I+D +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  265  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  444
            +L GI+N+YSL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  445  G  447
            G
Sbjct  126  G  126


 Score =   101 bits (251),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSNFAF  + +H+ WR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYRLPLHIGWRV  185

Query  626  M  628
            M
Sbjct  186  M  186



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   134 bits (338),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +1

Query  55   MGDTRPVRNAGSGH---IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  225
            M D R   N  S     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA+++
Sbjct  3    MADQRAKNNVVSSQPQNIVDFDPPKKPKTKKFAVACAILASMTSILLGYDIGVMSGASLF  62

Query  226  IQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFS  405
            I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF+
Sbjct  63   IKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFA  122

Query  406  TNYTFLMVGRFVAG  447
             NY FLM GRF+AG
Sbjct  123  PNYAFLMFGRFIAG  136


 Score =   102 bits (253),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPV TAE++PAS RGFLTSFPEVF+N GIL+GYVSNFA   + +HL+WR 
Sbjct  136  GVGVGYALMIAPVSTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFALAKLPIHLNWRI  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   138 bits (348),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  103  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  282
            A + PKK  RNKYA+A A LAS+ SIL GYD  VMSGA+++IQK LKINDTQVEIL GI+
Sbjct  21   ALEKPKKPPRNKYALACATLASMISILSGYDGAVMSGASVFIQKYLKINDTQVEILAGII  80

Query  283  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            N ++L+GS  AGRTSDWIGRRYT++ A+ +F  GA+LMG + NY  LMVGR VAG
Sbjct  81   NPFALVGSIAAGRTSDWIGRRYTIIFAAAIFLAGALLMGLAPNYAILMVGRLVAG  135


 Score = 98.2 bits (243),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+G+GYALMIAPVYTAE+AP S RGFLTSFP +FIN GIL+GYVSN AF  +  HL+WR 
Sbjct  135  GVGIGYALMIAPVYTAEIAPTSSRGFLTSFPALFINAGILLGYVSNLAFAKLPDHLNWRI  194

Query  626  M  628
            M
Sbjct  195  M  195



>ref|XP_010527168.1| PREDICTED: putative polyol transporter 1 [Tarenaya hassleriana]
Length=362

 Score =   134 bits (338),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  88   SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  267
            +G + +  P +   R  YA A A LAS++SI+LGYDIGV+SGA+I+IQ DLK++D Q+EI
Sbjct  8    AGTVTSQQPDRS--RRLYATACAVLASMSSIVLGYDIGVVSGASIFIQDDLKLSDLQLEI  65

Query  268  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +GILNLYS++GS +AGRTSDWIGRRYT+V+A   F  GA+LMGF+TNY F+MVGRFVAG
Sbjct  66   FMGILNLYSIVGSGLAGRTSDWIGRRYTIVLAGCFFIAGALLMGFATNYPFIMVGRFVAG  125


 Score =   102 bits (253),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY +MIAPVYT EVAPAS RGFL+SFPE+FIN GIL+GYVSNF F  +  HL WRF
Sbjct  125  GIGVGYGMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNFFFAQLPEHLGWRF  184

Query  626  ML  631
            ML
Sbjct  185  ML  186



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   133 bits (335),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  187  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  366
            GYDIGVMSGA+++I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A 
Sbjct  51   GYDIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAG  110

Query  367  VVFFVGAILMGFSTNYTFLMVGRFVAG  447
             +FF+GA+LMGF+ NY FLM GRF+AG
Sbjct  111  TIFFIGALLMGFAPNYAFLMFGRFIAG  137


 Score =   102 bits (255),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSNF    + +HL+WR 
Sbjct  137  GVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNFPLAKLPIHLNWRI  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_004958138.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=509

 Score =   130 bits (326),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  115  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  294
            PKK    KYA   A LAS+ASI+LGYDIGVMSGAA+YI+KDLKI D Q+EIL+GILN+YS
Sbjct  12   PKKKSNVKYASFCAILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNVYS  71

Query  295  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            LIGS  AGRTSDWIGRR+T+V A+ +FF GA+LMGF+ NY  LM GRFVAG
Sbjct  72   LIGSFAAGRTSDWIGRRFTVVFAAAIFFAGALLMGFAVNYAMLMAGRFVAG  122


 Score =   106 bits (264),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            G+GVGYA+MIAPVYTAE++PA+ RGFLTSFPEVFIN GIL+GYVSN+AF  + +HLSWR 
Sbjct  122  GVGVGYAIMIAPVYTAEISPAAARGFLTSFPEVFINIGILLGYVSNYAFARLPLHLSWRV  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   146 bits (369),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            F+P  K KRN +A A A LASL +ILLGYDIGVMSGA I+I+KDLKIND QVEIL+GILN
Sbjct  24   FEPANKPKRNLFAFACAVLASLTTILLGYDIGVMSGAIIFIKKDLKINDVQVEILVGILN  83

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            L  L+GS  AGRTSDWIGRRYT+V+A+ +FFVGA+LM F+TNY  LM GRF+ G
Sbjct  84   LCCLVGSFAAGRTSDWIGRRYTIVLANAIFFVGALLMAFATNYALLMFGRFIGG  137


 Score = 89.7 bits (221),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIG G+A+MIA VYTAE++PAS RGFLTSF EV IN GIL+GYVSN+AF  + ++L WRF
Sbjct  137  GIGAGFAIMIALVYTAELSPASSRGFLTSFTEVSINGGILLGYVSNYAFSKLPMNLGWRF  196

Query  626  ML  631
            ML
Sbjct  197  ML  198



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   141 bits (355),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  285
            FDPP+K K NK+AIA + +A   SIL GYDIGVMSGA ++I+ DLKIND Q++I  G LN
Sbjct  9    FDPPQKPKINKFAIACSLMACTTSILHGYDIGVMSGAYLFIKDDLKINDLQIQIFTGTLN  68

Query  286  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            +YS+IGS +AGRTSDWIGR+YT V++  +FFVGAILMG +  Y FLM GRFVAG
Sbjct  69   IYSVIGSALAGRTSDWIGRQYTAVLSGAIFFVGAILMGVAPGYAFLMFGRFVAG  122


 Score = 94.7 bits (234),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN  F  +  +LSWR 
Sbjct  122  GIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFLNIGILLGYVSNCVFSKLPANLSWRV  181

Query  626  ML  631
            ML
Sbjct  182  ML  183



>ref|XP_006827104.1| hypothetical protein AMTR_s00010p00243760 [Amborella trichopoda]
 gb|ERM94341.1| hypothetical protein AMTR_s00010p00243760 [Amborella trichopoda]
Length=521

 Score =   128 bits (321),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  109  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  288
            D  KK KRNKYA+A AFLAS+AS+LLGYD GVMSGAA++I+ DL IND QVEIL+G +N+
Sbjct  19   DRIKKPKRNKYALACAFLASMASVLLGYDTGVMSGAAMFIKDDLNINDIQVEILVGSINI  78

Query  289  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            Y+LIGS  AG TSDWIGRR T+  A  +FFVG+++MGF+ NY  L  GR VAG
Sbjct  79   YALIGSAFAGWTSDWIGRRKTIAFAGAIFFVGSVIMGFAPNYALLTAGRVVAG  131


 Score =   107 bits (267),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYT EVAP S+RGFLTSFPE+FIN G+L+GYVSNFAF ++S+ LSWR 
Sbjct  131  GIGVGYALMIAPVYTTEVAPTSIRGFLTSFPEIFINGGVLLGYVSNFAFADLSLQLSWRM  190

Query  626  ML  631
            ML
Sbjct  191  ML  192



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   135 bits (341),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 7/133 (5%)
 Frame = +1

Query  55   MGDTRPVRNAGSGHIPAFDP--PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  228
            M + +P  NA       FDP  P K  RNK+A A +FLAS+ S+LLGYD+GVMSGA IYI
Sbjct  1    MAEEKPENNAAF-----FDPAAPPKPTRNKFATACSFLASMTSVLLGYDVGVMSGAIIYI  55

Query  229  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  408
            Q+DL+I D Q E+++GI  LY+LIGS +AGR SD +GRR T+V A  +FF GA+ MG +T
Sbjct  56   QRDLQITDVQKEVIMGIFGLYALIGSAIAGRISDRVGRRLTIVFAGAIFFFGALFMGLAT  115

Query  409  NYTFLMVGRFVAG  447
            NY FLMVGRFVAG
Sbjct  116  NYAFLMVGRFVAG  128


 Score = 99.8 bits (247),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVG+ALMIAPVYTAEVAPAS RG L SFPE+FIN GIL+GYVSN AF  +  +L WRF
Sbjct  128  GIGVGHALMIAPVYTAEVAPASCRGLLLSFPELFINIGILLGYVSNLAFSKLPTNLGWRF  187

Query  626  ML  631
            ML
Sbjct  188  ML  189



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   132 bits (332),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  118  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  297
            K  K NKYA A A LAS+ SILLGYDIGVMSGA IYI++DL I+D ++ IL GILN++SL
Sbjct  27   KPPKMNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLNISDFKIGILAGILNIFSL  86

Query  298  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  447
            IGSC AG+TSD IGRRYT+V+A  +FF GAILMG + NY FLM GRFVAG
Sbjct  87   IGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAG  136


 Score =   102 bits (255),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  446  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFXNMSVHLSWRF  625
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF N  + L WR 
Sbjct  136  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSNFPLKLGWRL  195

Query  626  ML  631
            ML
Sbjct  196  ML  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500