BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF013F12

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    287   2e-89   Nicotiana tomentosiformis
ref|XP_009777506.1|  PREDICTED: protein ECERIFERUM 1-like               283   6e-89   Nicotiana sylvestris
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    280   3e-87   Nicotiana sylvestris
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    281   4e-87   Nicotiana sylvestris
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like               278   3e-86   Nicotiana tomentosiformis
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like               275   7e-85   Sesamum indicum [beniseed]
emb|CBI16764.3|  unnamed protein product                                261   4e-84   Vitis vinifera
emb|CBI16759.3|  unnamed protein product                                261   5e-84   Vitis vinifera
gb|KHN33999.1|  Protein WAX2                                            259   2e-83   Glycine soja [wild soybean]
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like               270   5e-83   Solanum tuberosum [potatoes]
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like               269   8e-83   Solanum tuberosum [potatoes]
ref|XP_010661477.1|  PREDICTED: protein ECERIFERUM 1-like               260   2e-82   
gb|KHN40120.1|  Protein WAX2                                            268   4e-82   Glycine soja [wild soybean]
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like               267   5e-82   Solanum lycopersicum
emb|CBI16761.3|  unnamed protein product                                266   1e-81   Vitis vinifera
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like               266   1e-81   Vitis vinifera
ref|XP_003521032.2|  PREDICTED: protein ECERIFERUM 1-like               267   2e-81   
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like               265   3e-81   Vitis vinifera
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like               265   3e-81   Solanum tuberosum [potatoes]
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like               263   2e-80   Vitis vinifera
emb|CAN81825.1|  hypothetical protein VITISV_014168                     273   3e-80   Vitis vinifera
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like               262   6e-80   Glycine max [soybeans]
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like               261   1e-79   Nicotiana tomentosiformis
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                    260   2e-79   
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g             260   2e-79   Phaseolus vulgaris [French bean]
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like               261   2e-79   Nicotiana tomentosiformis
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like               265   6e-79   
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                    258   1e-78   Vitis vinifera
ref|XP_009339873.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    247   2e-78   
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like               257   3e-78   Nicotiana sylvestris
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like               256   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like               256   7e-78   Cicer arietinum [garbanzo]
emb|CBI16760.3|  unnamed protein product                                266   1e-77   Vitis vinifera
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg                256   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like               254   1e-77   
emb|CAN60676.1|  hypothetical protein VITISV_029045                     254   1e-77   Vitis vinifera
gb|ACJ85705.1|  unknown                                                 248   2e-77   Medicago truncatula
gb|KJB67446.1|  hypothetical protein B456_010G191100                    252   4e-77   Gossypium raimondii
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like               254   4e-77   
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                    254   5e-77   Vitis vinifera
ref|XP_004510149.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    249   5e-77   
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like               254   6e-77   
ref|XP_003626834.1|  gl1-like protein                                   254   7e-77   Medicago truncatula
ref|XP_010479259.1|  PREDICTED: protein ECERIFERUM 1-like               243   7e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg             254   7e-77   Citrus clementina [clementine]
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like               253   9e-77   Fragaria vesca subsp. vesca
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg             253   9e-77   
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like               253   1e-76   
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1       253   2e-76   Theobroma cacao [chocolate]
ref|XP_010496699.1|  PREDICTED: protein ECERIFERUM 1-like               242   2e-76   
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    252   2e-76   Nicotiana sylvestris
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    252   2e-76   Nicotiana sylvestris
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    252   3e-76   Nicotiana sylvestris
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like               252   4e-76   
gb|KJB67445.1|  hypothetical protein B456_010G191100                    251   5e-76   Gossypium raimondii
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like               251   7e-76   Pyrus x bretschneideri [bai li]
ref|XP_009758897.1|  PREDICTED: uncharacterized protein LOC104211529    256   9e-76   Nicotiana sylvestris
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like               246   9e-76   
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like               251   1e-75   Fragaria vesca subsp. vesca
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg             250   2e-75   Citrus clementina [clementine]
gb|KHN30013.1|  Protein WAX2                                            249   2e-75   Glycine soja [wild soybean]
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein              250   3e-75   Medicago truncatula
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like               249   4e-75   
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like               249   4e-75   Eucalyptus grandis [rose gum]
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    249   5e-75   Cicer arietinum [garbanzo]
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like               249   6e-75   Sesamum indicum [beniseed]
ref|XP_002892018.1|  hypothetical protein ARALYDRAFT_887207             243   8e-75   
ref|XP_008356893.1|  PREDICTED: protein ECERIFERUM 1-like               241   9e-75   
gb|AAB87721.1|  maize gl1 homolog                                       248   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097746.1|  Protein WAX2                                       247   2e-74   
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg             248   2e-74   
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    246   4e-74   
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like               246   4e-74   Prunus mume [ume]
ref|XP_009339872.1|  PREDICTED: protein ECERIFERUM 1-like               241   4e-74   
gb|AAC24374.1|  CER1 protein                                            245   4e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like               246   5e-74   Populus euphratica
dbj|BAA11024.1|  possible aldehyde decarbonylase                        245   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    246   5e-74   
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2         246   6e-74   
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g             246   7e-74   Phaseolus vulgaris [French bean]
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like               246   7e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1         246   7e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004170720.1|  PREDICTED: protein ECERIFERUM 1-like               243   8e-74   
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like               246   8e-74   Tarenaya hassleriana [spider flower]
gb|AIE57503.1|  CER1                                                    245   1e-73   Camelina sativa [gold-of-pleasure]
ref|NP_171723.2|  protein ECERIFERUM 1                                  244   2e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KJB76288.1|  hypothetical protein B456_012G081500                    241   2e-73   Gossypium raimondii
ref|NP_001184890.1|  protein ECERIFERUM 1                               244   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    244   2e-73   
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg             244   2e-73   Prunus persica
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    244   3e-73   Solanum lycopersicum
gb|EMS51792.1|  Protein WAX2                                            239   3e-73   Triticum urartu
ref|XP_002320584.1|  ECERIFERUM 1 family protein                        244   4e-73   
gb|ABD28319.2|  Sterol desaturase                                       240   5e-73   Medicago truncatula
gb|KHN40121.1|  Protein WAX2                                            243   7e-73   Glycine soja [wild soybean]
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    243   9e-73   Pyrus x bretschneideri [bai li]
emb|CDP09364.1|  unnamed protein product                                243   9e-73   Coffea canephora [robusta coffee]
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    243   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    243   1e-72   Eucalyptus grandis [rose gum]
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like               243   1e-72   Eucalyptus grandis [rose gum]
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like               243   1e-72   Oryza brachyantha
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    243   1e-72   Eucalyptus grandis [rose gum]
emb|CDP09363.1|  unnamed protein product                                242   1e-72   Coffea canephora [robusta coffee]
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                    242   2e-72   Arabis alpina [alpine rockcress]
gb|KHG15491.1|  Protein WAX2 -like protein                              242   2e-72   Gossypium arboreum [tree cotton]
ref|NP_001047459.1|  Os02g0621300                                       242   2e-72   
gb|EEC73617.1|  hypothetical protein OsI_08114                          242   2e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like               242   2e-72   Eucalyptus grandis [rose gum]
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like               242   2e-72   Nicotiana tomentosiformis
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like               242   2e-72   Cucumis sativus [cucumbers]
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like               241   3e-72   Cucumis melo [Oriental melon]
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like               241   3e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like               241   3e-72   Nicotiana sylvestris
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    240   4e-72   
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like               241   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB67450.1|  hypothetical protein B456_010G191300                    241   7e-72   Gossypium raimondii
gb|KJB76287.1|  hypothetical protein B456_012G081500                    241   7e-72   Gossypium raimondii
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    240   7e-72   Cucumis melo [Oriental melon]
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    240   7e-72   Cucumis melo [Oriental melon]
gb|KJB76254.1|  hypothetical protein B456_012G081600                    237   8e-72   Gossypium raimondii
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    240   9e-72   Tarenaya hassleriana [spider flower]
ref|XP_010054532.1|  PREDICTED: protein ECERIFERUM 1-like               238   1e-71   Eucalyptus grandis [rose gum]
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g             240   1e-71   Populus trichocarpa [western balsam poplar]
gb|KJB76252.1|  hypothetical protein B456_012G081600                    238   1e-71   Gossypium raimondii
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg                239   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_003625020.1|  Protein WAX2                                       239   2e-71   
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g             238   2e-71   
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    237   2e-71   
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2       239   2e-71   
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1       239   2e-71   
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g             238   2e-71   
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like               239   3e-71   Sesamum indicum [beniseed]
dbj|BAJ85405.1|  predicted protein                                      234   3e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO85386.1|  hypothetical protein CISIN_1g006590mg                   235   5e-71   Citrus sinensis [apfelsine]
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    238   5e-71   Glycine max [soybeans]
gb|KDO85384.1|  hypothetical protein CISIN_1g006590mg                   236   7e-71   Citrus sinensis [apfelsine]
ref|XP_006445498.1|  hypothetical protein CICLE_v10019265mg             236   8e-71   
gb|KGN56664.1|  hypothetical protein Csa_3G127750                       238   8e-71   Cucumis sativus [cucumbers]
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like               238   1e-70   
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like               237   1e-70   Brachypodium distachyon [annual false brome]
emb|CBI16766.3|  unnamed protein product                                228   1e-70   Vitis vinifera
ref|XP_002526512.1|  sterol desaturase, putative                        237   1e-70   Ricinus communis
gb|EPS60467.1|  hypothetical protein M569_14337                         237   1e-70   Genlisea aurea
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                    237   2e-70   Brassica rapa
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like               237   2e-70   Cucumis melo [Oriental melon]
gb|KJB76257.1|  hypothetical protein B456_012G081600                    236   2e-70   Gossypium raimondii
gb|KJB76256.1|  hypothetical protein B456_012G081600                    236   3e-70   Gossypium raimondii
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                     235   3e-70   Eucalyptus grandis [rose gum]
ref|XP_004493412.1|  PREDICTED: protein ECERIFERUM 1-like               236   4e-70   
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                   235   6e-70   Citrus sinensis [apfelsine]
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like               235   6e-70   
gb|AHD24918.1|  CER1                                                    235   7e-70   Brassica napus [oilseed rape]
gb|EMT33049.1|  Protein WAX2                                            235   7e-70   
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like               235   7e-70   Setaria italica
gb|ACA14353.1|  TCER1                                                   235   8e-70   Triticum aestivum [Canadian hard winter wheat]
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                   235   1e-69   Citrus sinensis [apfelsine]
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                     236   1e-69   Tarenaya hassleriana [spider flower]
gb|KGN56666.1|  hypothetical protein Csa_3G127770                       234   1e-69   Cucumis sativus [cucumbers]
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    234   2e-69   Citrus sinensis [apfelsine]
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    234   2e-69   Citrus sinensis [apfelsine]
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg             234   2e-69   Citrus clementina [clementine]
ref|XP_007041192.1|  CER1 protein                                       233   3e-69   
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like               233   4e-69   Prunus mume [ume]
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg             233   4e-69   Prunus persica
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    233   4e-69   Prunus mume [ume]
ref|XP_003625022.1|  Protein WAX2                                       233   4e-69   Medicago truncatula
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320          233   5e-69   Sorghum bicolor [broomcorn]
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    233   5e-69   Solanum tuberosum [potatoes]
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    233   6e-69   
ref|XP_011085187.1|  PREDICTED: protein ECERIFERUM 1-like               232   7e-69   Sesamum indicum [beniseed]
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like               233   8e-69   Prunus mume [ume]
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like               232   1e-68   Nelumbo nucifera [Indian lotus]
emb|CDY38059.1|  BnaCnng09200D                                          235   1e-68   Brassica napus [oilseed rape]
ref|XP_010920377.1|  PREDICTED: protein ECERIFERUM 1-like               229   1e-68   
gb|EEE57393.1|  hypothetical protein OsJ_07566                          231   2e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010255639.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    232   2e-68   
ref|XP_007041196.1|  CER1 protein                                       231   3e-68   
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like               230   4e-68   Setaria italica
ref|XP_010054526.1|  PREDICTED: protein ECERIFERUM 1-like               229   5e-68   
ref|XP_003625024.1|  Protein WAX2                                       230   5e-68   
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg             230   6e-68   
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    232   6e-68   
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg             230   7e-68   
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like               230   8e-68   
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like               230   8e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010041339.1|  PREDICTED: protein ECERIFERUM 1-like               223   1e-67   
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                    229   1e-67   Solanum lycopersicum
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like               229   1e-67   
ref|XP_002526511.1|  sterol desaturase, putative                        229   1e-67   
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320          229   1e-67   Sorghum bicolor [broomcorn]
gb|KCW44429.1|  hypothetical protein EUGRSUZ_L02074                     224   1e-67   Eucalyptus grandis [rose gum]
gb|AES88391.2|  fatty acid hydroxylase superfamily protein              229   2e-67   Medicago truncatula
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like               229   2e-67   Malus domestica [apple tree]
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like               228   3e-67   Nelumbo nucifera [Indian lotus]
gb|EMS48098.1|  Protein WAX2                                            229   3e-67   Triticum urartu
gb|ACR38546.1|  unknown                                                 228   3e-67   Zea mays [maize]
gb|AAC24373.1|  CER1-like protein                                       228   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973742.1|  protein CER1-like 1                                   228   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                     228   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg             228   4e-67   Capsella rubella
ref|NP_171721.3|  protein CER1-like 1                                   228   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like               228   5e-67   Populus euphratica
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like               227   9e-67   Nelumbo nucifera [Indian lotus]
gb|KHG03871.1|  Protein WAX2 -like protein                              226   1e-66   Gossypium arboreum [tree cotton]
ref|XP_008460068.1|  PREDICTED: protein ECERIFERUM 1-like               225   4e-66   Cucumis melo [Oriental melon]
dbj|BAK01778.1|  predicted protein                                      221   4e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg             225   5e-66   Capsella rubella
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg             224   1e-65   
gb|KJB67449.1|  hypothetical protein B456_010G191200                    223   3e-65   Gossypium raimondii
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg                222   5e-65   Erythranthe guttata [common monkey flower]
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg                222   6e-65   Erythranthe guttata [common monkey flower]
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                     222   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    222   8e-65   Fragaria vesca subsp. vesca
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    221   8e-65   Fragaria vesca subsp. vesca
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                    221   1e-64   Arabis alpina [alpine rockcress]
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2          221   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    221   1e-64   Fragaria vesca subsp. vesca
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1          221   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    221   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    221   1e-64   Fragaria vesca subsp. vesca
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                    221   2e-64   Arabis alpina [alpine rockcress]
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like               221   2e-64   
gb|KJB76286.1|  hypothetical protein B456_012G081500                    220   2e-64   Gossypium raimondii
gb|EPS71900.1|  hypothetical protein M569_02856                         220   3e-64   Genlisea aurea
gb|AAD29719.1|AF143746_1  CER1                                          219   8e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    219   8e-64   Elaeis guineensis
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                     219   9e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                     219   1e-63   Camelina sativa [gold-of-pleasure]
gb|EEC67150.1|  hypothetical protein OsI_33995                          219   1e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001064826.1|  Os10g0471100                                       218   3e-63   
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like               218   4e-63   Nelumbo nucifera [Indian lotus]
emb|CDY55894.1|  BnaA04g29150D                                          217   5e-63   Brassica napus [oilseed rape]
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like               216   9e-63   
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590          216   1e-62   Sorghum bicolor [broomcorn]
emb|CAE03390.2|  OSJNBa0004N05.14                                       215   1e-62   Oryza sativa Japonica Group [Japonica rice]
gb|KDP34470.1|  hypothetical protein JCGZ_12753                         207   2e-62   Jatropha curcas
gb|EMT06855.1|  Protein WAX2                                            215   4e-62   
ref|NP_001118464.1|  protein CER1-like 2                                212   4e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CAA65200.1|  CER1-like                                              214   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3          214   5e-62   Brassica rapa
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1          214   6e-62   Brassica rapa
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2          214   6e-62   Brassica rapa
gb|AFW68611.1|  hypothetical protein ZEAMMB73_227989                    209   8e-62   
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like               213   1e-61   Setaria italica
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg             213   1e-61   Capsella rubella
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like               213   1e-61   Elaeis guineensis
gb|EMT07276.1|  Protein WAX2                                            213   2e-61   
emb|CDX79754.1|  BnaC03g20900D                                          213   2e-61   
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like               213   2e-61   Brachypodium distachyon [annual false brome]
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2          213   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1          213   3e-61   Camelina sativa [gold-of-pleasure]
gb|ACG35856.1|  CER1                                                    212   3e-61   Zea mays [maize]
emb|CDX93353.1|  BnaC04g45430D                                          212   5e-61   
ref|NP_181306.3|  protein CER1-like 2                                   211   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1          211   7e-61   Camelina sativa [gold-of-pleasure]
gb|EPS65064.1|  hypothetical protein M569_09713                         211   9e-61   Genlisea aurea
gb|KCW76793.1|  hypothetical protein EUGRSUZ_D011441                    199   1e-60   Eucalyptus grandis [rose gum]
ref|XP_007015842.1|  CER1 protein isoform 1                             211   1e-60   
ref|NP_001146661.1|  uncharacterized protein LOC100280261               211   1e-60   Zea mays [maize]
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like               210   2e-60   
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                     210   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898    216   2e-60   
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg             210   3e-60   Eutrema salsugineum [saltwater cress]
emb|CDX93352.1|  BnaC04g45440D                                          209   4e-60   
emb|CDY55893.1|  BnaA04g29140D                                          209   6e-60   Brassica napus [oilseed rape]
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                     209   6e-60   Brassica rapa
emb|CAA65199.1|  CER1-like                                              209   7e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91381.1|  BnaC04g07690D                                          208   1e-59   
emb|CDX74937.1|  BnaA05g06830D                                          208   1e-59   
ref|XP_004166202.1|  PREDICTED: protein ECERIFERUM 1-like               196   1e-59   
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                     208   1e-59   Brassica rapa
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650          207   3e-59   Amborella trichopoda
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                     207   3e-59   Brassica rapa
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                     207   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_007015845.1|  CER1 protein                                       207   3e-59   
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like               206   7e-59   Setaria italica
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    206   8e-59   Elaeis guineensis
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478             205   2e-58   
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily                 209   3e-58   
gb|EMT04955.1|  Protein WAX2                                            202   1e-57   
ref|XP_007008730.1|  Fatty acid hydroxylase superfamily isoform 2       200   1e-57   
gb|EAY87991.1|  hypothetical protein OsI_09413                          201   4e-57   
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                    201   4e-57   
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...    201   4e-57   
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like               202   5e-57   
gb|AAC23640.1|  CER1-like protein                                       201   6e-57   
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                   201   6e-57   
ref|NP_001048490.1|  Os02g0814200                                       201   8e-57   
gb|KDP28917.1|  hypothetical protein JCGZ_14688                         199   1e-56   
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940          200   1e-56   
gb|KDO47517.1|  hypothetical protein CISIN_1g039554mg                   189   2e-56   
gb|ACG47659.1|  CER1                                                    200   2e-56   
gb|EMS58051.1|  Protein WAX2                                            199   2e-56   
ref|XP_003606182.1|  Protein WAX2                                       199   2e-56   
gb|AES88379.2|  fatty acid hydroxylase superfamily protein              199   2e-56   
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like               199   2e-56   
ref|NP_001169009.1|  hypothetical protein                               187   4e-56   
ref|XP_007041188.1|  Fatty acid hydroxylase superfamily isoform 4       196   4e-56   
gb|AFW72383.1|  hypothetical protein ZEAMMB73_077345                    187   5e-56   
ref|XP_007041189.1|  Fatty acid hydroxylase superfamily isoform 5       196   7e-56   
ref|XP_004168237.1|  PREDICTED: protein ECERIFERUM 1-like               197   1e-55   
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    196   2e-55   
gb|EMS68717.1|  Protein WAX2                                            197   2e-55   
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3       196   2e-55   
dbj|BAK00236.1|  predicted protein                                      196   3e-55   
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1           196   4e-55   
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                     196   5e-55   
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like               196   5e-55   
dbj|BAJ85488.1|  predicted protein                                      196   6e-55   
gb|ABG47420.1|  putative CER1                                           196   6e-55   
gb|ABG66131.1|  CER1 protein, putative, expressed                       184   7e-55   
gb|ABG66132.1|  CER1 protein, putative, expressed                       194   1e-54   
gb|EMS58602.1|  Protein WAX2                                            184   2e-54   
gb|KJB09060.1|  hypothetical protein B456_001G122000                    194   2e-54   
gb|KHG12604.1|  Protein WAX2 -like protein                              193   4e-54   
gb|KJB76251.1|  hypothetical protein B456_012G081600                    192   4e-54   
gb|ACN31737.1|  unknown                                                 192   6e-54   
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    191   1e-53   
gb|EMS48099.1|  Protein WAX2                                            188   2e-52   
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...    187   7e-52   
gb|EMS58604.1|  Protein WAX2                                            187   9e-52   
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg                185   2e-51   
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like               185   3e-51   
ref|XP_009614891.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    176   5e-50   
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    181   5e-50   
ref|XP_007220698.1|  hypothetical protein PRUPE_ppa020996mg             177   9e-50   
ref|XP_003606194.1|  Protein WAX2                                       180   1e-49   
gb|EMT22938.1|  hypothetical protein F775_42817                         169   1e-47   
ref|XP_010097743.1|  Protein WAX2                                       173   8e-47   
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048             172   1e-46   
ref|XP_002443046.1|  hypothetical protein SORBIDRAFT_08g006860          163   1e-46   
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600          171   4e-46   
gb|EMT15823.1|  Protein WAX2                                            158   6e-45   
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2          167   7e-45   
gb|EMT04858.1|  Protein WAX2                                            167   8e-45   
gb|EMT15793.1|  Protein WAX2                                            163   1e-43   
emb|CDX79753.1|  BnaC03g20890D                                          149   3e-41   
ref|XP_001783415.1|  predicted protein                                  146   2e-37   
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942             141   2e-35   
ref|XP_007041194.1|  CER1 protein                                       140   2e-35   
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like               137   4e-35   
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             139   6e-35   
ref|XP_009621541.1|  PREDICTED: protein ECERIFERUM 1-like               127   9e-34   
ref|XP_007015843.1|  CER1 protein isoform 2                             134   2e-33   
ref|XP_002509294.1|  predicted protein                                  134   5e-33   
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            135   6e-33   
ref|XP_010097741.1|  Protein WAX2                                       132   1e-32   
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                132   2e-32   
ref|XP_001420263.1|  predicted protein                                  129   6e-31   
gb|KCW76788.1|  hypothetical protein EUGRSUZ_D011432                    118   7e-30   
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like               124   2e-29   
ref|XP_009793431.1|  PREDICTED: protein ECERIFERUM 1-like               116   2e-29   
gb|ABD28314.2|  possible aldehyde decarbonylase-related, putative       115   3e-29   
ref|XP_010041960.1|  PREDICTED: protein ECERIFERUM 1-like               119   1e-28   
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    120   2e-28   
ref|XP_004231132.1|  PREDICTED: protein ECERIFERUM 1-like               113   3e-28   
ref|XP_007041193.1|  Fatty acid hydroxylase superfamily                 110   2e-27   
ref|XP_007509665.1|  predicted protein                                  115   3e-26   
ref|XP_002891510.1|  hypothetical protein ARALYDRAFT_891841             109   1e-25   
gb|EEC73225.1|  hypothetical protein OsI_07312                          106   3e-25   
emb|CAH68010.1|  OSIGBa0157K09-H0214G12.21                              102   2e-24   
dbj|BAH00848.1|  unnamed protein product                                102   3e-24   
ref|NP_001141595.1|  uncharacterized protein LOC100273712               108   6e-24   
gb|ADE75704.1|  unknown                                                 109   7e-24   
gb|KEH23596.1|  fatty acid hydroxylase superfamily protein              108   9e-24   
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                    107   2e-23   
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             107   4e-23   
gb|EEE61327.1|  hypothetical protein OsJ_15439                          105   5e-23   
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    105   8e-23   
gb|EEC77626.1|  hypothetical protein OsI_16615                          105   9e-23   
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    105   9e-23   
gb|KCW76789.1|  hypothetical protein EUGRSUZ_D011433                  97.8    1e-22   
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         104   2e-22   
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         104   2e-22   
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               104   2e-22   
ref|XP_003061467.1|  predicted protein                                  104   2e-22   
gb|ABC87808.1|  TCER1                                                   100   6e-22   
emb|CBI25242.3|  unnamed protein product                                103   7e-22   
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               103   8e-22   
ref|XP_001756318.1|  predicted protein                                  102   1e-21   
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    102   2e-21   
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               101   4e-21   
emb|CBI25244.3|  unnamed protein product                                101   4e-21   
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               101   5e-21   
ref|XP_010103144.1|  Protein WAX2                                       100   9e-21   
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  99.8    1e-20   
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  99.8    1e-20   
gb|KHG04939.1|  Protein WAX2                                          99.4    2e-20   
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein            99.4    2e-20   
ref|XP_007154834.1|  hypothetical protein PHAVU_003G1516000g          96.7    4e-20   
ref|XP_007154833.1|  hypothetical protein PHAVU_003G1516000g          96.7    4e-20   
gb|KDO85388.1|  hypothetical protein CISIN_1g006590mg                 97.8    4e-20   
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like             97.8    7e-20   
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                  97.4    9e-20   
ref|XP_008364781.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...  94.0    2e-19   
gb|KJB27032.1|  hypothetical protein B456_004G273200                  96.3    2e-19   
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  95.1    4e-19   
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like             95.5    5e-19   
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  95.5    5e-19   
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  95.1    5e-19   
gb|KHG19461.1|  hypothetical protein F383_25066                       89.7    8e-19   
ref|XP_001781794.1|  predicted protein                                94.4    9e-19   
gb|KJB23545.1|  hypothetical protein B456_004G104100                  94.0    1e-18   
gb|KJB23544.1|  hypothetical protein B456_004G104100                  94.0    1e-18   
gb|KJB23541.1|  hypothetical protein B456_004G104100                  94.0    1e-18   
ref|XP_009622102.1|  PREDICTED: protein ECERIFERUM 3-like             90.9    2e-18   
gb|KHG27245.1|  Protein WAX2                                          93.6    2e-18   
gb|KHG27244.1|  Protein WAX2                                          93.2    3e-18   
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3       92.4    5e-18   
gb|KHN17538.1|  Protein WAX2                                          92.4    5e-18   
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like             92.4    5e-18   
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       92.0    6e-18   
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       92.0    7e-18   
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily               91.7    7e-18   
emb|CDP02895.1|  unnamed protein product                              91.7    9e-18   
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like             90.9    1e-17   
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like             91.3    1e-17   
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like             90.9    2e-17   
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like             89.0    8e-17   
gb|EEC73226.1|  hypothetical protein OsI_07314                        87.4    8e-17   
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                  88.6    1e-16   
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like             88.6    1e-16   
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg              88.2    1e-16   
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680           86.7    4e-16   
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g           86.3    6e-16   
gb|KDP38762.1|  hypothetical protein JCGZ_04115                       86.3    6e-16   
ref|XP_001782380.1|  predicted protein                                85.9    8e-16   
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                  85.9    8e-16   
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                  85.9    8e-16   
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167           85.9    8e-16   
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like             85.5    1e-15   
gb|KJB23543.1|  hypothetical protein B456_004G104100                  85.1    1e-15   
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like             85.1    1e-15   
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  85.1    1e-15   
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  84.7    1e-15   
gb|KGN58637.1|  hypothetical protein Csa_3G708180                     79.7    2e-15   
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like             84.7    2e-15   
gb|KJB83319.1|  hypothetical protein B456_013G242200                  83.6    2e-15   
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  84.7    2e-15   
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...  84.7    2e-15   
gb|KDO62362.1|  hypothetical protein CISIN_1g006768mg                 84.0    2e-15   
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  84.3    2e-15   
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg           84.0    3e-15   
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                 84.0    3e-15   
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like             84.0    3e-15   
ref|XP_002973631.1|  hypothetical protein SELMODRAFT_99824            80.9    4e-15   
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like             84.0    4e-15   
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g           84.0    4e-15   
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       83.6    5e-15   
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       83.2    7e-15   
gb|KJB83320.1|  hypothetical protein B456_013G242200                  82.4    7e-15   
gb|KJB83323.1|  hypothetical protein B456_013G242200                  83.2    7e-15   
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg              82.8    7e-15   
gb|KJB83318.1|  hypothetical protein B456_013G242200                  82.8    8e-15   
gb|KJB83321.1|  hypothetical protein B456_013G242200                  82.4    8e-15   
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       82.4    9e-15   
gb|KJB83322.1|  hypothetical protein B456_013G242200                  82.4    1e-14   
emb|CDO98263.1|  unnamed protein product                              82.8    1e-14   
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       82.4    1e-14   
gb|KHG30512.1|  Protein WAX2 -like protein                            82.0    1e-14   
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448           82.0    2e-14   
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like             82.0    2e-14   
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like             81.6    2e-14   
ref|XP_008438264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  81.3    2e-14   
gb|EAZ44800.1|  hypothetical protein OsJ_29433                        81.6    2e-14   
ref|NP_001063227.1|  Os09g0426800                                     81.3    2e-14   
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343           81.3    3e-14   
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982           80.1    8e-14   
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like             78.6    2e-13   
gb|AEQ39063.1|  putative sterol desaturase                            75.9    2e-13   
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like             78.2    3e-13   
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg           78.2    3e-13   
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like             77.8    4e-13   
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  77.4    5e-13   
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  77.4    5e-13   
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  77.4    6e-13   
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4  77.0    6e-13   
gb|KJB27033.1|  hypothetical protein B456_004G273200                  76.3    1e-12   
dbj|BAK02959.1|  predicted protein                                    76.3    1e-12   
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                  75.9    2e-12   
ref|XP_002528208.1|  sterol desaturase, putative                      75.5    2e-12   
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like             74.7    5e-12   
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like             74.3    5e-12   
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876           74.3    6e-12   
ref|NP_200588.2|  protein ECERIFERUM 3                                74.3    6e-12   
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg              73.6    1e-11   
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                  73.6    1e-11   
gb|KHG04940.1|  Protein WAX2                                          72.8    2e-11   
dbj|BAJ85039.1|  predicted protein                                    72.8    2e-11   
dbj|BAJ87617.1|  predicted protein                                    72.8    2e-11   
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like             72.0    3e-11   
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like             71.6    4e-11   
emb|CDY11848.1|  BnaC03g12740D                                        71.2    5e-11   
ref|XP_008369652.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    6e-11   
emb|CDX88639.1|  BnaA03g10100D                                        70.9    7e-11   
gb|AFW87578.1|  hypothetical protein ZEAMMB73_499314                  70.1    9e-11   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...  70.1    1e-10   
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like             69.7    2e-10   
dbj|BAJ85064.1|  predicted protein                                    69.7    2e-10   
emb|CBI38120.3|  unnamed protein product                              65.1    2e-10   



>ref|XP_009612939.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana tomentosiformis]
Length=626

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAP+VAHS + + +++  ++RD   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPYVAHSLHSFFMSEDESKRDITYLIIFPFLLFRML  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKGDNRIVDK IEF+QVDRERNWDDQIILNGLLFY+GY KL  +HHM
Sbjct  61   HNQIWISLSRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWRTDGII+TAL+ TGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PIWRTDGIIMTALLQTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LFAIPLLTTV T
Sbjct  181  EHIAYFLLFAIPLLTTVLT  199



>ref|XP_009777506.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=524

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 176/199 (88%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAPFVAHS + + L+    +RD    +IFPFLL RM+
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVAHSIHSFFLSKDEKQRDIVNFIIFPFLLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKGDNRIVDK IEF+QVDRERNWDDQII NGLLFY+GY KL  +HH+
Sbjct  61   HNQIWISLSRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIIFNGLLFYYGYMKLEQSHHI  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WRTDGIILTALIH GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PFWRTDGIILTALIHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EH+AYF LFAIP+LT + T
Sbjct  181  EHVAYFALFAIPMLTAILT  199



>ref|XP_009787252.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=590

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAP+V HS   + +++  ++RD   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPYVTHSLNSFFMSEDESKRDMTYLIIFPFLLFRML  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WIS+SRYRTAKGDNRIVDK IEF+Q+DRERNWDDQIILNGLLFY+GY KL  +HHM
Sbjct  61   HNQIWISVSRYRTAKGDNRIVDKTIEFDQIDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWRTDGII+TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSS+ TEPITSVIHPFA
Sbjct  121  PIWRTDGIIMTALLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSVATEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LFAIPLLTTV T
Sbjct  181  EHIAYFLLFAIPLLTTVLT  199



>ref|XP_009787251.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=626

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAP+V HS   + +++  ++RD   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPYVTHSLNSFFMSEDESKRDMTYLIIFPFLLFRML  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WIS+SRYRTAKGDNRIVDK IEF+Q+DRERNWDDQIILNGLLFY+GY KL  +HHM
Sbjct  61   HNQIWISVSRYRTAKGDNRIVDKTIEFDQIDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWRTDGII+TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSS+ TEPITSVIHPFA
Sbjct  121  PIWRTDGIIMTALLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSVATEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LFAIPLLTTV T
Sbjct  181  EHIAYFLLFAIPLLTTVLT  199



>ref|XP_009586975.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=625

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 176/199 (88%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAPFVAHS + + L+    ++D    +IFPFLL RM+
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVAHSIHSFFLSKDEKQKDIVKFIIFPFLLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WIS+SRYRTAKGDNRIVDK IEF+QVDRERNWDDQII NGLLFY+GY KL  +HH+
Sbjct  61   HNQIWISISRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIIFNGLLFYYGYMKLEQSHHI  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WRTDGIILTALIH GPVEFLYYWLHR+LHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PFWRTDGIILTALIHIGPVEFLYYWLHRSLHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EH+AYF LFAIP+LT V T
Sbjct  181  EHVAYFALFAIPMLTAVLT  199



>ref|XP_011085147.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=623

 Score =   275 bits (702),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWTWLGSFKYVVLAP+V HSTY Y+    +ERD +  +IFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTWLGSFKYVVLAPWVIHSTYSYMVKDKSERDFSQFVIFPFLLSRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRERNWDDQII NG+LFY G   +   HHMP
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKNIEFEQVDRERNWDDQIIFNGILFYVGQKYITQAHHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121  WWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIPLLTT++T
Sbjct  181  HIAYFMLFAIPLLTTLWT  198



>emb|CBI16764.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYSLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  IWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF+IPLL  +F
Sbjct  181  HLAYFILFSIPLLAGIF  197



>emb|CBI16759.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   261 bits (667),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRVDGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTMIFT  198



>gb|KHN33999.1| Protein WAX2 [Glycine soja]
Length=246

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LG FK+V+L P++AHSTY +L     ERD    LIFP++++RMLH
Sbjct  1    MASKPGILTNWPWKPLGCFKWVILTPWIAHSTYSFLVSDTKERDLGYFLIFPYMMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            HIAYFVLFAIPL TTV
Sbjct  181  HIAYFVLFAIPLYTTV  196



>ref|XP_006361513.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNER-DPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAPFV  S    L      + D   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIQSLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKGDNRI+DK IEF+QVDRERNWDDQI+LNGLLFY+GY KL  +H++
Sbjct  61   HNQIWISLSRYRTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWR+DGIILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IPLLTTV T
Sbjct  181  EHIAYFLLFSIPLLTTVLT  199



>ref|XP_006357723.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNER-DPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAPFV  S    L      + D   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIQSLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKGDNRI+DK IEF+QVDRERNWDDQI+LNGLLFY+GY KL  +H++
Sbjct  61   HNQIWISLSRYRTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWR+DGIILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IPLLTTV T
Sbjct  181  EHIAYFLLFSIPLLTTVLT  199



>ref|XP_010661477.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=354

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYSLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  IWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF+IPLL  +F
Sbjct  181  HLAYFILFSIPLLAGIF  197



>gb|KHN40120.1| Protein WAX2 [Glycine soja]
Length=627

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFK+V+L P++AHSTY +L   P ERD    LIFP +++RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKWVILTPWIAHSTYSFLVSEPKERDLTYFLIFPLMMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYFVLFAIPL TTV T
Sbjct  181  HIAYFVLFAIPLYTTVVT  198



>ref|XP_004234847.1| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=626

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNER-DPNillifpflliRML  192
            MAS+PGILTEWPWTWLG+FKYVVLAPFV  S    L      + D   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIESLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRY+TAKGDNRI+DK IEF+QVDRERNWDDQI+LNGLLFY+GY KL  +H++
Sbjct  61   HNQIWISLSRYKTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWR+DGIILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IPLLTTV T
Sbjct  181  EHIAYFLLFSIPLLTTVVT  199



>emb|CBI16761.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ Y +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGASHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRADGVVVTILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTVIFT  198



>ref|XP_002263787.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ Y +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGASHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRADGVVVTILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTVIFT  198



>ref|XP_003521032.2| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=684

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFK+V+L P++AHSTY +L   P ERD    LIFP +++RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKWVILTPWIAHSTYSFLVSEPKERDLTYFLIFPLMMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYFVLFAIPL TTV T
Sbjct  181  HIAYFVLFAIPLYTTVVT  198



>ref|XP_003633900.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRADGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTMIFT  198



>ref|XP_006354616.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=628

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWT LG+FKY+VLAPFV HSTY Y ++    +RD   ++I P LL R++
Sbjct  1    MASKPGILTEWPWTCLGNFKYLVLAPFVCHSTYTYFMSKDERQRDIVYIIILPLLLSRII  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQII NGLL+Y GY  L   HHM
Sbjct  61   HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLLYYIGYLMLEQAHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+  L+H+GPVEFLYYWLHRALHHH LYSRYHSHHHSSI TEPITSVIHPFA
Sbjct  121  PVWRTDGIIIIGLLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EH++YF LF+IPL TTVFT
Sbjct  181  EHLSYFTLFSIPLFTTVFT  199



>ref|XP_002265685.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRVDGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTMIFT  198



>emb|CAN81825.1| hypothetical protein VITISV_014168 [Vitis vinifera]
Length=2166

 Score =   273 bits (698),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 149/197 (76%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF+IPLL  +F
Sbjct  181  HLAYFLLFSIPLLAGIF  197



>ref|XP_003529007.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=624

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LG FK+V+L P++AHSTY +L     ERD    LIFP++++RMLH
Sbjct  1    MASKPGILTNWPWKPLGCFKWVILTPWIAHSTYSFLVSDAKERDLGYFLIFPYMMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            HIAYFVLFAIPL TTV
Sbjct  181  HIAYFVLFAIPLYTTV  196



>ref|XP_009614034.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWT+LG+FKY+VLAPFV HS Y Y ++   ++RD   ++I P LL R++
Sbjct  31   MASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIVYIIILPLLLSRVI  90

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQII NGL++Y GY  L   HH+
Sbjct  91   HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  150

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+ AL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  151  PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  210

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHI+YF+LFAIPLLT   T
Sbjct  211  EHISYFLLFAIPLLTATLT  229



>ref|XP_002262647.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38119.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF+IPLL  +F
Sbjct  181  HLAYFLLFSIPLLAGIF  197



>ref|XP_007134354.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
 gb|ESW06348.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
Length=622

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFKYVVLAP+V HSTY  L    NERD    LI P LL RM+H
Sbjct  1    MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSMLVKDKNERDVGTFLILPLLLWRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRYRTAKG+ RIVDKG+EF+QVDRER WDDQI+ NGLL+Y   Y LP   H+P
Sbjct  61   NQIWITLSRYRTAKGNGRIVDKGLEFDQVDREREWDDQILFNGLLYYLACYTLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRT+G+++  LIH GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTEGLVMAMLIHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LF+IP+LT VFT
Sbjct  181  HISYFLLFSIPMLTLVFT  198



>ref|XP_009600723.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWT+LG+FKY+VLAPFV HS Y Y ++   ++RD   L+I P LL R++
Sbjct  31   MASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIGYLIILPLLLSRVI  90

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKG+NRIVDK IEF+Q+DRE NWDDQII NGL++Y GY  L   HH+
Sbjct  91   HNQIWISLSRYRTAKGNNRIVDKSIEFDQIDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  150

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+ AL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  151  PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  210

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHI+YF+LF+IPLLT   T
Sbjct  211  EHISYFLLFSIPLLTATLT  229



>ref|XP_004229696.2| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=918

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILTEWPWT+LG+FKY+VLAPFV HSTY Y ++    +RD   ++I P L  R++
Sbjct  1    MASKPGILTEWPWTFLGNFKYLVLAPFVCHSTYTYFMSKDERQRDIVYIIILPLLFSRII  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQII NGLL+Y GY  L   HH+
Sbjct  61   HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLLYYIGYLMLEQAHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WR+DGII+  L+H+GPVEFLYYWLHRALHHH LYSRYHSHHHSSI TEPITSVIHPFA
Sbjct  121  PLWRSDGIIIIGLLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EH++YF LF+IPL TTVFT
Sbjct  181  EHLSYFTLFSIPLFTTVFT  199



>ref|XP_002265189.2| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI16762.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ Y ++     ERD +  LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIYSFVVKDEKERDISHFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ +P   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYITYFTVPGGTHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+++T L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  FWRADGVVITILLHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTVIFT  198



>ref|XP_009339873.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 1-like [Pyrus 
x bretschneideri]
Length=261

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTA G+ RIVDKG+EFEQVDRE+NWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTATGNGRIVDKGLEFEQVDREKNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDGIILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  YWRTDGIILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF++FAIP+LTT++T
Sbjct  181  HISYFIIFAIPMLTTIYT  198



>ref|XP_009793428.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=627

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MAS+PGILT+WPWT+LG+FKY+VLAPFV HS Y Y ++   ++RD   ++I P LL R++
Sbjct  1    MASKPGILTDWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIIYIIILPLLLSRVI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTA+G+NRIVD+ IEF+QVDRE NWDDQII NGL++Y GY  L   HH+
Sbjct  61   HNQIWISLSRYRTARGNNRIVDRSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+ AL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSI TEPITSVIHPFA
Sbjct  121  PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHI+YF+LFAIPLLT   T
Sbjct  181  EHISYFMLFAIPLLTVTLT  199



>ref|XP_009376851.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILTEWPWT LGSFK+VV+AP++ HSTY Y  +   ++D +  LIFP +L R +H
Sbjct  1    MATTPGILTEWPWTPLGSFKHVVVAPWIIHSTYSYFANDEEDKDLSYFLIFPLILWRFVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNSILFYLGSRHLPGASNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  MWRTDGVILTILLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIP+LTT+FT
Sbjct  181  HIAYFILFAIPMLTTLFT  198



>ref|XP_004510150.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=626

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFKYV+LAP+V HSTY  L    NERD +  LIFPFLL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKYVILAPWVVHSTYSVLVKDKNERDISTFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRYRTAKG+NRIVDKGIEF+QVDRER+WDDQI+ NGLL+Y   Y L     +P
Sbjct  61   NQIWISFSRYRTAKGNNRIVDKGIEFDQVDRERDWDDQILFNGLLYYLACYTLKGASRVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W T+G+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWNTEGVIITILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LFAIP LT VFT
Sbjct  181  HISYFLLFAIPKLTLVFT  198



>emb|CBI16760.3| unnamed protein product [Vitis vinifera]
Length=2763

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRADGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF+IPLLT +FT
Sbjct  181  HIGYFLLFSIPLLTMIFT  198



>gb|EYU40308.1| hypothetical protein MIMGU_mgv1a002952mg [Erythranthe guttata]
Length=622

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPWT+LG+FKY+V+AP+V HSTY Y+    NERD    +IFPFL+ RM+H
Sbjct  1    MASKPGILTEWPWTFLGNFKYLVIAPWVIHSTYSYMVKDKNERDLTQFIIFPFLISRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRYRTAKG NRIVDK IEF+QVDRERNWDDQII NG+LFY G   +   H++P
Sbjct  61   NQVWISFSRYRTAKGANRIVDKNIEFDQVDRERNWDDQIIFNGILFYVGQMYIKEAHNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRT G++ T L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121  WWRTMGVVWTILLHAGPVEYLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYFVLFAIPLLTT+++
Sbjct  181  HIAYFVLFAIPLLTTLYS  198



>ref|XP_008361247.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=561

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YFVLFAIP+LTT++T
Sbjct  181  HISYFVLFAIPMLTTIYT  198



>emb|CAN60676.1| hypothetical protein VITISV_029045 [Vitis vinifera]
Length=557

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY  Y  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF IPLL   F
Sbjct  181  HLAYFLLFLIPLLAGFF  197



>gb|ACJ85705.1| unknown [Medicago truncatula]
 gb|AFK48448.1| unknown [Medicago truncatula]
Length=385

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFKYVVLAP+V HSTY  +    +ERD +  LIFPFLL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSLIVKDKSERDVSAFLIFPFLLWRVLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRT+KG+NRI+DKGIEF+QVDRE++WDDQI+ NGLL+Y   Y L     +P
Sbjct  61   NQIWISLSRYRTSKGNNRILDKGIEFDQVDREKDWDDQILFNGLLYYLACYTLEGASRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+  L+H G VEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVIIAILLHAGAVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LFAIP LT VFT
Sbjct  181  HISYFLLFAIPKLTLVFT  198



>gb|KJB67446.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=528

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LGSFKY++L P+V  + Y  +   P E D     + PF+L RMLH
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVTETIYSIMVKDPKEWDLTNFSVIPFMLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG NRIVDKGIEF+QVDRERNWDDQI+ NG+LF+      P   H+P
Sbjct  61   NQLWISLSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNGILFFLANKYAPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+T L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVIITMLLHVGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF LFAIP+LT VFT
Sbjct  181  HIVYFALFAIPMLTVVFT  198



>ref|XP_008375723.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YFVLFAIP+LTT++T
Sbjct  181  HISYFVLFAIPMLTTIYT  198



>ref|XP_002262785.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38118.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY  Y  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF IPLL   F
Sbjct  181  HLAYFLLFLIPLLAGFF  197



>ref|XP_004510149.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Cicer arietinum]
Length=423

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPWT LGSFK+V+L P+VAHSTY +  +   ERD +  LIFP+L++RMLH
Sbjct  1    MASKPGILTNWPWTPLGSFKWVILTPWVAHSTYSFFVNGSEERDLSNFLIFPYLMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WISLSR+RTAKG +RIVDK IEFEQVDRE NWDDQI+ NG++FY G   +  +  +P
Sbjct  61   DQIWISLSRHRTAKGKSRIVDKSIEFEQVDRESNWDDQILFNGVIFYIGQMFIEESRKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG+I+T L+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  IWRTDGVIITILLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIPL TT  T
Sbjct  181  HIAYFMLFAIPLYTTAIT  198



>ref|XP_008364777.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YFVLFAIP+LTT++T
Sbjct  181  HISYFVLFAIPMLTTIYT  198



>ref|XP_003626834.1| gl1-like protein [Medicago truncatula]
 gb|AET01310.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=622

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG FK+V+L PF+A STY ++ +SP E+D +  LIFP++++RMLH
Sbjct  1    MASKPGILTDWPWTPLGRFKWVILTPFIAKSTYNFIVNSPEEKDLSNFLIFPYMMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WISLSR+RTAKG NRIVDK IEFEQVDRE NWDDQI+ N L+FY G + +P +  +P
Sbjct  61   DQVWISLSRHRTAKGKNRIVDKAIEFEQVDRESNWDDQILFNALIFYIGQWLVPESQKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRT G+++T L+H+GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  IWRTSGVVMTILLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIPL TT  T
Sbjct  181  HIAYFLLFAIPLYTTAIT  198



>ref|XP_010479259.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=246

 Score =   243 bits (619),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>ref|XP_006445500.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 ref|XP_006464360.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR58740.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 gb|KDO85379.1| hypothetical protein CISIN_1g006722mg [Citrus sinensis]
Length=633

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG LT+WPWT LG+FKYVVLAP++ HSTY ++     ER+    +IFP +L RMLH
Sbjct  1    MASKPGFLTDWPWTPLGNFKYVVLAPWIIHSTYSFIVKDEKERELAYFVIFPLMLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRYRTAKG NRIVDK IEFEQVDRERNWDDQII NG+LFY     LP    MP
Sbjct  61   NQIWISFSRYRTAKGSNRIVDKAIEFEQVDRERNWDDQIIFNGVLFYVFVKILPGASQMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG+ILTAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  IWRLDGVILTALLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF LFAIPL+T + +
Sbjct  181  HIAYFALFAIPLITPLLS  198



>ref|XP_004307281.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=625

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LGSFKYVVLAP+V HSTY ++ +   +RD +  LI P +L RMLH
Sbjct  1    MASTPGILTDWPWTPLGSFKYVVLAPWVVHSTYSFMVNEGPDRDLSYFLILPLMLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG  RIVDKG+EFEQVDRERNWDDQII NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGKGRIVDKGLEFEQVDRERNWDDQIIFNGILFYLGSRHLPGGSNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W+ DG+++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPI+SVIHPFAE
Sbjct  121  MWKADGLVITFLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIP +T   T
Sbjct  181  HIAYFILFAIPQVTIALT  198



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LGSFKYVV+AP+  HSTYK++TD P ++D    L+FPFLL+R+LH
Sbjct  1    MATKPGILTDWPWTPLGSFKYVVIAPWAVHSTYKFVTDDPEKKDLGYFLVFPFLLLRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY TAKG  RI+DKGI+F QVDRE NWDDQI+ NGL FY G   LP    +P
Sbjct  61   NQVWISLSRYCTAKGKRRILDKGIDFNQVDRETNWDDQILFNGLWFYIGMRLLPQGKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++ A++H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLMAAVLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYFVLF+IPLLTT+ T
Sbjct  181  HIAYFVLFSIPLLTTLIT  198



>ref|XP_009625188.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=626

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + +    ++RD   ++I P LL R++
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFFMGKDESQRDIAYIIILPLLLSRVI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRT KGDNRI+DK IEF+QVDRERNWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWISLSRYRTTKGDNRILDKSIEFDQVDRERNWDDQIILNGMVFYVAYLKFQQTHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E IAY+ LF IP +TT FT
Sbjct  181  EIIAYYTLFLIPGVTTFFT  199



>ref|XP_007008729.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOY17539.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=623

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LGSFKY++L P++  S Y ++ +  NERD + L IFPF+L RM H
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILVPWITESIYSFIANDENERDFSNLSIFPFMLWRMFH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTA G NRIVDKG+EF+QVDRERNWDDQI+ N +LFY G   +P + H+P
Sbjct  61   NQIWISLSRYRTATGSNRIVDKGLEFDQVDRERNWDDQILFNAILFYLGNKYVPGSSHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+ILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF LFAIPL T   +
Sbjct  181  HIAYFALFAIPLSTIALS  198



>ref|XP_010496699.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=255

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P  RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPETRDIGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>ref|XP_009760057.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=623

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + ++   ++RD + + I P+LL RM+
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+W SLSRYRTAKG+NRI+DK IEF+QVDRE NWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+TAL+H GPVEFLYYWLHRA HHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY  LF IP+ TT+FT
Sbjct  181  EIVAYLTLFLIPMTTTLFT  199



>ref|XP_009760058.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=622

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + ++   ++RD + + I P+LL RM+
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+W SLSRYRTAKG+NRI+DK IEF+QVDRE NWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+TAL+H GPVEFLYYWLHRA HHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY  LF IP+ TT+FT
Sbjct  181  EIVAYLTLFLIPMTTTLFT  199



>ref|XP_009760059.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Nicotiana sylvestris]
Length=618

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + ++   ++RD + + I P+LL RM+
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+W SLSRYRTAKG+NRI+DK IEF+QVDRE NWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+TAL+H GPVEFLYYWLHRA HHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY  LF IP+ TT+FT
Sbjct  181  EIVAYLTLFLIPMTTTLFT  199



>ref|XP_008338420.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILTEWPWT LGSFK+VV+AP++ H TY Y  +   ++D +  LIFP +L R +H
Sbjct  1    MATTPGILTEWPWTPLGSFKHVVVAPWIIHGTYSYFANDEEDKDLSYFLIFPLILWRFVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDK +EFEQVDRERNWDDQI+ N +LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKSLEFEQVDRERNWDDQILFNSILFYLGSRHLPGASNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  MWRTDGVILTILLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIP+LTT+FT
Sbjct  181  HIAYFILFAIPMLTTLFT  198



>gb|KJB67445.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=624

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LGSFKY++L P+V  + Y  +   P E D     + PF+L RMLH
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVTETIYSIMVKDPKEWDLTNFSVIPFMLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG NRIVDKGIEF+QVDRERNWDDQI+ NG+LF+      P   H+P
Sbjct  61   NQLWISLSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNGILFFLANKYAPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+T L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVIITMLLHVGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF LFAIP+LT VFT
Sbjct  181  HIVYFALFAIPMLTVVFT  198



>ref|XP_009337262.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDGIILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  YWRTDGIILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF LFAIPL+TT+ T
Sbjct  181  HILYFTLFAIPLMTTILT  198



>ref|XP_009758897.1| PREDICTED: uncharacterized protein LOC104211529 [Nicotiana sylvestris]
Length=1039

 Score =   256 bits (655),  Expect = 9e-76, Method: Composition-based stats.
 Identities = 138/199 (69%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTY-KYLTDSPNERDPNillifpflliRML  192
            MAS+PGI+T+WPWT+LG+FKY+VLAPFV HS Y  +++      D   ++I P LL  ++
Sbjct  795  MASKPGIITDWPWTFLGNFKYLVLAPFVGHSIYTNFMSKDERHGDIVYIIILPLLLSIVI  854

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAK +NRIVDK IEF+QVDRE NWDDQI+ N L++Y GY  L   HH+
Sbjct  855  HNQIWISLSRYRTAKDNNRIVDKSIEFDQVDRESNWDDQILFNRLIYYIGYLLLEQAHHL  914

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGI++ AL+H G VEFLYYWLHRALHHH  YSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  915  PLWRTDGIVMIALLHIGFVEFLYYWLHRALHHHFFYSRYHSHHHSSIVTEPITSVIHPFA  974

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHI+YFVLFAIPLLT   T
Sbjct  975  EHISYFVLFAIPLLTVTLT  993



>ref|XP_009337266.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=446

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTA G+ RIVDKG+EFEQVDRE+NWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTATGNGRIVDKGLEFEQVDREKNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRT GIILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  YWRTYGIILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF++FAIP+LTT++T
Sbjct  181  HISYFIIFAIPMLTTIYT  198



>ref|XP_004307280.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=623

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILTEWPWT LGSFKYVV+APF  HSTY ++ +   ++D +  LIFP++L RMLH
Sbjct  1    MASNPGILTEWPWTRLGSFKYVVVAPFAIHSTYSFIVNEWEDKDLSYFLIFPYMLFRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRT+KG  RI+DKG+EFEQVDRERNWDDQII N +LFY G  +L    ++P
Sbjct  61   NQLWISLSRYRTSKGSGRIIDKGLEFEQVDRERNWDDQIIFNAILFYIGRMRLDGGRNVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG ++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121  LWRADGFVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIP++T   T
Sbjct  181  HIAYFILFAIPMMTMALT  198



>ref|XP_006428971.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
 ref|XP_006480706.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|ESR42211.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
Length=627

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LG+FKY+VLAP++ HSTY ++     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYIVLAPWIIHSTYSFMVKDEKERDLLNFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYK-LPITHHM  372
            NQ+WISLSRYRTAKG NRIVDK IEFEQVDRERNWDDQIIL+G+LFY  + K LP    +
Sbjct  61   NQIWISLSRYRTAKGRNRIVDKPIEFEQVDRERNWDDQIILSGILFYVVFGKMLPGGTQL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            PIWR DG+IL AL+H GPVEF+YYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFA
Sbjct  121  PIWRLDGVILMALLHAGPVEFVYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVTHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYFV+FA PL+TTV T
Sbjct  181  EHIAYFVVFATPLITTVLT  199



>gb|KHN30013.1| Protein WAX2 [Glycine soja]
Length=621

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFKY++LAP+V HS+Y  L    +ERD +  LIFPFLL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKYLLLAPWVVHSSYSVLVKDKSERDISTFLIFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRYRTAKG+ RIVDKGIEF+QVDRER+WDDQI+ NGLL+Y   Y L     +P
Sbjct  61   NQIWITLSRYRTAKGNARIVDKGIEFDQVDRERDWDDQILFNGLLYYLASYTLSGASRIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVMAILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LFAIP LT VFT
Sbjct  181  HILYFLLFAIPKLTLVFT  198



>gb|KEH17984.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=658

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFKYVVLAP+V HSTY  +    +ERD +  LIFPFLL R+LH
Sbjct  37   MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSLIVKDKSERDVSTFLIFPFLLWRVLH  96

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRT+KG+NRI+DKGIEF+QVDRE++WDDQI+ NGLL+Y   Y L     +P
Sbjct  97   NQIWISLSRYRTSKGNNRILDKGIEFDQVDREKDWDDQILFNGLLYYLACYTLEGASRLP  156

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+  L+H G VEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  157  LWRTDGVIIAILLHAGAVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  216

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LFAIP LT VFT
Sbjct  217  HISYFLLFAIPKLTLVFT  234



>ref|XP_006354678.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+ KY+VLAPFV HS Y + +    ++RD + + IF ++++RM+
Sbjct  1    MATKPGILTEWPWASLGNLKYLVLAPFVGHSIYSFFMGKEESQRDFSYIFIFFYIVMRMV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H+Q+WISLSRYRTAKGDNRI+D+ IEF+QVDRE NWDDQIILNG++FY GY K   THH+
Sbjct  61   HHQMWISLSRYRTAKGDNRILDRSIEFDQVDRETNWDDQIILNGVVFYIGYLKFAETHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WR DGII+TALIHTGPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEP T+VIHPFA
Sbjct  121  PLWRIDGIIITALIHTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPHTAVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E + Y+ LF IPL TT+FT
Sbjct  181  EIVTYYTLFFIPLATTIFT  199



>ref|XP_010054531.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76798.1| hypothetical protein EUGRSUZ_D01149 [Eucalyptus grandis]
Length=620

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGSFKY++LAP+  H TY++++    ERD +  L+ PFLL R+LH
Sbjct  1    MASKPGILTEWPWKPLGSFKYMILAPWAIHGTYQFISKGAGERDSSYFLVLPFLLARLLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SR+R AKG+NRIVD+GIEFEQVDRE NWDDQI+LNG+LFY  +  +P   H+P
Sbjct  61   NQIWISYSRHRIAKGNNRIVDRGIEFEQVDRESNWDDQILLNGILFYVSHMIIPQASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+T LIH   VEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPI+SVIHPFAE
Sbjct  121  LWRTDGVIITVLIHASVVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LFAIP+ TT+F
Sbjct  181  HMAYFMLFAIPMFTTLF  197



>ref|XP_004510147.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cicer arietinum]
Length=622

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPWT LGSFK+V+L P+VAHSTY +  +   ERD +  LIFP+L++RMLH
Sbjct  1    MASKPGILTNWPWTPLGSFKWVILTPWVAHSTYSFFVNGSEERDLSNFLIFPYLMVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WISLSR+RTAKG +RIVDK IEFEQVDRE NWDDQI+ NG++FY G   +  +  +P
Sbjct  61   DQIWISLSRHRTAKGKSRIVDKSIEFEQVDRESNWDDQILFNGVIFYIGQMFIEESRKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG+I+T L+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  IWRTDGVIITILLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIPL TT  T
Sbjct  181  HIAYFMLFAIPLYTTAIT  198



>ref|XP_011093465.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=624

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPWT LG+FKYVVLAP+V HSTY Y+T   +ERD + LLI P LL R++H
Sbjct  1    MASKPGILTEWPWTRLGNFKYVVLAPWVVHSTYSYMTKDESERDLSYLLILPLLLSRVIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRERNWDDQIIL+G + Y G   +   H +P
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRERNWDDQIILSGFVLYLGSRHIQAAHCLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+I T L H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVIWTFLFHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HIAY+++F++P+L T+ 
Sbjct  181  HIAYYLIFSLPVLFTLL  197



>ref|XP_002892018.1| hypothetical protein ARALYDRAFT_887207 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68277.1| hypothetical protein ARALYDRAFT_887207 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ ALIH GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALIHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYFVLFAIP
Sbjct  181  HIAYFVLFAIP  191



>ref|XP_008356893.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=375

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNBEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNXILFYLGRH-LPGAVNLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG ILT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  120  FWRTDGXILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF LFAIPLLTT+ T
Sbjct  180  HISYFTLFAIPLLTTILT  197



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   L     +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLAEGKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ ALIHTGPVEFLYYW+H+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMGALIHTGPVEFLYYWVHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIPLLTT+ T
Sbjct  181  HIAYFILFAIPLLTTLVT  198



>ref|XP_010097746.1| Protein WAX2 [Morus notabilis]
 gb|EXB70701.1| Protein WAX2 [Morus notabilis]
Length=618

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLT-DSPNERDPNillifpflliRML  192
            MA+ PGILT+WPW  LGSFKYV+LAP+V + T+ +LT D P +RD +  LIFP +L RM+
Sbjct  1    MATTPGILTDWPWKHLGSFKYVILAPWVINGTHSFLTKDDPQDRDLSYFLIFPLMLWRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSRYRTAKG+NRI+DKG+EF+QVDRERNWDDQI+ N ++FY G   LP   ++
Sbjct  61   HNQIWISLSRYRTAKGNNRILDKGLEFDQVDRERNWDDQILFNAIIFYLGSQLLPGGSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+W+TDG+ILT L+H   VEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PMWKTDGVILTILLHASVVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF LFAIPL TTVFT
Sbjct  181  EHIAYFTLFAIPLYTTVFT  199



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  24   MATKPGVLTDWPWTSLGSFKYIVVAPWVVHSTYRFVTDDPEKRDLGYSLVFPFLLFRILH  83

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY TAKG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  84   NQVWISLSRYYTAKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  143

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  144  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  203

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  204  HIAYFMLFAIP  214



>ref|XP_006354618.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=589

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+ KY+VLAPF  HS Y + ++   ++RD   +L+ PF L RM+
Sbjct  1    MATKPGILTEWPWAGLGNLKYLVLAPFACHSIYTFFMSRDESQRDMFYILVLPFTLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H QLWIS+SRYRTAKG+NRI+DK IEF+QVDRE NWDDQIIL GL++Y GY  +   HHM
Sbjct  61   HYQLWISISRYRTAKGNNRIIDKSIEFDQVDRESNWDDQIILFGLVYYIGYLIVEQAHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+TALIH GPVEFLYYW HRALHHH LYSRYHSHHHSSI TEPIT+VIHPFA
Sbjct  121  PVWRTDGIIITALIHIGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITAVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY++LFAIP+ TTVFT
Sbjct  181  ELLAYYMLFAIPVFTTVFT  199



>ref|XP_008232261.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG+FK+V+LAP++ H  Y ++ +   E+D +  LIFPF+L RM+H
Sbjct  1    MASTPGILTDWPWTPLGNFKHVILAPWIIHGAYSFVVNDGKEKDLSYFLIFPFMLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRY+TAKG+ RIVDK +EFEQVDRERNWDDQI+ NG+LFY G   +P    +P
Sbjct  61   NQIWITLSRYQTAKGNGRIVDKPLEFEQVDRERNWDDQIVFNGILFYLGSRHMPGAQQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLLTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF LFAIP+LTT+ T
Sbjct  181  HIAYFTLFAIPMLTTILT  198



>ref|XP_009339872.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=429

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYLGRH-LPGAVNLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  120  FWRTDGVILTILLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF LFAIPL+TT+ T
Sbjct  180  HILYFTLFAIPLMTTILT  197



>gb|AAC24374.1| CER1 protein [Arabidopsis thaliana]
Length=580

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFILFAIP  191



>ref|XP_011012757.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFK+++LAP+V HSTY ++    +E+D +  L FP LL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKHLILAPWVIHSTYSFMIQ--DEKDLSTFLAFPLLLWRMLH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQI+ NG+LFY G   +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIVDKAIEFDQVDRESNWDDQILFNGILFYVGIKTIPGASHLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+I+TALIH GPVEFLYYWLHR LHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  LWRLDGVIITALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LFAIPL+TT+ T
Sbjct  179  HISYFMLFAIPLITTIMT  196



>dbj|BAA11024.1| possible aldehyde decarbonylase [Arabidopsis thaliana]
Length=567

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFILFAIP  191



>ref|XP_006354617.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+ KY+VLAPF  HS Y + ++   ++RD   +L+ PF L RM+
Sbjct  1    MATKPGILTEWPWAGLGNLKYLVLAPFACHSIYTFFMSRDESQRDMFYILVLPFTLSRMI  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H QLWIS+SRYRTAKG+NRI+DK IEF+QVDRE NWDDQIIL GL++Y GY  +   HHM
Sbjct  61   HYQLWISISRYRTAKGNNRIIDKSIEFDQVDRESNWDDQIILFGLVYYIGYLIVEQAHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+TALIH GPVEFLYYW HRALHHH LYSRYHSHHHSSI TEPIT+VIHPFA
Sbjct  121  PVWRTDGIIITALIHIGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITAVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY++LFAIP+ TTVFT
Sbjct  181  ELLAYYMLFAIPVFTTVFT  199



>ref|XP_010496714.1| PREDICTED: protein ECERIFERUM 1 isoform X2 [Camelina sativa]
Length=625

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>ref|XP_007134355.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
 gb|ESW06349.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
Length=625

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFK+V+L P++ HSTY ++ + P +R+    LIFP++L+RMLH
Sbjct  1    MASKPGILTHWPWEPLGSFKWVILTPWIVHSTYSFIVNDPKDRELAYFLIFPYMLVRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WI+LSR+R AKG +RIVDKGIEFEQVDRE NWDDQI+ NG+LFY G+  +P    MP
Sbjct  61   DQIWITLSRHRNAKGKSRIVDKGIEFEQVDRESNWDDQILFNGILFYAGHMLIPEASKMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+++TA++H G VEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  FWRMDGVVITAVLHAGAVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIPL TTV T
Sbjct  181  HIAYFLLFAIPLYTTVVT  198



>ref|XP_010496480.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=625

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>ref|XP_010496713.1| PREDICTED: protein ECERIFERUM 1 isoform X1 [Camelina sativa]
Length=625

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>ref|XP_004170720.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=507

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG+FKYVVLAP   +S Y+Y+     ERD + L+I P LL RM+H
Sbjct  1    MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVKDEAERDTSSLVIIPLLLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SR+RTAKG+ RIVDKG+EF+QVDRERNWDDQI+LNG+LFY          ++P
Sbjct  61   NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVSNLTAKGRNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ YF+LFAIP+LT +FT
Sbjct  181  HLTYFLLFAIPMLTVLFT  198



>ref|XP_010520222.1| PREDICTED: protein ECERIFERUM 1-like [Tarenaya hassleriana]
Length=631

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILTEWPWT LG FK+V++AP+V  STYK++    +ERD    L+FP LL R++H
Sbjct  1    MATKPGILTEWPWTSLGRFKFVIVAPWVVDSTYKFMRGEESERDLVYFLVFPMLLSRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            N LWISLSRY TAKG+ RIVDKGI+F QVDRE NWDDQI+ NG+LFY GY  LP    +P
Sbjct  61   NLLWISLSRYVTAKGNRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGYTFLPEAKKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++ AL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  121  MWRTDGVVMAALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF LFAIP LTTV T
Sbjct  181  HIAYFTLFAIPTLTTVMT  198



>gb|AIE57503.1| CER1 [Camelina sativa]
Length=625

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P  RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPETRDIGYSLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFILFAIP  191



>gb|KJB76288.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=488

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
             MAS+PGILT+WPW  LGSFKY++L P +    Y ++     + D + L +FPF+L RML
Sbjct  7    SMASKPGILTDWPWKPLGSFKYIILVPLITEHIYSFMVKD-EDIDVSKLALFPFVLWRML  65

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQLWISLSRYRTAKG N+IVDKGIEF+QVDRER+WDDQI+ N +LFY G   +P   H+
Sbjct  66   HNQLWISLSRYRTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYLGNIYVPGGSHL  125

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  126  PFWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  185

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IP+LTTV T
Sbjct  186  EHIAYFLLFSIPILTTVLT  204



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFILFAIP  191



>ref|XP_010324966.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum lycopersicum]
Length=626

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+FKY+VLAPFV HS Y + ++   ++RD + + IF ++++RM+
Sbjct  1    MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H+Q+WISLSRYR+AKGDNRI+D+ IEF+QVDRE NWDDQII NG+ FY  Y K   THH+
Sbjct  61   HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKFSETHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WR DGII+TAL+HTGPVEFLYYW+HRALHHH LYSRYHSHHHSSIVTEP T+VIHPFA
Sbjct  121  PLWRIDGIIITALLHTGPVEFLYYWIHRALHHHFLYSRYHSHHHSSIVTEPHTAVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E + Y+ LF IPL+TTV T
Sbjct  181  EIVTYYTLFFIPLVTTVLT  199



>ref|XP_007218863.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
 gb|EMJ20062.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
Length=623

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG+FK+V+LAP++ H  Y ++ +   E+D +  LIFPF+L RM+H
Sbjct  1    MASTPGILTDWPWTPLGNFKHVILAPWIIHGAYSFVVNDGKEKDLSYFLIFPFMLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRY+TAKG+ RIVDK +EFEQVDRERNWDDQI+ NG+LF  G   +P   ++P
Sbjct  61   NQIWITLSRYQTAKGNGRIVDKPLEFEQVDRERNWDDQIVFNGILFCLGSRHMPGAQNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVLLTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYFVLFAIP+LTT  T
Sbjct  181  HIAYFVLFAIPMLTTTLT  198



>ref|XP_004229695.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum lycopersicum]
Length=625

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILTEWPW  LG+FKY+VLAPFV HS Y + ++   ++RD + + IF ++++RM+
Sbjct  1    MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H+Q+WISLSRYR+AKGDNRI+D+ IEF+QVDRE NWDDQII NG+ FY  Y K   THH+
Sbjct  61   HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKFSETHHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WR DGII+TAL+HTGPVEFLYYW+HRALHHH LYSRYHSHHHSSIVTEP T+VIHPFA
Sbjct  121  PLWRIDGIIITALLHTGPVEFLYYWIHRALHHHFLYSRYHSHHHSSIVTEPHTAVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E + Y+ LF IPL+TTV T
Sbjct  181  EIVTYYTLFFIPLVTTVLT  199



>gb|EMS51792.1| Protein WAX2 [Triticum urartu]
Length=423

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +T    + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMTKGWGDIDLAYSLILPSLALRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEFEQVDRER WDDQI+ NGLLFY GY  +P     P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFEQVDRERGWDDQIVFNGLLFYAGYLAMPSVRRFP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI YF LFAIP+L+TV+
Sbjct  181  HIVYFTLFAIPMLSTVY  197



>ref|XP_002320584.1| ECERIFERUM 1 family protein [Populus trichocarpa]
 gb|EEE98899.1| ECERIFERUM 1 family protein [Populus trichocarpa]
Length=622

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFK+V+LAP+V HSTY ++    + +D +  L FP LL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPWVIHSTYSFMIK--DGKDLSTFLAFPLLLWRMLH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+NRI+DK IEF+QVDRE +WDDQI+ NG+LFY G + +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKAIEFDQVDRESSWDDQILFNGILFYVGIHTIPGASHLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+I+TALIH GPVEFLYYWLHR LHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  MWRLDGVIITALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LFAIPL+TT+ T
Sbjct  179  HISYFILFAIPLITTILT  196



>gb|ABD28319.2| Sterol desaturase [Medicago truncatula]
Length=493

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
             MAS+PGILT+WPW  LGSFK+++L+P++AHS Y ++     ERDP   +IFPF+LIRML
Sbjct  9    NMASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIW---GERDPVYHVIFPFMLIRML  65

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WIS+SRY+TAKG ++IVDKG+EFEQVDRE NWDDQI+   L++Y GY   P+  ++
Sbjct  66   HNQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPMASNL  125

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WR DG+ILTA++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFA
Sbjct  126  PWWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVTHPFA  185

Query  553  EHIAYFVLFAIPLLTTVF  606
            EH++YF LFAIP+LTT+F
Sbjct  186  EHLSYFTLFAIPMLTTLF  203



>gb|KHN40121.1| Protein WAX2 [Glycine soja]
Length=624

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGIL++WPW  LGSFKY++LAP + HS+Y  +    +E+D    LI PFLL RMLH
Sbjct  1    MASRPGILSDWPWKPLGSFKYMLLAPCIVHSSYSMMVKDNSEKDMFNFLILPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+ SRYRTAKG+ RIVDKGIEF+QVDRERNWDDQI+ +GL+FY   Y      H+P
Sbjct  61   NQIWITFSRYRTAKGNARIVDKGIEFDQVDRERNWDDQILFSGLIFYLANYVFAGASHIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W+TDG ++  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWKTDGAVMAILLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF LFAIPLLT  FT
Sbjct  181  HISYFFLFAIPLLTLAFT  198



>ref|XP_009337264.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Pyrus x bretschneideri]
Length=616

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYLGRH-LPGAVNLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYWL RALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  120  FWRTDGVILTILLHAGPVEFLYYWLPRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF++FAIP+LTT++T
Sbjct  180  HISYFIIFAIPMLTTIYT  197



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+LT+WPWT LG FKYVVLAP+VAHS Y   T   +ERD   LLI PFLL RMLH
Sbjct  1    MATTPGLLTDWPWTPLGRFKYVVLAPWVAHSIYSNATKGESERDLTNLLILPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR+RTA G NRIVDK IEFEQVDRE NWDDQIILNG+LFY     L     +P
Sbjct  61   DQIWISISRHRTANGKNRIVDKTIEFEQVDRESNWDDQIILNGILFYIFNNLLSNASRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+ILT+L+H+GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121  LWRTDGVILTSLLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIP+L T +T
Sbjct  181  HIAYFLLFAIPILATWYT  198



>ref|XP_009337263.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Pyrus x bretschneideri]
Length=622

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYLGRH-LPGAVNLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILT L+H GPVEFLYYWL RALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  120  FWRTDGVILTILLHAGPVEFLYYWLPRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF++FAIP+LTT++T
Sbjct  180  HISYFIIFAIPMLTTIYT  197



>ref|XP_010052747.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Eucalyptus grandis]
Length=620

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LG FKY+VLAP+V HSTY ++     ERD    LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGIFKYMVLAPWVIHSTYVFVNSEGRERDLFTFLIFPFLLWRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+W++LSRYR A+G+ RI+DKGIEF QVDRERNWDDQI+LNGL+FY G   LP    +P
Sbjct  61   NQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGASRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            H+AYF LFAIPL TTV
Sbjct  181  HLAYFTLFAIPLYTTV  196



>ref|XP_010052731.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76801.1| hypothetical protein EUGRSUZ_D01152 [Eucalyptus grandis]
Length=627

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LGSFKY+VLAP+V +STY ++  +  ERD +  LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGSFKYLVLAPWVVYSTYVFVNSNGRERDMSTFLIFPFLLWRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WI+LSRYR A+G+ RIVDKGIEFEQVDRER+WDDQI+ NGL+FY G   L    H+P
Sbjct  61   SQIWITLSRYRNARGNGRIVDKGIEFEQVDRERDWDDQILFNGLIFYIGAMTLAGGSHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR+DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHHSS+VTEPITSVIHPFAE
Sbjct  121  MWRSDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            H+AYF LFA+P  TTV
Sbjct  181  HLAYFALFAMPQYTTV  196



>ref|XP_006647531.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=619

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  LG+FKYVV+AP V H  ++ ++    + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGAHRVVSKGWGDIDLAYSLILPSLLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGLLFY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLLFYVGYLAMPSVRRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVMTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LFAIP+L+T++
Sbjct  181  HVVYFILFAIPILSTIY  197



>ref|XP_010052746.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW76818.1| hypothetical protein EUGRSUZ_D01172 [Eucalyptus grandis]
Length=627

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LG FKY+VLAP+V HSTY ++     ERD    LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGIFKYMVLAPWVIHSTYVFVNSEGRERDLFTFLIFPFLLWRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+W++LSRYR A+G+ RI+DKGIEF QVDRERNWDDQI+LNGL+FY G   LP    +P
Sbjct  61   NQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGASRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            H+AYF LFAIPL TTV
Sbjct  181  HLAYFTLFAIPLYTTV  196



>emb|CDP09363.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGIL +WPWT LG+FKYVVLAP+V H TY Y+    ++R+  + L+ PFLL+RMLH
Sbjct  1    MASKPGILYDWPWTPLGNFKYVVLAPWVIHHTYPYMVKDASDRNLPMFLVLPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRYRTAKG NRIVDK IEFEQ+DRERNWDD II NG++FY     L  T  MP
Sbjct  61   NQIWISYSRYRTAKGTNRIVDKSIEFEQIDRERNWDDNIIFNGIVFYM-VATLKNTADMP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  120  IWRTDGVIITILLHVGPVEFLYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+AYF+LFAIP+ TT F+
Sbjct  180  HVAYFLLFAIPMATTFFS  197



>gb|KFK42594.1| hypothetical protein AALP_AA1G015600 [Arabis alpina]
Length=624

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LGSFKY+V+AP+  HS YK +TD   + D    L+ PFLL+R+LH
Sbjct  1    MATKPGILTDWPWTPLGSFKYIVIAPWAIHSIYKLVTDDLEKIDLGYSLVLPFLLLRVLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T KG+ RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP   H+P
Sbjct  61   NQVWISLSRYYTVKGERRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGISLLPEAKHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++TAL+H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  VWRTDGVLMTALLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  181  HIAYFMLFAIP  191



>gb|KHG15491.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=612

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKY++L P +    Y ++ +   + D + L++FPF+L RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYILLVPLITEHIYSFM-EKDEDIDVSKLVLFPFMLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRY TAKG N+IVDKGIEF+QVDRER+WDDQI+ N +LFYWG   +P   H+P
Sbjct  60   NQLWISLSRYLTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYWGNKYVPGGSHLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  120  FWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LFAIP+LTTV T
Sbjct  180  HIAYFLLFAIPILTTVLT  197



>ref|NP_001047459.1| Os02g0621300 [Oryza sativa Japonica Group]
 dbj|BAD21539.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAD21579.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAF09373.1| Os02g0621300 [Oryza sativa Japonica Group]
Length=619

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  LG+FKYVV+AP VAH   + + +   + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWHRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGL+FY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LFAIP+L+T++
Sbjct  181  HVVYFILFAIPILSTIY  197



>gb|EEC73617.1| hypothetical protein OsI_08114 [Oryza sativa Indica Group]
Length=619

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  LG+FKYVV+AP VAH   + + +   + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWHRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGL+FY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LFAIP+L+T++
Sbjct  181  HVVYFILFAIPILSTIY  197



>ref|XP_010052726.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=620

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKY++LAP++AH TY+++   P ERD +  LI PFLL R++H
Sbjct  1    MASKPGILTDWPWKPLGSFKYMILAPWMAHGTYQFIAKGPGERDFSYFLILPFLLERIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L G+L Y   + +P   H+P
Sbjct  61   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTGILLYMTNWTIPQASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W+TDG+I+T LIH   VE+LYYWLHRALHHH LYSRYHSHHHSS+VTEPI+S++HPFAE
Sbjct  121  LWKTDGVIITVLIHALVVEYLYYWLHRALHHHFLYSRYHSHHHSSVVTEPISSIVHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI Y +LFAIP+ TTVFT
Sbjct  181  HIVYAMLFAIPMYTTVFT  198



>ref|XP_009586962.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=617

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG LT+WPW  LGSFKYV+LAP++AHS Y   T   +E D   LLI PFLL RMLH
Sbjct  1    MATTPGFLTDWPWKHLGSFKYVILAPWIAHSVYCLATKEQHETDSTNLLILPFLLSRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWIS SRYRTAKG+NRIVDKGIEF+QVDRE NWDDQIILNG+L Y          ++P
Sbjct  61   NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGILLYVFNTMSSAASNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR+DG+I++  +H GPVEFLYYWLHR+LHHH LYSRYHSHHHSSI TEPITSVIHPFAE
Sbjct  121  LWRSDGVIMSIFLHAGPVEFLYYWLHRSLHHHYLYSRYHSHHHSSIATEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LF IP L+TVFT
Sbjct  181  HIAYFLLFGIPTLSTVFT  198



>ref|XP_004133955.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN56665.1| hypothetical protein Csa_3G127760 [Cucumis sativus]
Length=624

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG+FKYVVLAP   +S Y+Y+     ERD + L+I P LL RM+H
Sbjct  1    MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVKDEAERDTSSLVIIPLLLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SR+RTAKG+ RIVDKG+EF+QVDRERNWDDQI+LNG+LFY          ++P
Sbjct  61   NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVSNLTAKGRNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ YF+LFAIP+LT +FT
Sbjct  181  HLTYFLLFAIPMLTVLFT  198



>ref|XP_008438253.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=624

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG+FKYVVLAP   +S Y+Y+     ERD + L++ P LL RM+H
Sbjct  1    MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVRDEAERDTSSLVVIPLLLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SR+RTAKG+ RIVDKG+EF+QVDRERNWDDQI+LNG+LFY          ++P
Sbjct  61   NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVANLTAKGRNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ YF+LFAIP+LT +FT
Sbjct  181  HLTYFLLFAIPMLTVLFT  198



>ref|XP_010691966.1| PREDICTED: protein ECERIFERUM 1-like [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFKYV++APF+ HS Y Y+  +  ERD   + + PF+L RMLH
Sbjct  1    MASKPGILTHWPWEPLGSFKYVIVAPFLVHSIYLYVVGA-EERDLTYIAVVPFMLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRYRTAKG+N IVD+ +EFEQVDRERNWDDQI+LNG+LFY GY+ L     +P
Sbjct  60   NQIWISFSRYRTAKGNNLIVDRSLEFEQVDRERNWDDQILLNGMLFYAGYWVLEAAKSLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG I   L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  120  LWRFDGFIQIFLLHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVF  606
            HI YF+LFAIP+L+T F
Sbjct  180  HIVYFILFAIPILSTTF  196



>ref|XP_009797701.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=617

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG LT+WPW  LGSFKYV+LAP++AHS Y   T    ERD   LLI PFLL RM+H
Sbjct  1    MATTPGFLTDWPWKHLGSFKYVILAPWIAHSFYCLATKEQEERDSTNLLIVPFLLSRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWIS SRYRTAKG+NRIVDKGIEF+QVDRE NWDDQIILNG+L Y          ++P
Sbjct  61   NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGILLYVFNTMTSAATNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W+++G+I++  +H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWKSEGVIMSIFLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LF IP L+TVFT
Sbjct  181  HISYFLLFGIPTLSTVFT  198



>ref|XP_010535407.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Tarenaya hassleriana]
Length=584

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LG +K+V+LAP+  HSTYK +     ERD    LIFP+LL+RMLH
Sbjct  1    MATKPGILTDWPWTPLGRYKFVILAPWAVHSTYKLMKGGEEERDWGYFLIFPYLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            N +WISLSRY TA+G  RI+DKGI+F QVDRE NWDDQI+ NG+LFY GY  +     MP
Sbjct  61   NLVWISLSRYVTARGKRRILDKGIDFNQVDRETNWDDQILFNGVLFYVGYILMEGAKQMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+H GPVE LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVMTALLHAGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            HIAYFVLFAIP++TTV
Sbjct  181  HIAYFVLFAIPMITTV  196



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+ TEWPW  LG+FKY+VLAP+  HS Y  ++    E D   L+I P LL+RMLH
Sbjct  1    MASRPGLFTEWPWQRLGNFKYLVLAPWSLHSLYLAVSKERKELDLTYLIILPSLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+R++ A+  NRIVDK IEFEQVDRERNWDDQII NG+LFY GY+ +P   ++P
Sbjct  61   NQVWISLARFQNARSKNRIVDKSIEFEQVDRERNWDDQIIFNGILFYLGYFYIPGATNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG +L AL+H GPVEFLYYW HRALHHH LYSRYHSHHH+S+VTEPITSVIHPFAE
Sbjct  121  VWRTDGALLMALLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASVVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ YF+LF+IP++TT+ T
Sbjct  181  HVVYFLLFSIPMVTTIVT  198



>gb|KJB67450.1| hypothetical protein B456_010G191300 [Gossypium raimondii]
Length=671

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    IVLPKMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfll  180
            +V   MAS PGILT+WPW  LGSFKY++LAP++  S Y  +       D   L I P +L
Sbjct  43   VVHQSMASEPGILTDWPWKPLGSFKYIILAPWITESIYSIIVGDEKGWDVFNLTILPLML  102

Query  181  iRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPI  360
             RMLH+QLWISLSRYRTAKG NRIVDKGIEF+QVDRERNWDDQI+ N ++FY G    P 
Sbjct  103  WRMLHSQLWISLSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNAIIFYLGNKYFPG  162

Query  361  THHMPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVI  540
              H+PIWRTDG+I+T L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVI
Sbjct  163  GSHIPIWRTDGVIITMLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVI  222

Query  541  HPFAEHIAYFVLFAIPLLTTVFT  609
            HPFAEHI YF LFAIP+ T VFT
Sbjct  223  HPFAEHIVYFALFAIPVSTVVFT  245



>gb|KJB76287.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=631

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
             MAS+PGILT+WPW  LGSFKY++L P +    Y ++     + D + L +FPF+L RML
Sbjct  7    SMASKPGILTDWPWKPLGSFKYIILVPLITEHIYSFMVKD-EDIDVSKLALFPFVLWRML  65

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQLWISLSRYRTAKG N+IVDKGIEF+QVDRER+WDDQI+ N +LFY G   +P   H+
Sbjct  66   HNQLWISLSRYRTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYLGNIYVPGGSHL  125

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  126  PFWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  185

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IP+LTTV T
Sbjct  186  EHIAYFLLFSIPILTTVLT  204



>ref|XP_008438262.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cucumis melo]
Length=621

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKY+VLAP V HS Y Y+     ERD + L IFPFLL RM+H
Sbjct  1    MASTPGILTDWPWKPLGSFKYLVLAPGVIHSLYHYIAKDETERDISYLFIFPFLLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SRYRTAKG  RIVDKG+EFEQVDRERNWDDQI+LNG+LFY     +    ++P
Sbjct  61   SQIWISFSRYRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYIASNCIEKASNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++  L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
              AYFVLFAIP++T VF+
Sbjct  181  EFAYFVLFAIPIMTAVFS  198



>ref|XP_008438263.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Cucumis melo]
Length=620

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKY+VLAP V HS Y Y+     ERD + L IFPFLL RM+H
Sbjct  1    MASTPGILTDWPWKPLGSFKYLVLAPGVIHSLYHYIAKDETERDISYLFIFPFLLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SRYRTAKG  RIVDKG+EFEQVDRERNWDDQI+LNG+LFY     +    ++P
Sbjct  61   SQIWISFSRYRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYIASNCIEKASNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++  L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
              AYFVLFAIP++T VF+
Sbjct  181  EFAYFVLFAIPIMTAVFS  198



>gb|KJB76254.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
 gb|KJB76255.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=489

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
             MAS+PG+LT+WPW  LGSFKY++L P +A   Y ++     + D + L +FP +L RML
Sbjct  7    SMASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDNKDIDVSKLALFPSMLWRML  66

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQLWISLSRYR AKG N+IVDKGIEF+QVDRER+WDD I+ + +LFYWG   +P    +
Sbjct  67   HNQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAILFYWGNKCVPGGSRV  126

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  127  PYWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  186

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IP+ T V T
Sbjct  187  EHIAYFLLFSIPVFTMVLT  205



>ref|XP_010535406.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Tarenaya hassleriana]
Length=628

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LG +K+V+LAP+  HSTYK +     ERD    LIFP+LL+RMLH
Sbjct  1    MATKPGILTDWPWTPLGRYKFVILAPWAVHSTYKLMKGGEEERDWGYFLIFPYLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            N +WISLSRY TA+G  RI+DKGI+F QVDRE NWDDQI+ NG+LFY GY  +     MP
Sbjct  61   NLVWISLSRYVTARGKRRILDKGIDFNQVDRETNWDDQILFNGVLFYVGYILMEGAKQMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+H GPVE LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVMTALLHAGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            HIAYFVLFAIP++TTV
Sbjct  181  HIAYFVLFAIPMITTV  196



>ref|XP_010054532.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76800.1| hypothetical protein EUGRSUZ_D01151 [Eucalyptus grandis]
Length=536

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LG+FKY+VLAP+V HSTY ++     ERD    LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGNFKYMVLAPWVIHSTYVFVNSEERERDLFTFLIFPFLLWRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRYR A+G+ RI+DKGIEF QVDRERNWDDQI+LNGL+FY G   L     +P
Sbjct  61   NQIWITLSRYRNARGNGRIIDKGIEFVQVDRERNWDDQILLNGLIFYIGAMTLAGAPRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSHHH+SIVTEPITSV HPFAE
Sbjct  121  MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVNHPFAE  180

Query  556  HIAYFVLFAIPLLTTV  603
            H+AYF LFAIPL TTV
Sbjct  181  HLAYFTLFAIPLYTTV  196



>ref|XP_006375527.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
 gb|ERP53324.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
Length=622

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFK+V+LAP V H+ Y ++    +E+D +  LIFP LL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVK--DEKDLSSFLIFPILLWRVLH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRERNWDDQI+ NG+LFY     +P   ++P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNWDDQILFNGILFYVSSKIIPGASYLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+ILTALIHTGPVEFLYYWLHR LHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  MWRLDGVILTALIHTGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+Y +LFAIPL+TT+ T
Sbjct  179  HISYSMLFAIPLITTIVT  196



>gb|KJB76252.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=533

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LGSFKY++L P +A   Y ++     + D + L +FP +L RMLH
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDNKDIDVSKLALFPSMLWRMLH  67

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYR AKG N+IVDKGIEF+QVDRER+WDD I+ + +LFYWG   +P    +P
Sbjct  68   NQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAILFYWGNKCVPGGSRVP  127

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  128  YWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  187

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LF+IP+ T V T
Sbjct  188  HIAYFLLFSIPVFTMVLT  205



>gb|EYU42308.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
 gb|EYU42309.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
Length=624

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPWTWLG+FKY+VLAP+   +TY +LT   N +  +  L+ P L+ R +H
Sbjct  1    MASKPGILTEWPWTWLGNFKYLVLAPWAVPATYSFLTKDDNRKYLSSFLVLPLLISRAVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            N +WISLSRYRTAKG+NRIVDK IEFEQVDRERNWDDQIILNG++ Y     +     +P
Sbjct  61   NLIWISLSRYRTAKGNNRIVDKSIEFEQVDRERNWDDQIILNGIIMYTAIMFIKYAQRVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             W TDG+I T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWSTDGLIWTFLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI+Y++LF+IPLLTT+F
Sbjct  181  HISYYLLFSIPLLTTLF  197



>ref|XP_003625020.1| Protein WAX2 [Medicago truncatula]
 gb|AES81238.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFK+++L+P++AHS Y ++     ERDP   +IFPF+LIRMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIW---GERDPVYHVIFPFMLIRMLH  57

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SRY+TAKG ++IVDKG+EFEQVDRE NWDDQI+   L++Y GY   P+  ++P
Sbjct  58   NQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPMASNLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+ILTA++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  118  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            H++YF LFAIP+LTT+F
Sbjct  178  HLSYFTLFAIPMLTTLF  194



>ref|XP_006375524.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
 gb|ERP53321.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
Length=584

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 167/198 (84%), Gaps = 2/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFK+V+LAP V H+ Y ++    +E+D    LIFP LL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVK--DEKDLPSFLIFPILLWRVLH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRE NWDDQI+ NG+LFY G   +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILFYVGSKIIPGASHLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+ILTALIH GPVEFLYYWLHR LHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  MWRLDGVILTALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+Y +LFAIPL+TT+ T
Sbjct  179  HISYSMLFAIPLITTIVT  196



>ref|XP_006583526.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Glycine max]
Length=522

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP V HS Y  L    +ERD    LI PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPSVVHSLYSMLAKDKSERDITNFLILPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSR+RTAKG+ RIVDKGIEF+QVDRERNWDDQI+L GL +Y   Y       +P
Sbjct  61   NQIWITLSRHRTAKGNGRIVDKGIEFDQVDRERNWDDQILLTGLTYYLSNYIFAGASRIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTD  ++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDAAVVTILLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+Y  LFA PLL  VFT
Sbjct  181  HISYLFLFATPLLILVFT  198



>ref|XP_007041186.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX97017.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=620

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 162/200 (81%), Gaps = 3/200 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpf--lliRM  189
            MA++PG+LT+WPW  LG+FKY +L P+V HSTY  L  S  E++ N+     F  L+ R+
Sbjct  1    MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLM-SKGEKEANLTYHLIFPFLMTRV  59

Query  190  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  369
            LHNQ+WIS+SRYRTAKG NRIVDKGI+FEQVDRE NWDDQIILNG+L Y     +P   H
Sbjct  60   LHNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMPGASH  119

Query  370  MPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPF  549
            +P+WR+DG I+  L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSI TEPITSVIHPF
Sbjct  120  LPLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPF  179

Query  550  AEHIAYFVLFAIPLLTTVFT  609
            AE +AYF+LFAIPL+T +FT
Sbjct  180  AEEVAYFLLFAIPLMTVMFT  199



>ref|XP_007041185.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOX97016.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=612

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 162/200 (81%), Gaps = 3/200 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpf--lliRM  189
            MA++PG+LT+WPW  LG+FKY +L P+V HSTY  L  S  E++ N+     F  L+ R+
Sbjct  1    MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLM-SKGEKEANLTYHLIFPFLMTRV  59

Query  190  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  369
            LHNQ+WIS+SRYRTAKG NRIVDKGI+FEQVDRE NWDDQIILNG+L Y     +P   H
Sbjct  60   LHNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMPGASH  119

Query  370  MPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPF  549
            +P+WR+DG I+  L+HTGPVEFLYYWLHRALHHH LYSRYHSHHHSSI TEPITSVIHPF
Sbjct  120  LPLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPF  179

Query  550  AEHIAYFVLFAIPLLTTVFT  609
            AE +AYF+LFAIPL+T +FT
Sbjct  180  AEEVAYFLLFAIPLMTVMFT  199



>ref|XP_006375521.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
 gb|ERP53318.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
Length=588

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 167/198 (84%), Gaps = 2/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFK+V+LAP V H+ Y ++    +E+D    LIFP LL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVK--DEKDLPSFLIFPILLWRVLH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRE NWDDQI+ NG+LFY G   +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILFYVGSKIIPGASHLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG+ILTALIH GPVEFLYYWLHR LHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  MWRLDGVILTALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+Y +LFAIPL+TT+ T
Sbjct  179  HISYSMLFAIPLITTIVT  196



>ref|XP_011093466.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=620

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILTEWPWTWLG+FKYVVLAP+V H+TY Y     +ERD    LI P LL RMLH
Sbjct  1    MASRPGILTEWPWTWLGNFKYVVLAPWVVHATYSYTMKEEDERDVAYFLILPLLLSRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TAKG+NRIVDK IEFEQV      DDQIILNG+LFY G   +   H +P
Sbjct  61   NQIWISLSRYQTAKGNNRIVDKSIEFEQVXXXXXXDDQIILNGILFYLGSRHMQAAHRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+I T L H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  WWRADGVIWTFLFHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HIAY+++F++PLL T+ 
Sbjct  181  HIAYYLIFSLPLLFTLL  197



>dbj|BAJ85405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +     + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYALILPSLALRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGLLFY GY  +P    +P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAIPNVRGLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI YF LFAIP+L+T++
Sbjct  181  HIVYFTLFAIPMLSTLY  197



>gb|KDO85386.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=495

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP V HS Y  L    +ERD    LI PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPSVVHSLYSMLAKDKSERDITNFLILPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSR+RTAKG+ RIVDKGIEF+QVDRERNWDDQI+L GL +Y   Y       +P
Sbjct  61   NQIWITLSRHRTAKGNGRIVDKGIEFDQVDRERNWDDQILLTGLTYYLSNYIFAGASRIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTD  ++T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDAAVVTILLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+Y  LFA PLL  VFT
Sbjct  181  HISYLFLFATPLLILVFT  198



>gb|KDO85384.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
 gb|KDO85385.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=533

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_006445498.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58738.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=533

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>gb|KGN56664.1| hypothetical protein Csa_3G127750 [Cucumis sativus]
Length=634

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+L GLL Y   Y +     +P
Sbjct  61   NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121  LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFVE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AYFVLFAIP++T VF+
Sbjct  181  ELAYFVLFAIPIMTAVFS  198



>ref|XP_004134362.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
Length=634

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+L GLL Y   Y +     +P
Sbjct  61   NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121  LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFVE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AYFVLFAIP++T VF+
Sbjct  181  ELAYFVLFAIPIMTAVFS  198



>ref|XP_003575378.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  LG+FKY+V+AP V H  ++ +T    + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVVVHGAHRVMTKGWGDIDLAYALILPSLLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQII NGLLFY GY  +P     P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIIFNGLLFYAGYLAMPSVRGFP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121  LWRTDGAVMTALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF LFAIP+L+T++
Sbjct  181  HVVYFTLFAIPMLSTIY  197



>emb|CBI16766.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 155/197 (79%), Gaps = 6/197 (3%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFK         +  Y  +     ERDP  +L F FLL R LH
Sbjct  32   MASKPGILTDWPWKSLGSFK------IQYYYIYSLIIKDGKERDPVYVLFFLFLLWRTLH  85

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+NRIVDK  +FEQVDRE NW DQI+LN +LFY GY  LP   HMP
Sbjct  86   NQIWISLSRYRTAKGNNRIVDKSNKFEQVDRESNWVDQILLNRILFYVGYMILPGAAHMP  145

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  146  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  205

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF+IPLL  +F
Sbjct  206  HLAYFILFSIPLLAGIF  222



>ref|XP_002526512.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35903.1| sterol desaturase, putative [Ricinus communis]
Length=622

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 2/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PG+ +EWPW  LGSFK+VVLAP+V +  Y  +     E++    LIFPFLL RM+H
Sbjct  1    MASMPGVFSEWPWKPLGSFKHVVLAPWVINHIYSIVVK--GEKENPSYLIFPFLLWRMVH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRERNWDDQ++LNG+LFY G   +P  + MP
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNWDDQVLLNGILFYVGAMVIPQANRMP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR D II+T L+H GPVEFLYYW HR LHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  MWRADSIIITILLHIGPVEFLYYWFHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+AYF+LFAIPLLTTV +
Sbjct  179  HLAYFILFAIPLLTTVLS  196



>gb|EPS60467.1| hypothetical protein M569_14337, partial [Genlisea aurea]
Length=623

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWTWLG++KY+V+APF   STY ++T   +ERD +  LI P +L R++H
Sbjct  1    MASNPGILTDWPWTWLGNYKYIVMAPFAVRSTYAFITKEAHERDLSNFLILPMMLWRVVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            N LWIS SRY+TAKG NRIVDK I+FEQVDRE NWDDQI+ NGLL Y G + +  +H++P
Sbjct  61   NLLWISFSRYKTAKGSNRIVDKNIDFEQVDREANWDDQILFNGLLLYVGQHYMRRSHNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             W   G+I T ++H GPVEFLYYWLHRALHHH LYSRYHSHHHSS+VTEPITSVIHPFAE
Sbjct  121  FWNAGGVIWTFVLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSVVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AY+ LFA PL++TV+
Sbjct  181  HLAYYALFASPLVSTVY  197



>ref|XP_009118866.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=644

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LG+FKY+V+AP+  HSTY+++TD P   D    L+ PFLL R+LH
Sbjct  17   MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYRFVTDDP--VDLGYSLVLPFLLFRILH  74

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T KG  RI+DKGI+F QVDRE NWDDQI+ NGLLFY G   LP    +P
Sbjct  75   NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  134

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++ A++H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  135  LWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  194

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  195  HIAYFILFAIP  205



>ref|XP_008438252.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=635

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKTLGSFKYVILAPWVVHSIYQYVVKDETERDVSSLVIFPFLLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+LNGLL Y   Y +     +P
Sbjct  61   NQIWISVSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLNGLLLYIVSYVMEEASKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121  LWRTDGMVIIFLLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFVE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AYF LFAIP++T VF+
Sbjct  181  ELAYFGLFAIPIMTAVFS  198



>gb|KJB76257.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=631

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LGSFKY++L P +A   Y ++     + D + L +FP +L RMLH
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDNKDIDVSKLALFPSMLWRMLH  67

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYR AKG N+IVDKGIEF+QVDRER+WDD I+ + +LFYWG   +P    +P
Sbjct  68   NQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAILFYWGNKCVPGGSRVP  127

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  128  YWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  187

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LF+IP+ T V T
Sbjct  188  HIAYFLLFSIPVFTMVLT  205



>gb|KJB76256.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=642

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG+LT+WPW  LGSFKY++L P +A   Y ++     + D + L +FP +L RMLH
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDNKDIDVSKLALFPSMLWRMLH  67

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWISLSRYR AKG N+IVDKGIEF+QVDRER+WDD I+ + +LFYWG   +P    +P
Sbjct  68   NQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAILFYWGNKCVPGGSRVP  127

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  128  YWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  187

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF+LF+IP+ T V T
Sbjct  188  HIAYFLLFSIPVFTMVLT  205



>gb|KCW76761.1| hypothetical protein EUGRSUZ_D01120 [Eucalyptus grandis]
Length=568

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKY +LAP+V   T++++   P ERD +  LI PF+L RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYAILAPWVVQGTHQFIAKGPGERDFSYFLILPFILERMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR+RTAKG+NRI+++GIEFEQVDRE NWDDQI+L  +L Y  ++ +P   H+P
Sbjct  61   NQIWISLSRHRTAKGNNRILERGIEFEQVDRESNWDDQILLTAILLYMVHWAIPQASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W+TDG+I+T LIH   VE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPI+S++HPFAE
Sbjct  121  LWKTDGVIITFLIHAFVVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSIVHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAY +LFAIP+ TTV T
Sbjct  181  HIAYAMLFAIPMYTTVIT  198



>ref|XP_004493412.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=620

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFK V+++P++AHS Y ++     ERDP   LIFP +  R+LH
Sbjct  1    MASKPGILTNWPWKPLGSFKLVIISPWIAHSIYSFIK---GERDPVYQLIFPHIFFRLLH  57

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SRY+TAKG ++IVDKG+EFEQVDRE NWDDQI+   L+ Y GY  +P++ ++P
Sbjct  58   SQIWISVSRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALITYIGYTIMPMSANLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG++ TA++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  118  WWRTDGVVFTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFGE  177

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+AYF LFAIP+LTT+ T
Sbjct  178  HLAYFTLFAIPILTTILT  195



>gb|KDO85383.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=602

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_006365794.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=625

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LG+FKY+VL PFV HS Y +L     E D   + I PFLL R +H
Sbjct  1    MASKPGILTEWPWANLGNFKYLVLVPFVGHSIYSFL----REGDIGYIAILPFLLFRFIH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR+RTAKG+NRIVD+ IEF+QVDRE +WDDQII NGLL+Y GY ++   HH+P
Sbjct  57   NQIWISLSRHRTAKGNNRIVDRSIEFDQVDRENSWDDQIIFNGLLYYIGYLRMEQVHHLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+TALIH GPVEF+YYW HRALHHH LYSRYHSHHHSSIVT+PI++ IHPFAE
Sbjct  117  LWRTDGLIITALIHIGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTQPISAFIHPFAE  176

Query  556  HIAYFVLFAIPLLTTVFT  609
              +Y+ +FA+P++ T FT
Sbjct  177  VASYYAIFAVPVIATEFT  194



>gb|AHD24918.1| CER1 [Brassica napus]
Length=628

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LG+FKY+V+AP+  HSTYK++TD P   D    L+ PFLL R+LH
Sbjct  1    MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYKFVTDDP--VDLGYSLVLPFLLFRILH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T KG  RI+DKGI+F QVDRE NWDDQI+ NGLLFY G   LP    +P
Sbjct  59   NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ A++H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  119  WWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  179  HIAYFILFAIP  189



>gb|EMT33049.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +     + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYSLILPSLALRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+ IEFEQVDRER WDDQI+ NGLLFY GY  +P     P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRDIEFEQVDRERGWDDQIVFNGLLFYVGYLAMPSVRRFP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI YF LFAIP+L+TV+
Sbjct  181  HIVYFTLFAIPMLSTVY  197



>ref|XP_004976194.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW W+GSFKY+VLAP V H+ ++  T    + DP  + + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGSFKYLVLAPAVLHTAHRVATKGWGDLDPAYITMLPALLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  N IVD+ IEFEQVDRER+WDDQII NGL FY  Y  +P    +P
Sbjct  61   NQIWISLSRYQTARRKNVIVDRSIEFEQVDRERSWDDQIIFNGLEFYLAYAMIPNVRLLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG I+T L+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTDGAIITVLLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LF+IP LT +F
Sbjct  181  HVVYFMLFSIPTLTPIF  197



>gb|ACA14353.1| TCER1 [Triticum aestivum]
Length=619

 Score =   235 bits (599),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +     + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYSLILPSLALRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI LSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGLLFY GY  +P     P
Sbjct  61   NQIWIGLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAMPSVRRFP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI YF LFAIP+L+TV+
Sbjct  181  HIVYFTLFAIPMLSTVY  197



>gb|KDO85382.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=627

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_010539481.1| PREDICTED: protein CER1-like 2 [Tarenaya hassleriana]
Length=707

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
            +MASRPGILT+WPW  LGSFKY+V+AP++  S Y Y T S  ERD   LLI   +  RM+
Sbjct  86   EMASRPGILTDWPWKALGSFKYLVVAPWIVESIYSYGTKSEEERDLGNLLIAALMAWRMV  145

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H+Q+WISLSR+RTAKG  RIVDK IEF+QVDRER WDDQII N LL Y G   LP +   
Sbjct  146  HSQIWISLSRHRTAKGSRRIVDKPIEFDQVDRERTWDDQIIFNALLMYLGNKFLPGSSRA  205

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDG +L AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFA
Sbjct  206  PLWRTDGAVLMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFA  265

Query  553  EHIAYFVLFAIPLLTT  600
            EHIAY +LFAIP++T+
Sbjct  266  EHIAYSLLFAIPVVTS  281



>gb|KGN56666.1| hypothetical protein Csa_3G127770 [Cucumis sativus]
Length=608

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGI T+WPW  LGSFKY+VLAP V HS Y Y+     ERD + LLIFPFLL RM+H
Sbjct  1    MASTPGIFTDWPWKPLGSFKYLVLAPGVIHSFYHYIAKDWTERDISYLLIFPFLLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SR+RTAKG  RIVDKG+EFEQVDRERNWDDQI+LNG+LFY     +    ++P
Sbjct  61   SQIWISFSRHRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYITSNCIEKASNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++  L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
              AYFVLFAIP++T VF+
Sbjct  181  EFAYFVLFAIPIMTAVFS  198



>ref|XP_006464361.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|KDO85380.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_006464362.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
 gb|KDO85381.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=638

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_006445499.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58739.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=639

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  372
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
              WR+DG+ILT L+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTV  603
            EHI YF+LFAIPL+TT+
Sbjct  181  EHIVYFLLFAIPLVTTM  197



>ref|XP_007041192.1| CER1 protein [Theobroma cacao]
 gb|EOX97023.1| CER1 protein [Theobroma cacao]
Length=595

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 166/223 (74%), Gaps = 27/223 (12%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT WPW  LG+FKYV+LAP+V HS Y + T + NER     LIFPFLL R+LH
Sbjct  1    MATKPGILTNWPWESLGNFKYVILAPWVVHSAYSWATKAGNERGLANFLIFPFLLTRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNW-------------------------  300
            NQ+WIS SRYRTAKG+NRI+DKGI+FEQVDRE NW                         
Sbjct  61   NQIWISYSRYRTAKGNNRIIDKGIDFEQVDRESNWSISILHCCLIASDLDTNMLKMMDMF  120

Query  301  --DDQIILNGLLFYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhi  474
              DDQIIL+G++ Y G   LP   H PIWR+DG+I+T L+HTGPVEFLYYWLHRALHHH 
Sbjct  121  GRDDQIILSGIILYLGNMILPEASHFPIWRSDGVIITILLHTGPVEFLYYWLHRALHHHY  180

Query  475  lysryhshhhssiVTEPITSVIHPFAEHIAYFVLFAIPLLTTV  603
            LYSRYHSHHHSSIVTEPITSVIHPFAE I+YF+LF IP+LTTV
Sbjct  181  LYSRYHSHHHSSIVTEPITSVIHPFAEIISYFLLFMIPMLTTV  223



>ref|XP_008232283.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=624

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LGSFK+V+LAP+V HST+ ++ +   ERD +  LI   +L R+LH
Sbjct  1    MASVPGILTDWPWTALGSFKHVILAPWVIHSTWLFVANDGKERDISYFLILALVLWRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+DKG+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYRTAKGNGRILDKGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR +G++LT ++H GPVEFLYYW HRALHHH LYSRY SHHHSSIVT+PITSVIHPFAE
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYQSHHHSSIVTQPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLL  594
            HI Y  LF+IP+L
Sbjct  181  HIVYSALFSIPIL  193



>ref|XP_007220536.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
 gb|EMJ21735.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
Length=629

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LGSFK+V+LAP+V HST+  + +   ERD +  LI   +L R+LH
Sbjct  1    MASVPGILTDWPWTALGSFKHVILAPWVIHSTWLLVANDGKERDISYFLILAVVLWRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+DKG+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYRTAKGNGRILDKGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR +G++LT ++H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVT+PITSVIHPFAE
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI Y  LF IP+L T+ T
Sbjct  181  HIVYSTLFFIPILGTMLT  198



>ref|XP_008245903.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Prunus mume]
Length=624

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILTEWPW  LGS KYV+LAP+V HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKRLGSLKYVILAPWVIHSTWLFVANDAKERDVSYFLMLGVVLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYQTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR +G++LT ++H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVT+PITSVIHPFAE
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI Y  LF+IP+L TV T
Sbjct  181  HIVYSALFSIPILGTVVT  198



>ref|XP_003625022.1| Protein WAX2 [Medicago truncatula]
 gb|ABD28316.1| Sterol desaturase [Medicago truncatula]
 gb|AES81240.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFK+V+L P++ HS Y ++     ERDP   LI PF+L+RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILIPWIGHSIYSFIWV---ERDPIQYLICPFILVRMLH  57

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SRY TA+G ++IVDK +EFEQVDRE NWDDQI+   LL+Y GY   P+  ++P
Sbjct  58   NQIWISISRYETARGKSKIVDKSLEFEQVDRETNWDDQILFTALLYYIGYMIFPMASNLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+ILTA++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEP+TSV HPFAE
Sbjct  118  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPVTSVAHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            H++YF LFAIP+LTT+F
Sbjct  178  HLSYFTLFAIPMLTTLF  194



>ref|XP_002448160.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
 gb|EES12488.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
Length=619

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW W+G+FKY+VL P V H+ ++  T    + DP    + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGNFKYLVLVPAVLHTAHRVATKGWGDLDPAYATMLPALLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  N IVD+ IEFEQVDRER+WDDQII NGL FY  Y  +P    +P
Sbjct  61   NQIWISLSRYQTARRKNVIVDRSIEFEQVDRERSWDDQIIFNGLEFYLAYAMIPNVRLLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG I+T L+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  IWRTDGAIVTVLLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LF+IP LT +F
Sbjct  181  HVVYFMLFSIPTLTPIF  197



>ref|XP_006354620.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=623

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILT  PW  LG+ KY+VLAPF  HS Y + ++   +ERD   +L+ P  L RM+
Sbjct  1    MANKPGILTNCPWACLGNLKYLVLAPFACHSIYTFFMSKDESERDMFYILLLPLTLFRMV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H Q+WISLSRYRTAKG+NRI+D+ IEF+QVDRE NWDD+IIL GL +Y GY  L   HHM
Sbjct  61   HYQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDEIILFGLAYYIGYLILEQAHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+ AL+H GPVE LYYWLHRALHHH LYSRYHSHHHSSIVTEPIT+V+HPFA
Sbjct  121  PMWRTDGIIIIALLHIGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY+ LF IP+ TT+FT
Sbjct  181  EILAYYTLFGIPVFTTLFT  199



>ref|XP_006354619.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpflliRML  192
            MA++PGILT  PW  LG+ KY+VLAPF  HS Y + ++   +ERD   +L+ P  L RM+
Sbjct  1    MANKPGILTNCPWACLGNLKYLVLAPFACHSIYTFFMSKDESERDMFYILLLPLTLFRMV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H Q+WISLSRYRTAKG+NRI+D+ IEF+QVDRE NWDD+IIL GL +Y GY  L   HHM
Sbjct  61   HYQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDEIILFGLAYYIGYLILEQAHHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WRTDGII+ AL+H GPVE LYYWLHRALHHH LYSRYHSHHHSSIVTEPIT+V+HPFA
Sbjct  121  PMWRTDGIIIIALLHIGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFA  180

Query  553  EHIAYFVLFAIPLLTTVFT  609
            E +AY+ LF IP+ TT+FT
Sbjct  181  EILAYYTLFGIPVFTTLFT  199



>ref|XP_011085187.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=597

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PG LT+WPW  LGSFKY++LAP+   S Y+  T+   ERD   LLI PFLL R LH
Sbjct  1    MATKPGFLTDWPWKHLGSFKYIILAPWGMQSIYRAATEGEKERDYTNLLIIPFLLWRALH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SRYRTAKG+NRIV + IEFEQVDRE NWDDQI+LNG+L Y+    L     +P
Sbjct  61   NQIWISISRYRTAKGNNRIVHRSIEFEQVDRESNWDDQILLNGILLYFFNTILGKPAFLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+T L+H GPVE++YYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  VWRTDGVIITILLHVGPVEYIYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YFVLFAIPLL TV  
Sbjct  181  HISYFVLFAIPLLGTVLN  198



>ref|XP_008232262.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILTEWPW  LGS KYV+LAP++ HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKPLGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLMLGVVLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR +G++LT ++H GPVEFLYYW HRALHHH LYSRY SHHHSSIVT+PITSVIHPFAE
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYQSHHHSSIVTQPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ Y  LF IP+L T+ T
Sbjct  181  HMVYSALFFIPILATILT  198



>ref|XP_010255640.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=627

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG LT WPW  LG+FKYVVLAP+V HS Y+++T   NERD   LL FPFLL RMLH
Sbjct  1    MASKPGPLTNWPWQKLGNFKYVVLAPWVVHSIYQFVTKDENERDVGYLLTFPFLLSRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +QLWISL+RY+TAK  +RIV KGIEFEQVDRERNWDDQIILNG++ Y      P    +P
Sbjct  61   SQLWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGIVNYIIPQIFPGASRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DGI L  L H GPVEFLYYWLHR LHHH LYSRYHSHHH+S+VTEPITSV+HPFAE
Sbjct  121  MWRWDGIFLVILFHAGPVEFLYYWLHRVLHHHFLYSRYHSHHHASVVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ YF LF+IP++ TVFT
Sbjct  181  HLLYFSLFSIPIMATVFT  198



>emb|CDY38059.1| BnaCnng09200D [Brassica napus]
Length=829

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT+WPWT LG+FKY+V+AP+  HSTYK++TD P   D    L+ PFLL R+LH
Sbjct  202  MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYKFVTDDP--VDLGYSLVLPFLLFRILH  259

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY T KG  RI+DKGI+F QVDRE NWDDQI+ NGLLFY G   LP    +P
Sbjct  260  NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  319

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+++ A++H GPVEFLYYWLH+ALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  320  WWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  379

Query  556  HIAYFVLFAIP  588
            HIAYF+LFAIP
Sbjct  380  HIAYFILFAIP  390



>ref|XP_010920377.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=519

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILTEWPW  LG+FKYV++AP+V H  +   T    E D   L IF  LL+R+LH
Sbjct  1    MASRPGILTEWPWQGLGNFKYVIMAPWVVHGLHMVATKGWRETDLTFLSIFASLLLRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+R++ A+ ++RIVDK IEFEQVDRERNWDDQI+ NG L + G+  +P   ++P
Sbjct  61   NQVWISLARFQNARSNHRIVDKSIEFEQVDRERNWDDQILFNGWLLHLGHTFIPGARNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++ AL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVIAALLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+AY +LF+IP+L T FT
Sbjct  181  HVAYSLLFSIPMLATAFT  198



>gb|EEE57393.1| hypothetical protein OsJ_07566 [Oryza sativa Japonica Group]
Length=619

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG   EW    LG+FKYVV+AP VAH   + + +   + D    LI P LL+RM+H
Sbjct  1    MATRPGPFYEWALDRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGL+FY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LFAIP+L+T++
Sbjct  181  HVVYFILFAIPILSTIY  197



>ref|XP_010255639.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nelumbo nucifera]
Length=654

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG LT WPW  LGSFKYVVLAP+VAHS Y ++T  P +RD   LLI P+LL R++H
Sbjct  94   MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTNLLILPYLLWRLVH  153

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q WI+L+R++TAK  +RI+DKGIEFEQVDRERNWDD I+LNG+LFY     L  + ++P
Sbjct  154  HQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGILFYMANLILNESKNLP  213

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++L+ L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPIT+V+HPFAE
Sbjct  214  MWRTDGVVLSFLLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFAE  273

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF LF+IP++ T+F 
Sbjct  274  HIAYFALFSIPMVVTLFN  291



>ref|XP_007041196.1| CER1 protein [Theobroma cacao]
 gb|EOX97027.1| CER1 protein [Theobroma cacao]
Length=627

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 164/222 (74%), Gaps = 27/222 (12%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA++PGILT WPW  LG+FKYV+LAP+V HS Y + T + NER     LIFPFLL R+LH
Sbjct  1    MATKPGILTNWPWESLGNFKYVILAPWVVHSAYSWATKAGNERGLFNFLIFPFLLTRILH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNW-------------------------  300
            NQ+WIS SRYRTAKG NRIVDKGI+FEQVDRE NW                         
Sbjct  61   NQIWISYSRYRTAKGSNRIVDKGIDFEQVDRESNWSISILHCCLIAYDLGTNMRKLMDMF  120

Query  301  --DDQIILNGLLFYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhi  474
              DDQIILNG++ Y     LP   H+PIWR+DG+I+T L+HTGPVEFLYYWLHRALHHH 
Sbjct  121  GRDDQIILNGIILYLTIMILPGASHLPIWRSDGVIITILLHTGPVEFLYYWLHRALHHHY  180

Query  475  lysryhshhhssiVTEPITSVIHPFAEHIAYFVLFAIPLLTT  600
            LYSRYHSHHHSSIVTEPITSVIHPFAE I+YFVLF IP+LTT
Sbjct  181  LYSRYHSHHHSSIVTEPITSVIHPFAEMISYFVLFMIPILTT  222



>ref|XP_004953128.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=620

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSP-NERDPNillifpflliRML  192
            MA+RPG LTEWPW  LG+FKYVV+AP V H + +        E D    LI P LL+RM+
Sbjct  1    MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGSRRVAGAGGWGELDLAFALILPSLLLRMV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WIS +RY+TA+  +RIVD+GI+F+QVDRER WDDQIILNGLLFY  Y  +P   HM
Sbjct  61   HNQIWISAARYQTARSKHRIVDRGIDFDQVDRERGWDDQIILNGLLFYVAYLLIPSARHM  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WRTDG +  AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PAWRTDGAVAMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVF  606
            EHI Y++LFAIP+LTT++
Sbjct  181  EHIVYYILFAIPMLTTIY  198



>ref|XP_010054526.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=542

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
            + AS+PGILT+WPW  LGSFKYV+LAP+V H TY+++   P E D +  LI PFLL RML
Sbjct  65   ETASKPGILTDWPWKPLGSFKYVILAPWVVHGTYQFIAKGPGEWDFSYFLILPFLLERML  124

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WISLSR+ TAKG+N I+D+GIEFEQVDRE NWDDQI+L  ++ Y  ++ +P   H+
Sbjct  125  HNQIWISLSRHGTAKGNNGILDRGIEFEQVDRESNWDDQILLTAIILYMFHWAIPQASHL  184

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+W+TDG+I+T L+H   VE LYYWLHRALHHH LYSRYHS HHSSIVTEPI+S++HPFA
Sbjct  185  PLWKTDGVIITFLVHALVVESLYYWLHRALHHHFLYSRYHSQHHSSIVTEPISSIVHPFA  244

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAY +LFAIP+ TTV T
Sbjct  245  EHIAYAMLFAIPMFTTVIT  263



>ref|XP_003625024.1| Protein WAX2 [Medicago truncatula]
 gb|ABN07985.1| Sterol desaturase [Medicago truncatula]
 gb|AES81242.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT WPW  LGSFK+V++ P++AHS Y ++     ERDP   +IFPF L+RMLH
Sbjct  1    MASKPGILTNWPWEPLGSFKFVIVIPWIAHSIYTFIW---GERDPVYYIIFPFALVRMLH  57

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+W S+SRY+TAKG NRIVDKG+EFEQVDRE +WDDQ++   L++   Y+  P+  ++P
Sbjct  58   NQIWTSVSRYQTAKGKNRIVDKGLEFEQVDRETHWDDQMLFTVLVYCIAYFIFPMASNLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG+ILTA++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  118  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVAHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            H++YF LFAIP+LTT+F
Sbjct  178  HLSYFTLFAIPMLTTLF  194



>ref|XP_007220541.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
 gb|EMJ21740.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
Length=623

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILTEWPW  LGS KYV+LAP++ HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKALGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLLLGVVLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP    +P
Sbjct  61   NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGAQKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR  G++LT ++H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVT+PITSVIHPFAE
Sbjct  121  LWRAHGVLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ Y  LF IP+L T+ T
Sbjct  181  HVVYSALFFIPILGTMLT  198



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG LT WPW  LGSFKYVVLAP+VAHS Y ++T  P +RD   LLI P+LL R++H
Sbjct  94   MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTNLLILPYLLWRLVH  153

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q WI+L+R++TAK  +RI+DKGIEFEQVDRERNWDD I+LNG+LFY     L  + ++P
Sbjct  154  HQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGILFYMANLILNESKNLP  213

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++L+ L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPIT+V+HPFAE
Sbjct  214  MWRTDGVVLSFLLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFAE  273

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYF LF+IP++ T+F 
Sbjct  274  HIAYFALFSIPMVVTLFN  291



>ref|XP_007218858.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
 gb|EMJ20057.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
Length=635

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILTEWPW  LGS KYV+LAP++ HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKALGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLLLGVVLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRYRTAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP    +P
Sbjct  61   NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGAQKLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR  G++LT ++H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVT+PITSVIHPFAE
Sbjct  121  LWRAHGVLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+ Y  LF IP+L T+ T
Sbjct  181  HVVYSALFFIPILGTMLT  198



>ref|XP_004145021.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 ref|XP_004153200.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN46281.1| hypothetical protein Csa_6G079750 [Cucumis sativus]
Length=618

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFK+V+L P+V HS+Y Y      +RD + +LIFPFL++RM+H
Sbjct  1    MASKPGILTDWPWKPLGSFKFVILTPWVIHSSYLYFKGG-EKRDLSYILIFPFLVLRMIH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TAKG  RIVDK IEFEQVDRE +WDDQI+ NGLLF  G   +    ++P
Sbjct  60   NQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGENLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRT+G+++ AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSI TEPITSVIHPFAE
Sbjct  120  LWRTNGVVIAALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF IPLL TV T
Sbjct  180  HIVYFLLFTIPLLVTVLT  197



>ref|XP_010276559.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=624

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 161/202 (80%), Gaps = 8/202 (4%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PG LT WPW  LG+FKY+VLAP+V HSTY ++T    ERD    L FPFLL RMLH
Sbjct  1    MASTPGPLTNWPWKKLGNFKYLVLAPWVIHSTYSFMTKDETERDVGNFLTFPFLLFRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPI----T  363
            +Q+WISL+RY+TAK  +RIV KGIEFEQVDRERNWDDQIILNGLL    YY +PI     
Sbjct  61   SQIWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGLL----YYIVPIFYSKA  116

Query  364  HHMPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIH  543
              +P+WR DG+IL  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIH
Sbjct  117  ARLPVWRWDGVILIMLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIH  176

Query  544  PFAEHIAYFVLFAIPLLTTVFT  609
            PFAEH+ YF LF+IPL+ T+ T
Sbjct  177  PFAEHLLYFSLFSIPLVATMIT  198



>ref|XP_010041339.1| PREDICTED: protein ECERIFERUM 1-like, partial [Eucalyptus grandis]
Length=355

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 16/198 (8%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP++AH TY++                PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPWMAHGTYQF----------------PFLLERMLH  44

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L  +L Y  ++ +P   H+P
Sbjct  45   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTAILLYMTHWTIPQASHLP  104

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             W+TDG+I+T LIH   VE++YYWLHRALHHH LYSRYHSHHHSSIVTEPI+S++HPF E
Sbjct  105  FWKTDGVIITVLIHALVVEYIYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSIVHPFVE  164

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAY +LFAIP+ TTV T
Sbjct  165  HIAYAMLFAIPMYTTVLT  182



>ref|XP_004252845.1| PREDICTED: protein ECERIFERUM 1 [Solanum lycopersicum]
Length=620

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGIL+EWPW  LG+FKY+VLAPFV HS Y +L D     D   + I PFLL R +H
Sbjct  1    MASKPGILSEWPWANLGNFKYLVLAPFVGHSIYSFLRDG----DIGYIAILPFLLFRFIH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR+RTAKG+NRIVD+ IEF+QVDRE NWDDQII NGLL+Y GY ++   HH+P
Sbjct  57   NQIWISLSRHRTAKGNNRIVDRSIEFDQVDRENNWDDQIIFNGLLYYVGYLRMEQVHHLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR+ G I+TAL H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVT+PI++ IHPFAE
Sbjct  117  LWRSGGFIVTALAHIGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTQPISAFIHPFAE  176

Query  556  HIAYFVLFAIPLLTTVFT  609
              +Y+ +FA+P++ T  T
Sbjct  177  VASYYAIFAVPVIATELT  194



>ref|XP_009376850.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=620

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKY+++AP+V HST  ++ +   ERD    LIFP +L RM+H
Sbjct  1    MASMPGILTDWPWKPLGSFKYLIMAPWVIHSTLLFMVNGGKERDITYFLIFPLMLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRYRTAKG+ RI+DKG+EF+QVDRERNWDDQI+ NG L Y          ++P
Sbjct  61   NQIWITLSRYRTAKGNGRILDKGLEFDQVDRERNWDDQILFNGALMYLSNRLFSGAQNVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++ T L+H GPVE+LYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVSTILLHAGPVEYLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI Y +LF++P+L TVF
Sbjct  181  HIVYSLLFSMPMLATVF  197



>ref|XP_002526511.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35902.1| sterol desaturase, putative [Ricinus communis]
Length=617

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LG FKYV+LAP+V HS Y ++     ERD   +LIFP +L+R+LH
Sbjct  1    MASRPGILTDWPWKSLGDFKYVILAPWVVHSIYSFVVKEEKERDLTSVLIFPSILLRLLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SRY+TAKG  R+VDK IEF+QVDRER+WDDQ++L G++ Y     +    +MP
Sbjct  61   NQIWISVSRYQTAKGKKRVVDKCIEFDQVDRERDWDDQVLLYGIITYSINMGVAGASNMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWRTDG++LT ++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVT+PI+SVIHPFAE
Sbjct  121  IWRTDGVVLTMILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPISSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY++LF IP+L ++F+
Sbjct  181  ILAYYLLFLIPILASIFS  198



>ref|XP_002454185.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
 gb|EES07161.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
Length=619

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  LG+FKY+V+ P V     + +     + D    LI P LL+RM H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMGPVVVDGARRVVARGWGDIDLAFALILPSLLLRMAH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS +RY+TA+  +RIVD+GIEFEQVDRER WDDQIILNGLLFY GY  +P   H+P
Sbjct  61   NQIWISAARYQTARSKHRIVDRGIEFEQVDRERGWDDQIILNGLLFYAGYLAIPSARHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG  + AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  AWRTDGAAVMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ Y+VLFAIP+L+TV+
Sbjct  181  HMVYYVLFAIPMLSTVY  197



>gb|KCW44429.1| hypothetical protein EUGRSUZ_L02074 [Eucalyptus grandis]
Length=398

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 16/198 (8%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LGSFKYV+LAP++AH TY++                PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPWMAHGTYQF----------------PFLLERMLH  44

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L  +L Y  ++ +P   H+P
Sbjct  45   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTAILLYMTHWTIPQASHLP  104

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             W+TDG+I+T LIH   VE++YYWLHRALHHH LYSRYHSHHHSSIVTEPI+S++HPF E
Sbjct  105  FWKTDGVIITVLIHALVVEYIYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSIVHPFVE  164

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAY +LFAIP+ TTV T
Sbjct  165  HIAYAMLFAIPMYTTVLT  182



>gb|AES88391.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+ GILT WPW  LGS K+V+L+P++AHS Y ++     ERDP   LIFP++L+RMLH
Sbjct  1    MASKAGILTNWPWKPLGSLKFVILSPWIAHSIYSFIWV---ERDPTYYLIFPYILVRMLH  57

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS+SRY+TAKG  RIVDKG+EF+QVDRE NWDDQI+   L+FY  Y   P+  ++P
Sbjct  58   NQIWISISRYQTAKGKRRIVDKGLEFDQVDRETNWDDQILFTALMFYILYTIFPMAANLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+ILTA++H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPIT+V HPFAE
Sbjct  118  WWRTDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITAVTHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
             +AYF LF IP+LTT+F
Sbjct  178  MLAYFTLFLIPMLTTLF  194



>ref|XP_008344085.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=620

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPW  LGSFKY+++AP+V HST  ++ +   +RD   +LIFP +L RM+H
Sbjct  1    MASMPGILTDWPWKPLGSFKYLIMAPWVIHSTMLFMMNDGKDRDIAYILIFPLMLWRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI+LSRYRTAKG+ RI+DKG+EF+QVDRERNWDDQI+ NG L Y          ++P
Sbjct  61   NQIWITLSRYRTAKGNGRILDKGLEFDQVDRERNWDDQILFNGTLMYLSNRLFSGAQNVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++ T L+H GPVE+LYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGVVATILLHAGPVEYLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            HI Y +LF+IP+L TVF
Sbjct  181  HIVYSLLFSIPMLATVF  197



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG LT WPW  LG+FKY+VLAP+VAHS Y +++  P + D   LLIFP+LL RMLH
Sbjct  1    MATTPGPLTNWPWQKLGNFKYLVLAPWVAHSIYSFVSKGPKDGDWTNLLIFPYLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q WI+L+RY+TAK  +RI+D+GIEFEQVDRERNWDD I+LNG+LFY          ++P
Sbjct  61   HQAWITLARYQTAKSKHRILDRGIEFEQVDRERNWDDLILLNGILFYMTNLMYDEAKNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG++L+ L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPIT+V+HPFAE
Sbjct  121  LWRTDGVVLSFLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HIAYFVLF+IP+L T+F 
Sbjct  181  HIAYFVLFSIPMLVTMFN  198



>gb|EMS48098.1| Protein WAX2 [Triticum urartu]
Length=654

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW W+GSFKY+VLAP   H+ ++ +T    +       + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGSFKYLVLAPAALHTAHRVVTKGWGDMSLAYAAMLPALLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR++TA+  + IVD+G+EF+QVDRE +WDDQII NGL FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRGLEFDQVDRESSWDDQIIFNGLFFYLAYAAVPNVSRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG I+TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTDGAIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ YF+LF+IP++T +F
Sbjct  181  HVVYFLLFSIPMMTPIF  197



>gb|ACR38546.1| unknown [Zea mays]
 gb|AFW72382.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=623

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW  LG+FKY+V+AP   H   + +     + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVVARGWGDIDLAFALILPSLLLRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS +RY+TA+  +RIVD+GIEF+QVDRER WDDQIILNGLLFY GY  +P    MP
Sbjct  61   NQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIPSARRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR+DG +  AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  AWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+ Y+VLFAIP+L+T++
Sbjct  181  HMVYYVLFAIPMLSTLY  197



>gb|AAC24373.1| CER1-like protein [Arabidopsis thaliana]
Length=604

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR RTAKG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++T 
Sbjct  181  HIAYTLLFAIPMVTA  195



>ref|NP_973742.1| protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27398.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=623

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR RTAKG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++T 
Sbjct  181  HIAYTLLFAIPMVTA  195



>ref|XP_010496697.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG LTEWPW+ LGSFKY+++APFV  S + Y+T +  E+D + L+I   +L R++H
Sbjct  1    MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEEKDFSRLMIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG +L AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  LWRLDGALLMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++T 
Sbjct  181  HIAYSLLFAIPMVTA  195



>ref|XP_006306997.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
 gb|EOA39895.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
Length=629

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LG+FKY+++APFV  S + Y+T +  E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGNFKYLLVAPFVMASMHTYVTVADEEKDLSRLMIVALMLWRIIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG +L AL+H GPVEFLYYW HRALHH+ LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  LWRLDGALLMALLHAGPVEFLYYWFHRALHHYFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++T 
Sbjct  181  HIAYSLLFAIPMVTA  195



>ref|NP_171721.3| protein CER1-like 1 [Arabidopsis thaliana]
 sp|F4HVX7.1|CERL1_ARATH RecName: Full=Protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27399.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=627

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR RTAKG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++T 
Sbjct  181  HIAYTLLFAIPMVTA  195



>ref|XP_011005107.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILT+WPW  LGSFK V+LAP+V HSTY ++    +E+D +  L+F  LL RM+H
Sbjct  1    MASRPGILTDWPWKPLGSFKRVILAPWVIHSTYSFMVK--DEKDLSTFLMFLILLWRMIH  58

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
             QLWISLSRYRTAKG+NRI+DKGIEF+QVDRE NWDDQI+ NG+L Y G   +P   ++P
Sbjct  59   TQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILLYVGRKIIPGASYLP  118

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG+ILTALIH GPVEFLYYWLHR LHHH LYSRYHSHHHSSIVT  ITS IHPFAE
Sbjct  119  IWRLDGVILTALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTGAITSAIHPFAE  178

Query  556  HIAYFVLFAIPLLTTV  603
            HI+Y +LF IPL+TT 
Sbjct  179  HISYSMLFMIPLITTA  194



>ref|XP_010255641.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LT WPW  LG+FKYV+LAP+  HST++++T    ERD    L+FPFLL RMLH
Sbjct  1    MASRPGPLTNWPWKKLGNFKYVILAPWAVHSTHQFVTKDEKERDLGYSLVFPFLLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
             Q+WISL+R RTA+  +RIV KGIEFEQVDRERNWDDQII NG+L+Y     LP    +P
Sbjct  61   AQIWISLARNRTAESKHRIVHKGIEFEQVDRERNWDDQIIFNGILYYLAINLLPGASRIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            ++R DGI+LT+L+H G VEFLYYWLHRALHHHILYSRYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  MFRWDGILLTSLLHAGLVEFLYYWLHRALHHHILYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI+YF+LFAIP++  + T
Sbjct  181  HISYFLLFAIPMVVMLVT  198



>gb|KHG03871.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=599

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 143/198 (72%), Gaps = 16/198 (8%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPWT LGSFKY++L P+V  + +  +   P E D     + PF+L RMLH
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVMETIHSIMVKDPQEWDLTNFTVIPFMLWRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQLWIS SRYRTAKG NRIVDKGIEF+QVDRE+NWDDQI+ NG+LF+     +P   H+P
Sbjct  61   NQLWISFSRYRTAKGTNRIVDKGIEFDQVDREKNWDDQILFNGILFFLANKYVPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+I+T L+H GPVEFLYYW HRALHHH LY                + VIHPFAE
Sbjct  121  LWRTDGVIITMLLHVGPVEFLYYWFHRALHHHYLY----------------SPVIHPFAE  164

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF LFAIP+LT V T
Sbjct  165  HIVYFALFAIPMLTVVLT  182



>ref|XP_008460068.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
 gb|ADN34102.1| sterol desaturase [Cucumis melo subsp. melo]
Length=618

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILT+WPW  LG +K+V+L P+V HST  Y  +   + D + +LIFPFLL+RM+H
Sbjct  1    MASKPGILTDWPWKPLGKYKFVILTPWVIHSTSLYFREE-EKGDLSYILIFPFLLLRMIH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TAKG  RIVDK IEFEQVDRE +WDDQI+ NGLLF  G   +    ++P
Sbjct  60   NQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGEYLP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG+++ AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSI TEPITSVIHPFAE
Sbjct  120  LWRTDGVVMAALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF+LF IPLL TV T
Sbjct  180  HIVYFLLFTIPLLVTVLT  197



>dbj|BAK01778.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW W+GSFKY+VLAP   H+ ++ +T    + +     + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGSFKYLVLAPAALHTAHRLVTKGWGDMNLAYATMLPALLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR++TA+  + IVD+ +EF+QVDRE +WDDQII NGL FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRSLEFDQVDRESSWDDQIIFNGLFFYLAYVAVPNVSQMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRT+G+I+TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTEGVIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
             + YF+LF+IP +T  F
Sbjct  181  QVVYFLLFSIPTMTPTF  197



>ref|XP_006306552.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
 gb|EOA39450.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
Length=626

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LG FKY+++APF   S + Y+T    E+D   +LI   +L RM+H
Sbjct  1    MASRPGFLTEWPWSPLGGFKYLLVAPFALASMHSYITAEEEEKDLGRMLIVALMLWRMVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
             Q+WIS+SR +TAKG N+IVDK IEFEQVDRER+WDDQII N LL Y    KLP +  +P
Sbjct  61   CQIWISVSRQKTAKGRNKIVDKPIEFEQVDRERSWDDQIIFNTLLMYLLNNKLPGSSRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  LWRLDGAILIALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LF+IP++T 
Sbjct  181  HIAYTLLFSIPIVTA  195



>ref|XP_006418508.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
 gb|ESQ36861.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
Length=631

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D   L I   +L R++H
Sbjct  1    MASRPGALTEWPWSSLGSFKYLLVAPLVMASMHSYVTAEDEEKDLGRLAIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS++R RTA G  +IVDK IEFEQVDRER WDDQII N LL Y   +KLP +  +P
Sbjct  61   SQIWISVARQRTAMGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANFKLPGSCRLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  LWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LF+IP++T 
Sbjct  181  HIAYTLLFSIPMVTA  195



>gb|KJB67449.1| hypothetical protein B456_010G191200 [Gossypium raimondii]
Length=617

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 156/215 (73%), Gaps = 17/215 (8%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFK-----------------YVVLAPFVAHSTYKYLTDSPNER  144
            MAS+PGILT+WPW  LGSFK                 Y++LAP++  S Y  +     + 
Sbjct  1    MASKPGILTDWPWKPLGSFKGFSHALIHCVVGWIYLRYIILAPWITESIYTAIVKDAKQW  60

Query  145  DPNillifpflliRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNG  324
            D   L I P +L RMLH+QLWIS SRYRTAKG NRIVDKGIEF+QVDRERNWDDQI+ N 
Sbjct  61   DVLNLAILPLMLWRMLHSQLWISFSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNA  120

Query  325  LLFYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhh  504
            +L Y     LP   H P+WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHH
Sbjct  121  ILLYLINKYLPGASHSPVWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHH  180

Query  505  ssiVTEPITSVIHPFAEHIAYFVLFAIPLLTTVFT  609
            SSI TEPITSVIHPFAEHIAY+ LF+IP LTT+ T
Sbjct  181  SSIATEPITSVIHPFAEHIAYYALFSIPGLTTILT  215



>gb|EYU40310.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=608

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 159/200 (80%), Gaps = 2/200 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTD--SPNERDPNillifpflliRM  189
            MA++PG+LT+WPW  LGSFKY++LAP+   S Y    +     ERD   LL+ PF++ R+
Sbjct  1    MATKPGVLTDWPWKHLGSFKYMILAPWAMQSIYSIAKNKNGEKERDYINLLVIPFMVSRI  60

Query  190  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  369
            LHNQ+WIS+SR+RTAKG+NRI+D+ IEFEQVDRE NWDD I+L+G+LFY+    L     
Sbjct  61   LHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSASF  120

Query  370  MPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPF  549
            +PIWR DGII+T L+H GPVE+LYYWLHR LHHH LY+RYHSHHHSSIVTEPITSVIHPF
Sbjct  121  LPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSHHHSSIVTEPITSVIHPF  180

Query  550  AEHIAYFVLFAIPLLTTVFT  609
            AEH++YF LFAIP+  T+ T
Sbjct  181  AEHLSYFALFAIPMFATILT  200



>gb|EYU40309.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=612

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 159/200 (80%), Gaps = 2/200 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTD--SPNERDPNillifpflliRM  189
            MA++PG+LT+WPW  LGSFKY++LAP+   S Y    +     ERD   LL+ PF++ R+
Sbjct  1    MATKPGVLTDWPWKHLGSFKYMILAPWAMQSIYSIAKNKNGEKERDYINLLVIPFMVSRI  60

Query  190  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  369
            LHNQ+WIS+SR+RTAKG+NRI+D+ IEFEQVDRE NWDD I+L+G+LFY+    L     
Sbjct  61   LHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSASF  120

Query  370  MPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPF  549
            +PIWR DGII+T L+H GPVE+LYYWLHR LHHH LY+RYHSHHHSSIVTEPITSVIHPF
Sbjct  121  LPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSHHHSSIVTEPITSVIHPF  180

Query  550  AEHIAYFVLFAIPLLTTVFT  609
            AEH++YF LFAIP+  T+ T
Sbjct  181  AEHLSYFALFAIPMFATILT  200



>ref|XP_010479268.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
 ref|XP_010496715.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=630

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLT-DSPNERDPNillifpflliRML  192
            MAS+PG LTEWPW+ LGSFKY+++APFV  S + Y+T    + +D + L+I   +L R++
Sbjct  1    MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEDHKDFSRLMIVVLMLWRIV  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            H+Q+WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP   H+
Sbjct  61   HSQIWISVSRQRTAKGTTKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P+WR DG +L AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFA
Sbjct  121  PLWRLDGALLMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFA  180

Query  553  EHIAYFVLFAIPLLTT  600
            EHIAY +LFAIP++T 
Sbjct  181  EHIAYSLLFAIPMVTA  196



>ref|XP_011469549.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=618

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LGSFKYVVLAP+V HSTY Y+       D   +LI PF L RMLH
Sbjct  1    MASTPGILTDWPWTPLGSFKYVVLAPWVIHSTYSYMFGEEGT-DLFYILILPFQLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+G + I+DKG+EFEQVDRER+WDDQII NG+LFY G   L  T  + 
Sbjct  60   NQIWISLSRYQTARGKS-IIDKGLEFEQVDRERDWDDQIIFNGMLFYVGRCILLQT-DLQ  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG+++T L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  118  IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            HI+YF+LFAIP++ T+ 
Sbjct  178  HISYFLLFAIPMIGTLL  194



>ref|XP_004308720.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=614

 Score =   221 bits (564),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LGSFKYVVLAP+V HSTY Y+       D   +LI PF L RMLH
Sbjct  1    MASTPGILTDWPWTPLGSFKYVVLAPWVIHSTYSYMFGEEGT-DLFYILILPFQLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+G + I+DKG+EFEQVDRER+WDDQII NG+LFY G   L  T  + 
Sbjct  60   NQIWISLSRYQTARGKS-IIDKGLEFEQVDRERDWDDQIIFNGMLFYVGRCILLQT-DLQ  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG+++T L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  118  IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            HI+YF+LFAIP++ T+ 
Sbjct  178  HISYFLLFAIPMIGTLL  194



>gb|KFK42593.1| hypothetical protein AALP_AA1G015500 [Arabis alpina]
Length=628

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 152/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T   +E+D   LLI   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVIASMHSYVTSEEDEKDLGRLLIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            + +WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP    +P
Sbjct  61   SLIWISVSRQRTAKGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLAIMKLPGAARLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  LWRPDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HI Y +LFAIP++T 
Sbjct  181  HIGYTLLFAIPIVTA  195



>ref|XP_010480306.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LTEWPW+ LG FKY+++ P    S Y Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGGFKYLLVVPLAIGSIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR +TAKG  +IVDK IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRKKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIPL+  
Sbjct  181  HIAYTILFAIPLVAA  195



>ref|XP_011466125.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=596

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG FKYVVLAP+V HSTY Y+    +  D   +L+ PFLL RMLH
Sbjct  1    MASTPGILTDWPWTPLGKFKYVVLAPWVIHSTYSYMFGEEST-DLFYILVLPFLLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TAKG   I+DKG+EFEQVDRER+WDDQII NG+LFY     L  T  +P
Sbjct  60   NQIWISLSRYQTAKG-KAIIDKGLEFEQVDRERDWDDQIIFNGILFYVSRCVLFKT-DLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG+++T L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  118  IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            HI+YF+LFAIP++ T+ 
Sbjct  178  HISYFMLFAIPMIGTLL  194



>ref|XP_010480305.1| PREDICTED: protein CER1-like 1 isoform X1 [Camelina sativa]
Length=629

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LTEWPW+ LG FKY+++ P    S Y Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGGFKYLLVVPLAIGSIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR +TAKG  +IVDK IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRKKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRVP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIPL+  
Sbjct  181  HIAYTILFAIPLVAA  195



>ref|XP_010691968.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=620

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA  PGILT WPW  LG+FKYV++APF  HS Y Y+  S  +RD   L I PF+L RMLH
Sbjct  1    MAFTPGILTHWPWECLGNFKYVIVAPFAIHSIYLYVVGS-EDRDLGYLAIIPFMLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRYRTAKG+N IVDK +EFEQVDRERNWDDQI+LN + FY     +    ++P
Sbjct  60   NQIWISFSRYRTAKGNNLIVDKSLEFEQVDRERNWDDQILLNVIAFYLANRGMETAKNVP  119

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             +R DG+I   L+H GPVEFLYYWLHRALHHH LYSRYHSHHH SIVTEPITSVIHPFAE
Sbjct  120  FFRMDGLIYAFLLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHLSIVTEPITSVIHPFAE  179

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI YF LFAIP L+T   
Sbjct  180  HILYFTLFAIPTLSTTLA  197



>ref|XP_011466122.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466123.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466124.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS PGILT+WPWT LG FKYVVLAP+V HSTY Y+    +  D   +L+ PFLL RMLH
Sbjct  1    MASTPGILTDWPWTPLGKFKYVVLAPWVIHSTYSYMFGEEST-DLFYILVLPFLLWRMLH  59

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TAKG   I+DKG+EFEQVDRER+WDDQII NG+LFY     L  T  +P
Sbjct  60   NQIWISLSRYQTAKG-KAIIDKGLEFEQVDRERDWDDQIIFNGILFYVSRCVLFKT-DLP  117

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG+++T L+H GPVE+LYYWLHRALHHH LYSRYHSHHHSSIVTEPITSV HPFAE
Sbjct  118  IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  556  HIAYFVLFAIPLLTTVF  606
            HI+YF+LFAIP++ T+ 
Sbjct  178  HISYFMLFAIPMIGTLL  194



>gb|KFK36660.1| hypothetical protein AALP_AA4G153400 [Arabis alpina]
Length=625

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPWT LGSFKY+VLAP V  S Y Y T     RD   L I    + R++H
Sbjct  1    MASRPGFLTEWPWTPLGSFKYLVLAPLVMDSIYSYAT----LRDHEKLFIVAVTVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q WIS SRYRTAKG  RIV+K IEF+QVDRER WDDQ+ILN LLFY     +  T+ +P
Sbjct  57   SQAWISFSRYRTAKGTKRIVNKSIEFDQVDRERTWDDQVILNTLLFYLVKVYVTGTNTLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG +LTA++H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRTDGAVLTAILHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI Y ++ A+PL+TT+  
Sbjct  177  HIGYSIILAVPLVTTLIC  194



>ref|XP_003574039.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG L+EWPW  LGSFKY+VLAP+VAH  ++  T    E D   + I P +L+R LH
Sbjct  1    MATNPGFLSEWPWKRLGSFKYLVLAPWVAHGFHQLATKGWRETDLGYIAILPSMLLRALH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ WI++SR + A+G  +IVD+GIEFEQVDRERNWDDQIIL+ +LFY G   LP   H+P
Sbjct  61   NQAWITVSRLQNARGRKQIVDRGIEFEQVDRERNWDDQIILSAILFYLGALHLPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG +L AL+H GPVE LYYW HRALHHH LY+RYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVLVALLHAGPVELLYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IP++ +  T
Sbjct  181  LVAYELLFSIPMIASALT  198



>gb|KJB76286.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=613

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 154/199 (77%), Gaps = 19/199 (10%)
 Frame = +1

Query  13   KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRML  192
             MAS+PGILT+WPW  LGSFK                     + D + L +FPF+L RML
Sbjct  7    SMASKPGILTDWPWKPLGSFK-------------------DEDIDVSKLALFPFVLWRML  47

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQLWISLSRYRTAKG N+IVDKGIEF+QVDRER+WDDQI+ N +LFY G   +P   H+
Sbjct  48   HNQLWISLSRYRTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYLGNIYVPGGSHL  107

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WR DG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  108  PFWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  167

Query  553  EHIAYFVLFAIPLLTTVFT  609
            EHIAYF+LF+IP+LTTV T
Sbjct  168  EHIAYFLLFSIPILTTVLT  186



>gb|EPS71900.1| hypothetical protein M569_02856, partial [Genlisea aurea]
Length=619

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNE-RDPNillifpflliRML  192
            MAS+PGILT+WPW  LG++KYVVLAP   ++T  YL  + +E RD   +L+ P L+ R L
Sbjct  1    MASKPGILTQWPWGCLGNYKYVVLAPMAIYTTSSYLMKNESEKRDMLPVLVLPLLISRFL  60

Query  193  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  372
            HNQ+WIS+SR+RTA+G NRIVD+ IEFEQVDRE NWDDQII NGL  Y          ++
Sbjct  61   HNQIWISISRHRTAQGTNRIVDRSIEFEQVDRESNWDDQIIFNGLYMYLLLIFEKKAQNL  120

Query  373  PIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFA  552
            P WRTDG+I T ++H GPVE+ YYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPFA
Sbjct  121  PFWRTDGMIWTFILHAGPVEYTYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  553  EHIAYFVLFAIPLLTTVF  606
            EHIAY+ +F+IP LTT++
Sbjct  181  EHIAYYAIFSIPFLTTIY  198



>gb|AAD29719.1|AF143746_1 CER1 [Oryza sativa Indica Group]
Length=621

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGRREVDLGYIAILPSLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+RYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IPL+    T
Sbjct  181  LVAYELLFSIPLIACALT  198



>ref|XP_010936012.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Elaeis guineensis]
Length=624

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PG LT+WPW  LG+FKYV+LAP+VAHS +K++  S  +RD    LIFP LL+R+L+
Sbjct  1    MASQPGPLTQWPWQKLGNFKYVLLAPWVAHSMHKFMAASGEKRDMINFLIFPILLLRLLY  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +QLWI+ SRY+TAK  +RIVDK ++F+QVDRERNWDDQIIL  LL Y G   +P   H+P
Sbjct  61   SQLWITFSRYQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALLMYMGNMVVPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             W T G+ +T L+H GPVEF+YYWLHRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  WWETRGVAITILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             ++YFVLFAIPL+T  FT
Sbjct  181  ELSYFVLFAIPLMTMAFT  198



>ref|XP_010493027.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   219 bits (558),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 152/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LTEWPW+ LG FKY+++AP    S + Y+T    E+D   LLI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGGFKYLLVAPLAMASMHSYVTAQEEEKDLASLLIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR +TAKG  +IVDK IEF+QVDRER+WDDQII N L  Y    KLP    MP
Sbjct  61   SQIWISVSRQKTAKGRKKIVDKPIEFDQVDRERSWDDQIIFNTLYMYLLNSKLPGCSRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  LWRLDGAILIALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LF+IPL+T 
Sbjct  181  HIAYTLLFSIPLVTA  195



>ref|XP_010511349.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LTEWPW+  G FKY+++ P    S Y Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPFGGFKYLLVVPLAIASIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR +TAKG  +IVDK IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRQKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG IL AL+H GPVEFLYYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  121  IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++  
Sbjct  181  HIAYTILFAIPIVAA  195



>gb|EEC67150.1| hypothetical protein OsI_33995 [Oryza sativa Indica Group]
Length=621

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGRREVDLGYIAILPSLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+RYHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IPL+    T
Sbjct  181  LVAYELLFSIPLIACALT  198



>ref|NP_001064826.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|AAG21908.1|AC026815_12 putative CER1 [Oryza sativa Japonica Group]
 gb|AAP54228.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26740.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|EEE51118.1| hypothetical protein OsJ_31858 [Oryza sativa Japonica Group]
Length=621

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+ YHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IPL+    T
Sbjct  181  LVAYELLFSIPLIACALT  198



>ref|XP_010247895.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA  PG LT++PW  LG+FKYVVLAP++ HSTY+++T    ERD    L+ P+LL R++H
Sbjct  1    MALSPGPLTKYPWEKLGNFKYVVLAPWIVHSTYQFVTKDEKERDLAYFLMLPYLLSRVIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
             Q+WISL+RY TAK  +RIVDKGIEFEQVDRERNWDD II NG+++Y     LP    MP
Sbjct  61   AQIWISLARYMTAKSKHRIVDKGIEFEQVDRERNWDDNIIFNGIIYYLAITLLPGASRMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            ++R DGI++ AL+H GPVEFLYYW HRALHHHILY+ YHSHHHSSIVTEPITSVIHPFAE
Sbjct  121  MFRWDGILIAALVHVGPVEFLYYWFHRALHHHILYTGYHSHHHSSIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             I YF+LF IP    + T
Sbjct  181  IIVYFILFCIPTSAALAT  198



>emb|CDY55894.1| BnaA04g29150D [Brassica napus]
Length=616

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 150/195 (77%), Gaps = 4/195 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LT+WPWT LGSFKY+VLAP V  S Y Y T     RD   LL+   ++ R++H
Sbjct  1    MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDHEKLLVVALMVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SRYRTAKG  RIVDK IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG++L AL+H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRLDGLVLVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTT  600
            HIAY ++  IPL+TT
Sbjct  177  HIAYSLILVIPLVTT  191



>ref|XP_006661851.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=635

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 159/212 (75%), Gaps = 14/212 (7%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYK------------YLTDSPNE--RDPN  153
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+            YL   P+   RD  
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWRAADLGYLAILPSLLLRDLA  60

Query  154  illifpflliRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLF  333
              LI P LL+RM+HNQ+WISLSRY+TA+  +RIVD+GIEF+QVDRERNWDDQIIL+G L 
Sbjct  61   YSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERNWDDQIILSGFLL  120

Query  334  YWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssi  513
            Y G   LP    +P+WR DG  + AL+H GPVEFLYYWLHRALHHH LY+RYHSHHH+SI
Sbjct  121  YLGALYLPGGQRLPLWRADGAAVIALLHAGPVEFLYYWLHRALHHHWLYTRYHSHHHASI  180

Query  514  VTEPITSVIHPFAEHIAYFVLFAIPLLTTVFT  609
            VTEPITSVIHPFAE +AY VLF++PL+ +  T
Sbjct  181  VTEPITSVIHPFAELVAYEVLFSVPLIASALT  212



>ref|XP_002464501.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
 gb|EER91499.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
Length=619

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ TEWPW  LG+FKY+++AP+VAH  Y   T      D   + IFP LL+RML 
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLVAPWVAHGVYLVATKGWKAADLGYMAIFPSLLLRMLQ  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI++SR + A+G  +IVD+GIEFEQVDRERNWDDQI+L+G+L Y G+  +P   H+P
Sbjct  61   NQVWITVSRLQNARGRRQIVDRGIEFEQVDRERNWDDQILLSGILMYLGFMYIPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG +L AL+H GPVE +YYW HRALHHH LY+RYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IPL   +F 
Sbjct  181  LVAYELLFSIPLFVCIFN  198



>emb|CAE03390.2| OSJNBa0004N05.14 [Oryza sativa Japonica Group]
Length=597

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW W+G +KY+VLAP   H+ ++  T    + DP    + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGGYKYLVLAPVAMHTAHRLATKGWGDFDPAYTFMLPTLLLRMIH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSRY+TA+  + IVD+ ++FEQVDR    DDQIILNGLLFY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARRKHLIVDRSLDFEQVDRVLYLDDQIILNGLLFYLGYAIIPNFRLMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRT+G ++T L+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  VWRTNGALITILLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
            H+AYF+LF+I +L  +F
Sbjct  181  HLAYFLLFSISILPPIF  197



>gb|KDP34470.1| hypothetical protein JCGZ_12753 [Jatropha curcas]
Length=281

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MAS+PGILTEWPW  LGSFKY++L P++A S Y +      ERD    +IFP L++R LH
Sbjct  1    MASKPGILTEWPWRSLGSFKYLILGPWIAQSIYSFTVKEEKERDLFNFIIFPVLILRFLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WIS SRY TAKG  RIVDK IEFEQ++RE NWDDQIIL G+L Y     +      P
Sbjct  61   NQIWISFSRYLTAKGRKRIVDKDIEFEQLERESNWDDQIILQGILSYILNKAITGASKFP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTD +++  L+H GPVEFLYYWLHRALHHH LYSRYHSHHHSSIVT+PITS IHPFAE
Sbjct  121  LWRTDSVVIIILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTQPITSGIHPFAE  180

Query  556  HIAYFVLFAIPL  591
             +AYF+LF IP+
Sbjct  181  VMAYFMLFLIPI  192



>gb|EMT06855.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ +EWPW  LGSFKYVVLAP+VAH   +  T    E D   L+I P +++R LH
Sbjct  1    MATTPGLFSEWPWKRLGSFKYVVLAPWVAHGVQQVATKGWREADLGYLVILPSMMLRGLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ WI++SR + A+G  +IVD+GIEFEQ+DRERNWDDQIIL+ +LF+ G   LP   ++P
Sbjct  61   NQAWITVSRLQNARGKRQIVDRGIEFEQIDRERNWDDQIILSAILFFLGALHLPGAQNLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG +L AL+H GPVE +YYW HRALHHH LY+RYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IP++    T
Sbjct  181  LVAYELLFSIPMIACALT  198



>ref|NP_001118464.1| protein CER1-like 2 [Arabidopsis thaliana]
 gb|AEC09437.1| protein CER1-like 2 [Arabidopsis thaliana]
Length=493

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 149/195 (76%), Gaps = 4/195 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LT+WPWT LGSFKY++LAP V  S Y Y T     RD   LLI    + R++H
Sbjct  1    MASRPGFLTDWPWTPLGSFKYLLLAPLVFDSIYSYATI----RDHEKLLIVAVTVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WISLSRY+TAKG  RI++K IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQIWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQIIFNTLIVYLTKVYVSGTSTIP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+IL AL+H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRTDGVILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTT  600
            HI Y ++  +PL+TT
Sbjct  177  HIGYTLILGLPLITT  191



>emb|CAA65200.1| CER1-like [Arabidopsis thaliana]
Length=623

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR RT KG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG IL  L+H GPVEFLYYW HR LHHH LYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121  PWRVDGGILMVLLHAGPVEFLYYWFHRGLHHHFLYSRYHSHHHSSIVTEPITSVVHPFGE  180

Query  556  HIAYFVLFAIPLLTT  600
            HI Y +L  IP++T 
Sbjct  181  HIVYTLLCDIPMVTA  195



>ref|XP_009141690.1| PREDICTED: protein CER1-like 2 isoform X3 [Brassica rapa]
Length=592

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 149/195 (76%), Gaps = 4/195 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LT+WPWT LGSFKY+VLAP V  S Y Y T     RD   LL+   ++ R++H
Sbjct  1    MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDHEKLLVVALMVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SRYRTAKG  RIVDK IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG++L AL+H GP EF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRLDGLVLVALLHAGPGEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTT  600
            HIAY ++  IPL+TT
Sbjct  177  HIAYSLILVIPLVTT  191



>ref|XP_009141688.1| PREDICTED: protein CER1-like 2 isoform X1 [Brassica rapa]
Length=627

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 149/195 (76%), Gaps = 4/195 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LT+WPWT LGSFKY+VLAP V  S Y Y T     RD   LL+   ++ R++H
Sbjct  1    MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDHEKLLVVALMVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SRYRTAKG  RIVDK IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG++L AL+H GP EF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRLDGLVLVALLHAGPGEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTT  600
            HIAY ++  IPL+TT
Sbjct  177  HIAYSLILVIPLVTT  191



>ref|XP_009141689.1| PREDICTED: protein CER1-like 2 isoform X2 [Brassica rapa]
Length=625

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 149/195 (76%), Gaps = 4/195 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LT+WPWT LGSFKY+VLAP V  S Y Y T     RD   LL+   ++ R++H
Sbjct  1    MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDHEKLLVVALMVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS SRYRTAKG  RIVDK IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG++L AL+H GP EF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRLDGLVLVALLHAGPGEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTT  600
            HIAY ++  IPL+TT
Sbjct  177  HIAYSLILVIPLVTT  191



>gb|AFW68611.1| hypothetical protein ZEAMMB73_227989 [Zea mays]
Length=419

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 149/198 (75%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ TEWPW  LG+FKY++LAP+VAH  Y   T      D   + I P LL+R LH
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADLGYVAILPSLLLRALH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ WI+ SR ++A+G  ++VD+GIEFEQVDRERNWDDQI+L+G+L Y G   LP   H+P
Sbjct  61   NQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG  L AL+H GPVE +YYWLHRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LF+IPL+     
Sbjct  181  LVAYELLFSIPLIVCTLN  198



>ref|XP_004982905.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+ PG+ TEWPW  LG+FKY++LAP+VAH  Y   T      D   L I P LL+R+LH
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADVGYLAILPSLLLRVLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WI++SR + A+   +IVD+GIEFEQVDRERNWDDQI+L+G+L Y G   +P   H+P
Sbjct  61   NQVWITVSRVQNARSRRQIVDRGIEFEQVDRERNWDDQILLSGILLYLGALYVPGGQHLP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WR DG +L AL+H GPVEF+YYW HRALHHH LY+RYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRADGFLLIALLHAGPVEFIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
             +AY +LFAIPL++   +
Sbjct  181  LVAYELLFAIPLISCALS  198



>ref|XP_006295717.1| hypothetical protein CARUB_v10024836mg [Capsella rubella]
 gb|EOA28615.1| hypothetical protein CARUB_v10024836mg [Capsella rubella]
Length=612

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG LT+WPWT LGSFKY++LAP V  S Y Y T     RD   LLI    + R++H
Sbjct  1    MASRPGFLTDWPWTPLGSFKYLLLAPLVIDSIYSYAT----MRDHEKLLIVAMTVWRIVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WISLSRY+TAKG  RI++K IEF+QVDRER WDDQ+I N L+ Y     +  T+ +P
Sbjct  57   SQVWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQVIFNSLIVYLTKVYVLGTNTLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WRTDG+IL AL+H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRTDGLILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI Y ++  IPL+TT+  
Sbjct  177  HIGYTLILGIPLITTLLC  194



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPGILTEWPW  LG+FKYV++AP+V H  +   T    E D + L IFP LL+RMLH
Sbjct  1    MASRPGILTEWPWHRLGNFKYVIMAPWVLHGLHMMATKGWRETDLSYLTIFPSLLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISL+R++ A+  +RIVDK IEFEQVDRERNWDDQI+L G L Y G+  +P   + P
Sbjct  61   NQVWISLARFQNARSKHRIVDKSIEFEQVDRERNWDDQILLYGWLLYLGHTFIPGAQNAP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +WRTDG ++  L+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  LWRTDGAVIAVLLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVFT  609
            H+AY +LF+IP+L T FT
Sbjct  181  HVAYALLFSIPILATAFT  198



>gb|EMT07276.1| Protein WAX2 [Aegilops tauschii]
Length=604

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 150/197 (76%), Gaps = 0/197 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA+RPG LTEWPW W+GSFKY+V AP    + Y+ +T    + +     I P LL+RMLH
Sbjct  1    MATRPGPLTEWPWHWMGSFKYLVFAPVALQTAYRVVTKGWGDMNLAYAAILPALLLRMLH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            NQ+WISLSR++TA+  + IVD+ +EFEQVDRER+WDDQIIL+GL FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRSLEFEQVDRERSWDDQIILSGLYFYLAYAAIPSVRLMP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W T G I+ AL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIVTEPITSVIHPFAE
Sbjct  121  MWETKGAIIMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  556  HIAYFVLFAIPLLTTVF  606
             + YF+LF IP+L  + 
Sbjct  181  MLVYFLLFLIPMLIPIL  197



>emb|CDX79754.1| BnaC03g20900D [Brassica napus]
Length=614

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LTEWPWT LGSFKY+VLAP V  S Y Y T     RD + LLI   ++ R++H
Sbjct  1    MASRPGLLTEWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDVDKLLILVVMVGRVVH  56

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS +RY+TAKG  RIV+K IEF QVDRER WDDQ+I N L+ Y     +  T+ +P
Sbjct  57   SQMWISFARYKTAKGTKRIVNKSIEFNQVDRERTWDDQVIFNTLVIYLAKVYVLGTNTLP  116

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
             WR DG++  AL+H GPVEF+YYW HRALHHH LYSRYHSHHHSSIVTEPITSV+HPFAE
Sbjct  117  FWRLDGVVQVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  556  HIAYFVLFAIPLLTTVFT  609
            HI Y ++  IPL+TT+  
Sbjct  177  HIGYTLILGIPLVTTLLC  194



>ref|XP_003580122.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=620

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 147/193 (76%), Gaps = 0/193 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MA RPG LTEWPW W+GSFKY+VLAP   H+ +   T      +P    I P LL+RM+H
Sbjct  1    MAKRPGPLTEWPWKWMGSFKYLVLAPVAVHTAHMLATKGRGGINPAQATILPILLLRMMH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WISLSR++TA+  + IVD+ +EFEQVDRER+WDDQII +GLL Y  Y  +P    +P
Sbjct  61   SQIWISLSRHQTARRKHIIVDRSLEFEQVDRERSWDDQIIFSGLLSYMAYLAIPNVSLIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            +W T G I+TAL+H GPVEFLYYW HRALHHH LYSRYHSHHH+SIV EPITS IHPFAE
Sbjct  121  VWSTKGAIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVVEPITSTIHPFAE  180

Query  556  HIAYFVLFAIPLL  594
            H+ YF+LFAIP L
Sbjct  181  HLVYFLLFAIPTL  193



>ref|XP_010414811.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  16   MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpflliRMLH  195
            MASRPG+LTEWPW+ LG FKY+++ P    S   Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGDFKYLLVVPLAIASIISYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  196  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  375
            +Q+WIS+SR +TAKG  +IV K IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRQKTAKGTKKIVYKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRIP  120

Query  376  IWRTDGIILTALIHTGPVEFLYYWLHRAlhhhilysryhshhhssiVTEPITSVIHPFAE  555
            IWR DG IL ALIH GPVEFLYYW HRALHHH LYSRYHSHHHSSIVT+PITSV+HPFAE
Sbjct  121  IWRLDGAILIALIHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTKPITSVVHPFAE  180

Query  556  HIAYFVLFAIPLLTT  600
            HIAY +LFAIP++  
Sbjct  181  HIAYTILFAIPIVAA  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230