BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF013F11

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010093134.1|  Cytochrome P450                                    112   2e-25   Morus notabilis
ref|XP_009784851.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    111   5e-25   Nicotiana sylvestris
ref|XP_010044825.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_009612398.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    109   2e-24   Nicotiana tomentosiformis
ref|XP_002266883.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     109   3e-24   Vitis vinifera
ref|XP_010260623.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    109   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008342307.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     108   4e-24   
ref|XP_009784850.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    108   6e-24   Nicotiana sylvestris
ref|XP_006429775.1|  hypothetical protein CICLE_v10011353mg             107   1e-23   
ref|XP_006481375.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    107   1e-23   Citrus sinensis [apfelsine]
ref|XP_009612399.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    106   2e-23   Nicotiana tomentosiformis
ref|XP_006354415.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    107   2e-23   Solanum tuberosum [potatoes]
ref|XP_010321037.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    106   2e-23   Solanum lycopersicum
ref|XP_010260624.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    105   3e-23   
ref|XP_004239253.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    106   3e-23   Solanum lycopersicum
ref|XP_009784852.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    105   4e-23   Nicotiana sylvestris
ref|XP_010321038.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    103   7e-23   
ref|XP_007049044.1|  Cytochrome P450 97B2, chloroplastic isoform 2      105   1e-22   
ref|XP_007049043.1|  Cytochrome P450 97B2 isoform 1                     105   1e-22   
ref|XP_009347871.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     104   2e-22   Pyrus x bretschneideri [bai li]
gb|KDP42786.1|  hypothetical protein JCGZ_00485                         104   2e-22   Jatropha curcas
ref|XP_011100398.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     104   2e-22   Sesamum indicum [beniseed]
gb|KJB10648.1|  hypothetical protein B456_001G213800                    103   3e-22   Gossypium raimondii
ref|XP_010914244.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     103   4e-22   Elaeis guineensis
ref|XP_006841947.1|  hypothetical protein AMTR_s00042p00221280          103   5e-22   
gb|KJB10651.1|  hypothetical protein B456_001G213800                    100   6e-22   Gossypium raimondii
ref|XP_010532498.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     102   6e-22   Tarenaya hassleriana [spider flower]
gb|KJB10649.1|  hypothetical protein B456_001G213800                    100   7e-22   Gossypium raimondii
ref|XP_004303949.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     101   1e-21   Fragaria vesca subsp. vesca
ref|XP_008451892.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    101   2e-21   
ref|XP_004147731.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    101   2e-21   Cucumis sativus [cucumbers]
ref|XP_008229650.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     100   4e-21   Prunus mume [ume]
ref|XP_007215027.1|  hypothetical protein PRUPE_ppa003405mg           99.4    9e-21   
ref|XP_009412059.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  99.4    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN35086.1|  Cytochrome P450 97B2, chloroplastic                   99.0    1e-20   Glycine soja [wild soybean]
ref|XP_004164429.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  98.6    2e-20   
ref|XP_010435019.1|  PREDICTED: cytochrome P450 97B3, chloroplast...  98.6    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006414564.1|  hypothetical protein EUTSA_v10024764mg           98.6    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010313051.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  98.6    2e-20   
ref|XP_007158591.1|  hypothetical protein PHAVU_002G165400g           98.2    3e-20   Phaseolus vulgaris [French bean]
ref|XP_010495892.1|  PREDICTED: cytochrome P450 97B3, chloroplast...  97.1    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008809593.1|  PREDICTED: cytochrome P450 97B2, chloroplastic   96.7    7e-20   Phoenix dactylifera
ref|XP_011002376.1|  PREDICTED: cytochrome P450 97B2, chloroplastic   96.3    1e-19   Populus euphratica
ref|XP_010440341.1|  PREDICTED: cytochrome P450 97B3, chloroplastic   96.3    1e-19   Camelina sativa [gold-of-pleasure]
ref|NP_001235534.1|  cytochrome P450 97B2, chloroplastic              96.3    1e-19   
dbj|BAD26183.1|  putative cytochrome P450                             95.5    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84668.1|  hypothetical protein OsI_06039                        95.5    2e-19   Oryza sativa Indica Group [Indian rice]
gb|AJD25227.1|  cytochrome P450 CYP97B34                              95.5    2e-19   Salvia miltiorrhiza [Chinese salvia]
emb|CDP16026.1|  unnamed protein product                              95.1    3e-19   Coffea canephora [robusta coffee]
ref|XP_002308766.1|  hypothetical protein POPTR_0006s00800g           94.4    5e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006478583.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    9e-19   Citrus sinensis [apfelsine]
ref|NP_001046036.1|  Os02g0173100                                     90.9    1e-18   
ref|XP_010680161.1|  PREDICTED: cytochrome P450 97B2, chloroplastic   92.8    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006478580.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    2e-18   Citrus sinensis [apfelsine]
gb|AAT28222.1|  putative 97B2-like cytochrome P450                    92.4    2e-18   Ginkgo biloba [ginkgo]
ref|XP_002520583.1|  cytochrome P450, putative                        92.4    2e-18   Ricinus communis
gb|EYU42831.1|  hypothetical protein MIMGU_mgv1a003489mg              92.4    3e-18   Erythranthe guttata [common monkey flower]
gb|EAZ21913.1|  hypothetical protein OsJ_05566                        92.4    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006478581.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    3e-18   Citrus sinensis [apfelsine]
emb|CDY22733.1|  BnaA08g05630D                                        92.0    3e-18   Brassica napus [oilseed rape]
emb|CDY09057.1|  BnaC08g10110D                                        92.0    3e-18   Brassica napus [oilseed rape]
gb|AFW66345.1|  putative cytochrome P450 superfamily protein          87.4    5e-18   
gb|KFK33561.1|  hypothetical protein AALP_AA5G029500                  91.3    6e-18   Arabis alpina [alpine rockcress]
ref|XP_009107829.1|  PREDICTED: cytochrome P450 97B3, chloroplastic   91.3    6e-18   Brassica rapa
ref|XP_006285060.1|  hypothetical protein CARUB_v10006369mg           90.5    1e-17   Capsella rubella
ref|XP_006648355.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  89.7    2e-17   
ref|XP_008679919.1|  PREDICTED: cytochrome P450 97B2, chloroplastic   89.0    4e-17   Zea mays [maize]
ref|NP_193247.2|  cytochrome P450 97B3                                88.2    6e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10290.1|  cytochrome P450 like protein                         88.2    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004951757.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  87.8    1e-16   Setaria italica
ref|XP_002868224.1|  hypothetical protein ARALYDRAFT_493377           86.3    4e-16   
sp|Q43078.1|C97B1_PEA  RecName: Full=Cytochrome P450 97B1, chloro...  85.9    4e-16   Pisum sativum [garden pea]
ref|XP_002451628.1|  hypothetical protein SORBIDRAFT_04g004850        85.5    6e-16   Sorghum bicolor [broomcorn]
dbj|BAJ97821.1|  predicted protein                                    84.7    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87287.1|  predicted protein                                    84.7    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003610974.1|  Cytochrome P450                                  84.3    2e-15   Medicago truncatula
gb|EMS51606.1|  Cytochrome P450 97B2, chloroplastic                   84.3    2e-15   Triticum urartu
ref|XP_003570274.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  83.6    3e-15   Brachypodium distachyon [annual false brome]
gb|KEH27407.1|  cytochrome P450 family 97 protein                     82.8    3e-15   Medicago truncatula
gb|EPS66221.1|  hypothetical protein M569_08554                       80.5    1e-14   Genlisea aurea
ref|XP_001769554.1|  predicted protein                                81.3    2e-14   
gb|EMT03024.1|  Cytochrome P450 97B2                                  76.6    7e-13   
gb|KHG14945.1|  Cytochrome P450, chloroplastic                        75.1    2e-12   Gossypium arboreum [tree cotton]
ref|XP_002968239.1|  hypothetical protein SELMODRAFT_145597           68.6    3e-10   
ref|XP_002976141.1|  hypothetical protein SELMODRAFT_175360           67.0    9e-10   
gb|AFK42094.1|  unknown                                               56.2    2e-07   Medicago truncatula
ref|XP_006833026.1|  hypothetical protein AMTR_s00094p00103220        54.3    5e-07   



>ref|XP_010093134.1| Cytochrome P450 [Morus notabilis]
 gb|EXB53586.1| Cytochrome P450 [Morus notabilis]
Length=581

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 7/80 (9%)
 Frame = +2

Query  323  GTRHSHGSS----FKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSM  490
            G+ HS  +S    FK K S   R+RCQSTSTDE KTK NLLDNASNLLTNLLSGG++GSM
Sbjct  28   GSFHSSSASNLLYFKPKRS---RVRCQSTSTDELKTKRNLLDNASNLLTNLLSGGRLGSM  84

Query  491  PTAEGAVSDLFGRPVFFSLY  550
            P AEGAVSDLF RP+FFSLY
Sbjct  85   PVAEGAVSDLFDRPLFFSLY  104



>ref|XP_009784851.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   111 bits (277),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 63/113 (56%), Positives = 68/113 (60%), Gaps = 20/113 (18%)
 Frame = +2

Query  230  MATG------CCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQ  391
            MATG      C V    +DC   R C    S  + +   R S              IRCQ
Sbjct  1    MATGFVSSNTCLVLNRRSDCCSSRFCHFPSSYPTLSTPKRAS--------------IRCQ  46

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            STSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RP+FFSLY
Sbjct  47   STSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLY  99



>ref|XP_010044825.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Eucalyptus grandis]
 gb|KCW88536.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88537.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88538.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
Length=584

 Score =   109 bits (273),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            P G C IRCQSTSTDE KTK NLLDNASNLLTNLLSGG +GSMP AEGAV+DLFG+P+FF
Sbjct  44   PRGPC-IRCQSTSTDEPKTKRNLLDNASNLLTNLLSGGSLGSMPIAEGAVTDLFGKPLFF  102

Query  542  SLY  550
            SLY
Sbjct  103  SLY  105



>ref|XP_009612398.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=582

 Score =   109 bits (273),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 68/113 (60%), Positives = 74/113 (65%), Gaps = 12/113 (11%)
 Frame = +2

Query  230  MATG------CCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQ  391
            MATG      C V    +DC   R C   PS SS ++ +  S  S+ K        IRCQ
Sbjct  1    MATGSVSSNTCLVLNRRSDCCSSRFC-HFPSSSSSSSSSSKSTLSTPKRT-----SIRCQ  54

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            STSTDE KTKMNL DNASNLLTNLLSGG IGSMP AEGAVSDLF RP+FFSLY
Sbjct  55   STSTDEPKTKMNLFDNASNLLTNLLSGGSIGSMPIAEGAVSDLFDRPLFFSLY  107



>ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera]
 emb|CBI34117.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   109 bits (272),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 3/84 (4%)
 Frame = +2

Query  302  SISSRTAGTRHSHGSSF-KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGK  478
            S  SRT   + S  S   K++P GG  IRCQSTSTD++K++ NLLDNASNLLTN LSGG 
Sbjct  15   SCFSRTPYLQSSRTSQLSKLRP-GGSSIRCQSTSTDKQKSR-NLLDNASNLLTNFLSGGS  72

Query  479  IGSMPTAEGAVSDLFGRPVFFSLY  550
            IGSMP AEGAVSDLFGRP+FFSLY
Sbjct  73   IGSMPVAEGAVSDLFGRPLFFSLY  96



>ref|XP_010260623.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   109 bits (272),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  371  GCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            G RIRCQSTST+E KT+ NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFGRP+FFSLY
Sbjct  46   GSRIRCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLFFSLY  105



>ref|XP_008342307.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Malus domestica]
Length=577

 Score =   108 bits (270),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  374  CRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            C +RCQSTST+E KTK NLLDNASNLLTN LSGGKIGSMPTAEGAV+DLF RP+FFSLY
Sbjct  43   CPLRCQSTSTEEPKTKRNLLDNASNLLTNFLSGGKIGSMPTAEGAVTDLFDRPLFFSLY  101



>ref|XP_009784850.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=584

 Score =   108 bits (269),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RP+FFSLY
Sbjct  53   IRCQSTSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLY  109



>ref|XP_006429775.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43015.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=582

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 68/107 (64%), Gaps = 7/107 (7%)
 Frame = +2

Query  236  TGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSS--FKMKPSGGCRIRCQSTSTDE  409
            T  C++  H       S +G  S  +R  G   S+  +     KP     IRCQST T+E
Sbjct  4    TTTCISHHHLS-----SAVGYGSFHAREFGFVGSNSRTHLVNSKPKESPSIRCQSTGTNE  58

Query  410  RKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
             KT+ NLLDNASNLLTNLLSGG +GS P AEGAVSDLFGRP+FFSLY
Sbjct  59   PKTRRNLLDNASNLLTNLLSGGNLGSTPVAEGAVSDLFGRPLFFSLY  105



>ref|XP_006481375.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Citrus sinensis]
Length=619

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 68/107 (64%), Gaps = 7/107 (7%)
 Frame = +2

Query  236  TGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSS--FKMKPSGGCRIRCQSTSTDE  409
            T  C++  H       S +G  S  +R  G   S+  +     KP     IRCQST T+E
Sbjct  41   TTTCISHHHLS-----SAVGYGSFHAREFGFVGSNSRTHLVNSKPKESPSIRCQSTGTNE  95

Query  410  RKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
             KT+ NLLDNASNLLTNLLSGG +GS P AEGAVSDLFGRP+FFSLY
Sbjct  96   PKTRRNLLDNASNLLTNLLSGGNLGSTPVAEGAVSDLFGRPLFFSLY  142



>ref|XP_009612399.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTSTDE KTKMNL DNASNLLTNLLSGG IGSMP AEGAVSDLF RP+FFSLY
Sbjct  51   IRCQSTSTDEPKTKMNLFDNASNLLTNLLSGGSIGSMPIAEGAVSDLFDRPLFFSLY  107



>ref|XP_006354415.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Solanum 
tuberosum]
Length=573

 Score =   107 bits (266),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 62/109 (57%), Positives = 70/109 (64%), Gaps = 14/109 (13%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCR--IRCQSTST  403
            MATG C + T         C+ L   + R+        SS+    S   R  IRCQST T
Sbjct  1    MATGFCSSNT---------CLVL---NRRSDSIFRHFPSSYPTSGSTRKRSSIRCQSTGT  48

Query  404  DERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            DE KTKM+L DNASNLLTNLLSGGKIGSMP AEGAV+DLF RP+FFSLY
Sbjct  49   DEPKTKMSLFDNASNLLTNLLSGGKIGSMPIAEGAVTDLFDRPLFFSLY  97



>ref|XP_010321037.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=573

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 62/109 (57%), Positives = 70/109 (64%), Gaps = 14/109 (13%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCR--IRCQSTST  403
            MATG C + T         C+ L   + R+        SS+    S   R  IRCQST T
Sbjct  1    MATGFCSSIT---------CLVL---NRRSDSIFRHFPSSYPTSWSTQKRSSIRCQSTGT  48

Query  404  DERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            DE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLY
Sbjct  49   DEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLY  97



>ref|XP_010260624.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  371  GCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            G RIRCQSTST+E KT+ NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFGRP+FFSLY
Sbjct  46   GSRIRCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLFFSLY  105



>ref|XP_004239253.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=578

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 71/113 (63%), Gaps = 17/113 (15%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRH---SHGSSFKMKPSGGCRI---RCQ  391
            MATG C + T         C+ L   S      RH   S+ +S+  +     R    RCQ
Sbjct  1    MATGFCSSIT---------CLVLNRRSDSI--FRHFPSSYPTSWSTQKRSSIRTMKCRCQ  49

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            ST TDE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLY
Sbjct  50   STGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLY  102



>ref|XP_009784852.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RP+FFSLY
Sbjct  53   IRCQSTSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLY  109



>ref|XP_010321038.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Solanum 
lycopersicum]
Length=436

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 72/113 (64%), Gaps = 17/113 (15%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRH---SHGSSFKMKPSGGCRI---RCQ  391
            MATG C + T         C+ L   S   +  RH   S+ +S+  +     R    RCQ
Sbjct  1    MATGFCSSIT---------CLVLNRRSD--SIFRHFPSSYPTSWSTQKRSSIRTMKCRCQ  49

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            ST TDE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLY
Sbjct  50   STGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLY  102



>ref|XP_007049044.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOX93201.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
Length=582

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 2/66 (3%)
 Frame = +2

Query  353  KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRP  532
            K+K S    IRCQSTSTDE K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFG+P
Sbjct  41   KLKTSAA--IRCQSTSTDEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGQP  98

Query  533  VFFSLY  550
            +FFSLY
Sbjct  99   LFFSLY  104



>ref|XP_007049043.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
 gb|EOX93200.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
Length=622

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 2/66 (3%)
 Frame = +2

Query  353  KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRP  532
            K+K S    IRCQSTSTDE K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFG+P
Sbjct  41   KLKTSAA--IRCQSTSTDEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGQP  98

Query  533  VFFSLY  550
            +FFSLY
Sbjct  99   LFFSLY  104



>ref|XP_009347871.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Pyrus x bretschneideri]
Length=577

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  374  CRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            C +R QSTST+E KTK NLLDNASNLLTN LSGGKIGSMPTAEGAV+DLF RP+FFSLY
Sbjct  43   CPLRSQSTSTEEPKTKRNLLDNASNLLTNFLSGGKIGSMPTAEGAVTDLFDRPLFFSLY  101



>gb|KDP42786.1| hypothetical protein JCGZ_00485 [Jatropha curcas]
Length=583

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAV  511
            H H  + K K  G   IRCQSTSTD+ KT+ NLLDNASNLLTNLLSGG +GSMPTAEGAV
Sbjct  40   HYHFLNSKAK-KGFPAIRCQSTSTDKPKTR-NLLDNASNLLTNLLSGGNLGSMPTAEGAV  97

Query  512  SDLFGRPVFFSLY  550
            SDLFGRP+FFSLY
Sbjct  98   SDLFGRPLFFSLY  110



>ref|XP_011100398.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Sesamum indicum]
Length=577

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 64/87 (74%), Gaps = 13/87 (15%)
 Frame = +2

Query  329  RHSHGSSFKMKPSG-----GCR-----IRCQS-TSTDERKT--KMNLLDNASNLLTNLLS  469
            R +  SS +  PS      GC+     +RCQS TSTDE KT   MNLLDNASNLLTN LS
Sbjct  15   RSTEFSSSRFLPSSATPLVGCKPKGSSVRCQSSTSTDENKTTKSMNLLDNASNLLTNFLS  74

Query  470  GGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            GGKIGSMPTAEGAVSDLFG+P+FFSLY
Sbjct  75   GGKIGSMPTAEGAVSDLFGKPLFFSLY  101



>gb|KJB10648.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=579

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLY
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLY  102



>ref|XP_010914244.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Elaeis guineensis]
Length=574

 Score =   103 bits (256),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 55/86 (64%), Positives = 62/86 (72%), Gaps = 4/86 (5%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSG  472
            GL S+ S   G      S F  K S   RIRCQSTS ++ K K NLLDNASNLLTNLLSG
Sbjct  16   GLHSLQSSQTGASTPR-SVFPKKRS---RIRCQSTSIEKPKMKRNLLDNASNLLTNLLSG  71

Query  473  GKIGSMPTAEGAVSDLFGRPVFFSLY  550
            G +G+MP AEGAVSDLFG+P+FFSLY
Sbjct  72   GSLGTMPVAEGAVSDLFGQPLFFSLY  97



>ref|XP_006841947.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
 gb|ERN03622.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
Length=589

 Score =   103 bits (256),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  341  GSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDL  520
            G   K + + G  +RCQSTS +E K + NLLDNASNLLTNLLSGG+IG MP AEGAVSDL
Sbjct  37   GKYQKKRRNNGFMLRCQSTSKNETKFEKNLLDNASNLLTNLLSGGRIGRMPVAEGAVSDL  96

Query  521  FGRPVFFSLY  550
            FGRP+FFSLY
Sbjct  97   FGRPLFFSLY  106



>gb|KJB10651.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=287

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLY
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLY  102



>ref|XP_010532498.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   102 bits (255),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 62/86 (72%), Gaps = 9/86 (10%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSG  472
            GL   SSR+    +S         SG  RIRCQSTST E KT+ N+ DNASNLLTNLLSG
Sbjct  31   GLLGFSSRSISVGYSR--------SGSARIRCQSTSTKEPKTR-NIFDNASNLLTNLLSG  81

Query  473  GKIGSMPTAEGAVSDLFGRPVFFSLY  550
            G +GSMP A+GAVSDLFG+P+FFSLY
Sbjct  82   GSLGSMPIAQGAVSDLFGKPLFFSLY  107



>gb|KJB10649.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=408

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLY
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLY  102



>ref|XP_004303949.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011467680.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=572

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query  323  GTRHSHGSSFKMKPS-GGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTA  499
            G  HS  ++  + P      IRCQSTST++ KTK NLLDNASNLLTNLLSGG +GSMP A
Sbjct  20   GYLHSSTTTNLLNPKLKRSSIRCQSTSTEDPKTKRNLLDNASNLLTNLLSGGNLGSMPIA  79

Query  500  EGAVSDLFGRPVFFSLY  550
            EGAV+DLF RP+FFSLY
Sbjct  80   EGAVTDLFDRPLFFSLY  96



>ref|XP_008451892.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Cucumis melo]
Length=580

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFGRP+FF+LY
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGRPLFFALY  103



>ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN53488.1| hypothetical protein Csa_4G056760 [Cucumis sativus]
Length=580

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFGRP+FF+LY
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGRPLFFALY  103



>ref|XP_008229650.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Prunus mume]
Length=577

 Score =   100 bits (249),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTSTDE KT+  LLDNASNLLTN LSGG +GSMP AEGAVSDLF RP+FF+LY
Sbjct  47   IRCQSTSTDEPKTRRKLLDNASNLLTNFLSGGSLGSMPIAEGAVSDLFARPLFFALY  103



>ref|XP_007215027.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
 gb|EMJ16226.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
Length=577

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTSTDE KT+  LLDNASNLLTN LSGG +GSMP AEGAVSDLF RP+FF+LY
Sbjct  45   IRCQSTSTDEPKTRRKLLDNASNLLTNFLSGGSLGSMPIAEGAVSDLFVRPLFFALY  101



>ref|XP_009412059.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=574

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKT-KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPV  535
            KPS    IRCQSTS ++ KT K NLLDNASNLLTN LSGG++G MPTAEGAVSDLFGRP+
Sbjct  40   KPS---LIRCQSTSMEKPKTSKRNLLDNASNLLTNFLSGGRLGDMPTAEGAVSDLFGRPL  96

Query  536  FFSLY  550
            FFSLY
Sbjct  97   FFSLY  101



>gb|KHN35086.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=576

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            +P     IRCQS +TD++K+  NLLDNASNLLT+LLSGG IGSMP AEGAVSDL GRP+F
Sbjct  36   QPKRISSIRCQSINTDKKKSSRNLLDNASNLLTDLLSGGSIGSMPIAEGAVSDLLGRPLF  95

Query  539  FSLY  550
            FSLY
Sbjct  96   FSLY  99



>ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
Length=580

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFG P+FF+LY
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGHPLFFALY  103



>ref|XP_010435019.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQST T E KT  NLLDNASNLLTN LSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  47   IRCQSTDTKEPKTNGNLLDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  103



>ref|XP_006414564.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
 gb|ESQ56017.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
Length=581

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 11/97 (11%)
 Frame = +2

Query  260  HTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDN  439
            H    +GRS   L  +  +T  +R +  S           IRCQST+T E KT  N+LDN
Sbjct  20   HGGLHVGRSDYCLFGLYPQTENSRRASVS-----------IRCQSTNTKEPKTNGNILDN  68

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            ASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  69   ASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  105



>ref|XP_010313051.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic-like 
[Solanum lycopersicum]
Length=585

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            + RCQST TDE KTK++  DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLY
Sbjct  52   KCRCQSTGTDEPKTKVHSFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLY  109



>ref|XP_007158591.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
 gb|ESW30585.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
Length=576

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            P     IRCQS +TD++K+  N+LDNASNLLT+LLSGG IGSMP AEGAVSDLF RP+FF
Sbjct  37   PQQISSIRCQSINTDKKKSSRNILDNASNLLTDLLSGGSIGSMPIAEGAVSDLFNRPLFF  96

Query  542  SLY  550
            SLY
Sbjct  97   SLY  99



>ref|XP_010495892.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQST T E KT  N LDNASNLLTN LSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  47   IRCQSTDTKEPKTNGNFLDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  103



>ref|XP_008809593.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Phoenix dactylifera]
Length=572

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            P    + RCQSTS ++ KTK NLLDNASNLLTNLLSGG + +MP A+GAVSDLFGRP+FF
Sbjct  33   PKKRSQTRCQSTSIEKPKTKRNLLDNASNLLTNLLSGGILETMPVADGAVSDLFGRPLFF  92

Query  542  SLY  550
            SLY
Sbjct  93   SLY  95



>ref|XP_011002376.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Populus euphratica]
Length=585

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +2

Query  326  TRHSHGSSF-KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAE  502
            +R  H   F   K  G   IRCQSTST+E KT+ N LD ASNLLTNLLSGG +GSMP AE
Sbjct  34   SRFPHKYHFLSSKTKGSPLIRCQSTSTEEPKTR-NPLDKASNLLTNLLSGGNLGSMPIAE  92

Query  503  GAVSDLFGRPVFFSLY  550
            GAVSDLF RP+FFSLY
Sbjct  93   GAVSDLFSRPLFFSLY  108



>ref|XP_010440341.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Camelina sativa]
Length=578

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQS+ T E KT  N+LDNASNLLTN LSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  46   IRCQSSDTKEPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  102



>ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max]
 sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor 
[Glycine max]
 gb|AAB94586.1| CYP97B2p [Glycine max]
Length=576

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            +P     IRCQS +TD++K+  NLL NASNLLT+LLSGG IGSMP AEGAVSDL GRP+F
Sbjct  36   QPKRISSIRCQSINTDKKKSSRNLLGNASNLLTDLLSGGSIGSMPIAEGAVSDLLGRPLF  95

Query  539  FSLY  550
            FSLY
Sbjct  96   FSLY  99



>dbj|BAD26183.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=571

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  380  IRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            +RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLY
Sbjct  41   VRCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLY  98



>gb|EAY84668.1| hypothetical protein OsI_06039 [Oryza sativa Indica Group]
Length=571

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  380  IRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            +RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLY
Sbjct  41   VRCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLY  98



>gb|AJD25227.1| cytochrome P450 CYP97B34 [Salvia miltiorrhiza]
Length=582

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 52/60 (87%), Gaps = 3/60 (5%)
 Frame = +2

Query  380  IRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQS TSTDE K   KMNLLDNASNLLTN LSGGKI SMPTAEGAVSDLFG+P+F SL+
Sbjct  46   IRCQSSTSTDETKATKKMNLLDNASNLLTNFLSGGKILSMPTAEGAVSDLFGKPLFLSLF  105



>emb|CDP16026.1| unnamed protein product [Coffea canephora]
Length=599

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRC S  T+  K KMNLLDNASNLLTN LSGG++GSMP AEGAVSDLFGRP+FF+LY
Sbjct  64   IRCHSAKTNAPKPKMNLLDNASNLLTNFLSGGRMGSMPMAEGAVSDLFGRPLFFALY  120



>ref|XP_002308766.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
 gb|EEE92289.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
Length=579

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            K  G   IRCQSTST+E KT+ N LD ASNLLTNLLSGG +GSMP AEGAVSDLF RP+F
Sbjct  40   KTKGSPLIRCQSTSTEEPKTR-NPLDKASNLLTNLLSGGNLGSMPIAEGAVSDLFSRPLF  98

Query  539  FSLY  550
            FSL+
Sbjct  99   FSLF  102



>ref|XP_006478583.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Citrus sinensis]
 ref|XP_006478584.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X5 [Citrus sinensis]
Length=204

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +2

Query  248  VAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM------------KPSGGCRIRCQ  391
            +A+ H    +  S +   S +S   G    HG  F              KP     IRCQ
Sbjct  92   LASNHAQLNISISNLN-NSTNSEAVGYGSFHGREFGFVGGNSRTHLVNSKPKESPSIRCQ  150

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            ST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  P+FF
Sbjct  151  STGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLFF  200



>ref|NP_001046036.1| Os02g0173100 [Oryza sativa Japonica Group]
 dbj|BAF07950.1| Os02g0173100, partial [Oryza sativa Japonica Group]
Length=286

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLY
Sbjct  1    RCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLY  57



>ref|XP_010680161.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            R  CQST+T++ K++ NLLDNASNLLTN LSGG +GSMPTAEGAVSDLFGRP+F SLY
Sbjct  43   RFICQSTNTEKPKSR-NLLDNASNLLTNFLSGGNLGSMPTAEGAVSDLFGRPLFLSLY  99



>ref|XP_006478580.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Citrus sinensis]
Length=267

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +2

Query  248  VAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM------------KPSGGCRIRCQ  391
            +A+ H    +  S +   S +S   G    HG  F              KP     IRCQ
Sbjct  155  LASNHAQLNISISNLN-NSTNSEAVGYGSFHGREFGFVGGNSRTHLVNSKPKESPSIRCQ  213

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            ST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  P+FF
Sbjct  214  STGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLFF  263



>gb|AAT28222.1| putative 97B2-like cytochrome P450 [Ginkgo biloba]
Length=586

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 4/71 (6%)
 Frame = +2

Query  344  SSFKMKPSGGCRIRCQSTSTDERKTKMN--LLDNASNLLTNLLSGGKIGSMPTAEGAVSD  517
            SSF++ P      RC+S+ST ER TK N  LLDNASN LTNLLSGG++G+MP AEGAVSD
Sbjct  37   SSFRL-PGSKFFPRCESSST-ERATKSNRTLLDNASNFLTNLLSGGQLGTMPIAEGAVSD  94

Query  518  LFGRPVFFSLY  550
            LFG+P+FFSLY
Sbjct  95   LFGKPLFFSLY  105



>ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41816.1| cytochrome P450, putative [Ricinus communis]
Length=555

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +2

Query  335  SHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVS  514
            SH      K  G   IRCQ   TDE KT+  LLDNASNLLT+ LSGG +GSMP AEGAVS
Sbjct  8    SHYPLLNSKAKGSPVIRCQPKITDEPKTR-TLLDNASNLLTSFLSGGSLGSMPIAEGAVS  66

Query  515  DLFGRPVFFSLY  550
            DLF RP+FFSLY
Sbjct  67   DLFNRPLFFSLY  78



>gb|EYU42831.1| hypothetical protein MIMGU_mgv1a003489mg [Erythranthe guttata]
Length=582

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 57/82 (70%), Gaps = 13/82 (16%)
 Frame = +2

Query  344  SSFKMKPS-----GGCR-----IRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIG  484
            SS ++ PS     G C      IRCQS TSTDE K   KM LLDNASN LTN LSGG IG
Sbjct  24   SSSRLPPSASPFSGRCNPRFSSIRCQSSTSTDETKAAKKMTLLDNASNFLTNFLSGGNIG  83

Query  485  SMPTAEGAVSDLFGRPVFFSLY  550
             MP AEGAVSDLFG+P+FFSLY
Sbjct  84   PMPIAEGAVSDLFGKPLFFSLY  105



>gb|EAZ21913.1| hypothetical protein OsJ_05566 [Oryza sativa Japonica Group]
Length=557

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +2

Query  386  CQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            CQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLY
Sbjct  29   CQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLY  84



>ref|XP_006478581.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Citrus sinensis]
Length=266

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            KP     IRCQST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  P+F
Sbjct  202  KPKESPSIRCQSTGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLF  261

Query  539  F  541
            F
Sbjct  262  F  262



>emb|CDY22733.1| BnaA08g05630D [Brassica napus]
Length=566

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQST+T E K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  45   IRCQSTNTKEPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  100



>emb|CDY09057.1| BnaC08g10110D [Brassica napus]
Length=565

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQST+T E K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  45   IRCQSTNTKEPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  100



>gb|AFW66345.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=169

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 6/63 (10%)
 Frame = +2

Query  380  IRCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
             RCQSTS D+++ +       NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FF
Sbjct  37   FRCQSTSVDKQQERPPKPKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFF  96

Query  542  SLY  550
            SLY
Sbjct  97   SLY  99



>gb|KFK33561.1| hypothetical protein AALP_AA5G029500 [Arabis alpina]
Length=577

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQST+T E KT  N+LDNASNLLTN LSGG + SMP A+GAVSDLFG+P+F SLY
Sbjct  45   IRCQSTNTKEPKTDGNILDNASNLLTNFLSGGSLSSMPIAKGAVSDLFGKPLFLSLY  101



>ref|XP_009107829.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Brassica rapa]
Length=578

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQST+T + K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLY
Sbjct  45   IRCQSTNTKDPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLY  100



>ref|XP_006285060.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
 gb|EOA17958.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
Length=576

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAV  511
            +SH  S          IRCQST+T E K   N+LD+ASNLLTN LSGG +GSMPTAEGAV
Sbjct  29   YSHTLSSVNPRRASVSIRCQSTNTKEPKNG-NILDDASNLLTNFLSGGNLGSMPTAEGAV  87

Query  512  SDLFGRPVFFSLY  550
            SDLFG+P+F SLY
Sbjct  88   SDLFGKPLFLSLY  100



>ref|XP_006648355.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Oryza brachyantha]
Length=543

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
             CQSTS D++ K K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLY
Sbjct  14   ECQSTSVDDKPKPKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLY  70



>ref|XP_008679919.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Zea mays]
 gb|ADL28271.1| carotene beta-ring hydroxylase [Zea mays]
 gb|AFP28222.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW66346.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=572

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 6/62 (10%)
 Frame = +2

Query  383  RCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            RCQSTS D+++ +       NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FFS
Sbjct  38   RCQSTSVDKQQERPPKPKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFFS  97

Query  545  LY  550
            LY
Sbjct  98   LY  99



>ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana]
 sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana]
Length=580

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 3/57 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            I+CQST   E KT  N+LDNASNLLTN LSGG +GSMPTAEG+VSDLFG+P+F SLY
Sbjct  51   IKCQST---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGSVSDLFGKPLFLSLY  104



>emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=576

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 3/57 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            I+CQST   E KT  N+LDNASNLLTN LSGG +GSMPTAEG+VSDLFG+P+F SLY
Sbjct  47   IKCQST---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGSVSDLFGKPLFLSLY  100



>ref|XP_004951757.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Setaria 
italica]
Length=568

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 6/62 (10%)
 Frame = +2

Query  383  RCQSTSTDERK------TKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            RCQSTS D+ +       + N+LDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FFS
Sbjct  37   RCQSTSVDKEQEQPPKPKQRNMLDNASNLLTNFLSGGSLGAMPVAEGAVTDLFGKPLFFS  96

Query  545  LY  550
            LY
Sbjct  97   LY  98



>ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 3/57 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            I+CQS    E KT  N+LDNASNLLTN LSGG +GSMPTA+GAVSDLFG+P+F SLY
Sbjct  42   IKCQSM---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAQGAVSDLFGKPLFLSLY  95



>sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome 
P450 97A2; Flags: Precursor [Pisum sativum]
 emb|CAA89260.1| cytochrome P450 [Pisum sativum]
Length=552

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERK-TKMNLLDNASNLLTNLLSGGKIGSMPTAEGA  508
            H H SS   + S    IRCQS + ++RK +  N+ DNASNLLT+LLSG  +GSMP AEGA
Sbjct  38   HFHFSSHSKRFSS---IRCQSVNGEKRKQSSRNVFDNASNLLTSLLSGANLGSMPIAEGA  94

Query  509  VSDLFGRPVFFSLY  550
            V+DLF RP+FFSLY
Sbjct  95   VTDLFDRPLFFSLY  108



>ref|XP_002451628.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
 gb|EES04604.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
Length=573

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 7/63 (11%)
 Frame = +2

Query  383  RCQSTSTDERKTKM-------NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            RCQSTS D+++          NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FF
Sbjct  38   RCQSTSVDKQQQPPPPKQKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFF  97

Query  542  SLY  550
            SLY
Sbjct  98   SLY  100



>dbj|BAJ97821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  13   LPRSSTGTHRVASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  66

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            LTNLL+GG + +MP AEGAV+DLF RP+F+SLY
Sbjct  67   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLY  99



>dbj|BAJ87287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  13   LPRSSTGTHRVASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  66

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            LTNLL+GG + +MP AEGAV+DLF RP+F+SLY
Sbjct  67   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLY  99



>ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula]
 gb|AES93932.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=574

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = +2

Query  380  IRCQSTSTDERKTKM-----NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            IRCQ+ + D++K        N+ DNASNLLTNLLSGG +G+MP AEGAV+DLF RP+FFS
Sbjct  36   IRCQAVNGDKKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFS  95

Query  545  LY  550
            LY
Sbjct  96   LY  97



>gb|EMS51606.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=571

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  12   LPRSSTGTHRLASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  65

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            LTNLL+GG + +MP AEGAV+DLF RP+F+SLY
Sbjct  66   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLY  98



>ref|XP_003570274.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=569

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            +RCQS   D+ K K +L DNASN+LTNLL+GG + +MP AEGAV+DLF RP+F+SLY
Sbjct  40   VRCQSPGVDKTKPKRSLFDNASNVLTNLLAGGSLRNMPVAEGAVTDLFDRPLFYSLY  96



>gb|KEH27407.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=463

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = +2

Query  380  IRCQSTSTDERKTKM-----NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            IRCQ+ + D++K        N+ DNASNLLTNLLSGG +G+MP AEGAV+DLF RP+FFS
Sbjct  36   IRCQAVNGDKKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFS  95

Query  545  LY  550
            LY
Sbjct  96   LY  97



>gb|EPS66221.1| hypothetical protein M569_08554, partial [Genlisea aurea]
Length=394

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  RCQSTSTDERKTKMNLLDNASNLLTNLLSGGK-IGSMPTAEGAVSDLFGRPVFFSLY  550
            RC+ ++  E    M+L DNASNLLTNLLSGG+  G MPTAEGAVSDLFGRP+FF+LY
Sbjct  2    RCKLSTNAEDNKSMSLFDNASNLLTNLLSGGRRFGFMPTAEGAVSDLFGRPLFFALY  58



>ref|XP_001769554.1| predicted protein [Physcomitrella patens]
 gb|EDQ65715.1| predicted protein [Physcomitrella patens]
Length=586

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 10/96 (10%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSH-------GSSFKMK--PSGGCRIRCQSTSTDER-KTKMNLLDNA  442
            G  S+ ++ +G+R          G SF ++  PS       Q   TD + + +  LLDNA
Sbjct  11   GPASLMNQNSGSRRLSSSKSTILGHSFLLRHLPSKTRSRGIQCLKTDRKPENERTLLDNA  70

Query  443  SNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            SNLLTNLLSGG +G+MP AEGAVSDLFGRP+FF+LY
Sbjct  71   SNLLTNLLSGGNMGTMPIAEGAVSDLFGRPLFFALY  106



>gb|EMT03024.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=605

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            RCQ    D+  K K NL DNASNLLTNLL+G  + +MP AEGAV+DLF RP+F+SLY
Sbjct  23   RCQLPGVDKTTKPKRNLFDNASNLLTNLLAGSNLKNMPVAEGAVTDLFDRPLFYSLY  79



>gb|KHG14945.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=576

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQSTST E K K NLLDN SNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLY
Sbjct  46   IRCQSTSTKEPKAKRNLLDNLSNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLY  102



>ref|XP_002968239.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
 gb|EFJ30493.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
Length=563

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            K +   LDNASN LTN LSGG I +MP A+GA+SDLF RP+FF+LY
Sbjct  46   KPQRTFLDNASNALTNFLSGGGIQNMPVADGAISDLFSRPLFFALY  91



>ref|XP_002976141.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
 gb|EFJ23046.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
Length=541

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            K +   LDNASN LTN LSGG I +MP A+GA+SDLF RP+FF+LY
Sbjct  21   KPQRTFLDNASNALTNFLSGGGIQNMPVADGAISDLFSRPLFFALY  66



>gb|AFK42094.1| unknown [Medicago truncatula]
Length=84

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  549  YSEKKTGRPKRSETAPSAVGMDPIFPPLNRLVRRLLALSN  430
            YSEKK GR  +S TAPSA+G+ P  PPLN+ V+RLLALSN
Sbjct  27   YSEKKRGRSNKSVTAPSAIGIFPKLPPLNKFVKRLLALSN  66



>ref|XP_006833026.1| hypothetical protein AMTR_s00094p00103220, partial [Amborella 
trichopoda]
 gb|ERM98304.1| hypothetical protein AMTR_s00094p00103220, partial [Amborella 
trichopoda]
Length=70

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +2

Query  386  CQSTSTDERKTKMNLLDNASNLLTNLLS--GGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            C S+S      +  LLD AS++LTN+    G   G+MP A GA+SDL GRP+F SLY
Sbjct  1    CDSSSVKPLLLRTVLLDKASDILTNIYRDRGESYGTMPVARGALSDLVGRPLFLSLY  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720