BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012P04

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366693.1|  PREDICTED: receptor-like protein kinase HSL1...    133   4e-32   Solanum tuberosum [potatoes]
gb|KDP34178.1|  hypothetical protein JCGZ_07749                         119   3e-27   Jatropha curcas
ref|XP_009367420.1|  PREDICTED: receptor-like protein kinase HSL1       119   4e-27   Pyrus x bretschneideri [bai li]
gb|KHG24857.1|  Receptor-like protein kinase HSL1                       118   7e-27   Gossypium arboreum [tree cotton]
ref|XP_008220120.1|  PREDICTED: receptor-like protein kinase HSL1       117   2e-26   Prunus mume [ume]
ref|XP_009779466.1|  PREDICTED: receptor-like protein kinase HSL1       116   2e-26   Nicotiana sylvestris
gb|KJB54767.1|  hypothetical protein B456_009G048200                    115   8e-26   Gossypium raimondii
gb|KJB54766.1|  hypothetical protein B456_009G048200                    115   9e-26   Gossypium raimondii
gb|KDO79911.1|  hypothetical protein CISIN_1g001706mg                   114   1e-25   Citrus sinensis [apfelsine]
gb|KDO79910.1|  hypothetical protein CISIN_1g001706mg                   114   1e-25   Citrus sinensis [apfelsine]
ref|XP_004291157.1|  PREDICTED: receptor-like protein kinase 5          114   1e-25   Fragaria vesca subsp. vesca
ref|XP_006475995.1|  PREDICTED: receptor-like protein kinase HSL1...    114   1e-25   Citrus sinensis [apfelsine]
ref|XP_007012181.1|  Kinase family protein with leucine-rich repe...    114   2e-25   
ref|XP_010049140.1|  PREDICTED: receptor-like protein kinase HSL1       113   4e-25   Eucalyptus grandis [rose gum]
ref|XP_002516533.1|  serine-threonine protein kinase, plant-type,...    112   8e-25   Ricinus communis
ref|XP_010668729.1|  PREDICTED: receptor-like protein kinase HSL1       111   1e-24   
ref|XP_004148398.1|  PREDICTED: receptor-like protein kinase HSL1...    111   2e-24   
ref|XP_004164767.1|  PREDICTED: receptor-like protein kinase HSL1...    110   2e-24   
ref|XP_009587881.1|  PREDICTED: receptor-like protein kinase HSL1       110   2e-24   Nicotiana tomentosiformis
ref|XP_008444991.1|  PREDICTED: receptor-like protein kinase HSL1       110   4e-24   Cucumis melo [Oriental melon]
gb|EYU29298.1|  hypothetical protein MIMGU_mgv1a000685mg                110   5e-24   Erythranthe guttata [common monkey flower]
ref|XP_002280395.1|  PREDICTED: receptor-like protein kinase 5          109   8e-24   Vitis vinifera
ref|XP_011093340.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    108   1e-23   Sesamum indicum [beniseed]
ref|XP_010095459.1|  Receptor-like protein kinase HSL1                  107   3e-23   Morus notabilis
ref|XP_010536218.1|  PREDICTED: receptor-like protein kinase HSL1       107   4e-23   Tarenaya hassleriana [spider flower]
emb|CDY05509.1|  BnaA02g31820D                                          107   5e-23   
ref|XP_010668734.1|  PREDICTED: receptor-like protein kinase HSL1       106   8e-23   
ref|XP_004245143.1|  PREDICTED: receptor-like protein kinase HSL1       106   9e-23   Solanum lycopersicum
ref|XP_002872190.1|  leucine-rich repeat family protein                 106   1e-22   
ref|XP_010267130.1|  PREDICTED: receptor-like protein kinase HSL1       105   2e-22   Nelumbo nucifera [Indian lotus]
emb|CDY05337.1|  BnaC02g40450D                                          105   2e-22   
emb|CDP03253.1|  unnamed protein product                                104   3e-22   Coffea canephora [robusta coffee]
ref|XP_002278306.2|  PREDICTED: receptor-like protein kinase 5 is...    104   3e-22   Vitis vinifera
ref|XP_009350259.1|  PREDICTED: receptor-like protein kinase HSL1       104   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_010519875.1|  PREDICTED: receptor-like protein kinase 5          104   5e-22   Tarenaya hassleriana [spider flower]
emb|CDX80549.1|  BnaC07g28950D                                          100   1e-21   
emb|CDP08193.1|  unnamed protein product                                103   1e-21   Coffea canephora [robusta coffee]
ref|XP_009151498.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    2e-21   Brassica rapa
ref|NP_197965.1|  protein kinase family protein with leucine-rich...    102   2e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19649.1|  AT5G25930                                              102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081744.1|  PREDICTED: receptor-like protein kinase 5          102   2e-21   Sesamum indicum [beniseed]
emb|CDX80547.1|  BnaC07g28970D                                          102   2e-21   
gb|KFK26382.1|  hypothetical protein AALP_AA8G241000                    101   4e-21   Arabis alpina [alpine rockcress]
emb|CDX88207.1|  BnaA06g27980D                                        97.8    7e-21   
ref|XP_010519877.1|  PREDICTED: receptor-like protein kinase 5          100   1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010050470.1|  PREDICTED: receptor-like protein kinase HSL1     99.0    1e-20   Eucalyptus grandis [rose gum]
ref|XP_003603644.1|  Receptor-like protein kinase                       100   1e-20   Medicago truncatula
ref|XP_004501092.1|  PREDICTED: receptor-like protein kinase HSL1...  98.6    4e-20   
ref|XP_004501091.1|  PREDICTED: receptor-like protein kinase HSL1...  98.6    4e-20   
ref|XP_010910570.1|  PREDICTED: probable leucine-rich repeat rece...  95.9    5e-20   Elaeis guineensis
ref|XP_010421450.1|  PREDICTED: receptor-like protein kinase 5        97.8    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009151112.1|  PREDICTED: receptor-like protein kinase 5        97.8    7e-20   Brassica rapa
ref|XP_003533283.1|  PREDICTED: receptor-like protein kinase HSL1...  97.8    8e-20   Glycine max [soybeans]
ref|XP_009151111.1|  PREDICTED: receptor-like protein kinase 5        97.4    9e-20   Brassica rapa
ref|XP_010648290.1|  PREDICTED: receptor-like protein kinase 5 is...  97.4    1e-19   Vitis vinifera
emb|CBI20588.3|  unnamed protein product                              97.4    1e-19   Vitis vinifera
ref|XP_008778617.1|  PREDICTED: receptor-like protein kinase HSL1     93.6    1e-19   
ref|XP_002872187.1|  predicted protein                                93.6    1e-19   
emb|CDX80548.1|  BnaC07g28960D                                        96.3    2e-19   
ref|XP_011078243.1|  PREDICTED: receptor-like protein kinase HSL1     96.3    3e-19   Sesamum indicum [beniseed]
gb|AAO00824.1|  disease resistance protein - like                     94.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CBI27997.3|  unnamed protein product                              95.9    3e-19   Vitis vinifera
gb|KEH27214.1|  leucine-rich receptor-like kinase family protein      95.9    3e-19   Medicago truncatula
emb|CDX88206.1|  BnaA06g27970D                                        95.9    3e-19   
ref|XP_010493845.1|  PREDICTED: receptor-like protein kinase 5 is...  95.9    4e-19   Camelina sativa [gold-of-pleasure]
gb|KEH27213.1|  leucine-rich receptor-like kinase family protein      95.5    4e-19   Medicago truncatula
ref|XP_008780256.1|  PREDICTED: receptor-like protein kinase HSL1     91.7    6e-19   Phoenix dactylifera
gb|KHG19858.1|  Receptor-like protein kinase HSL1                     94.7    7e-19   Gossypium arboreum [tree cotton]
ref|NP_197963.1|  receptor like protein 52                            94.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010047668.1|  PREDICTED: receptor-like protein kinase 5        94.4    1e-18   Eucalyptus grandis [rose gum]
gb|KHG25031.1|  Receptor-like protein kinase HSL1                     94.0    2e-18   Gossypium arboreum [tree cotton]
ref|XP_010050465.1|  PREDICTED: receptor-like protein kinase 5        93.2    2e-18   
gb|KCW79613.1|  hypothetical protein EUGRSUZ_C00967                   93.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_006394841.1|  hypothetical protein EUTSA_v10003585mg           93.6    2e-18   Eutrema salsugineum [saltwater cress]
gb|KEH27215.1|  leucine-rich receptor-like kinase family protein      92.8    3e-18   Medicago truncatula
emb|CAN78716.1|  hypothetical protein VITISV_009349                   87.8    4e-18   Vitis vinifera
ref|XP_003549165.1|  PREDICTED: receptor-like protein kinase HSL1...  92.4    5e-18   Glycine max [soybeans]
ref|XP_010248386.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    5e-18   Nelumbo nucifera [Indian lotus]
gb|KCW79632.1|  hypothetical protein EUGRSUZ_C00991                   92.0    5e-18   Eucalyptus grandis [rose gum]
ref|XP_006475586.1|  PREDICTED: receptor-like protein kinase 5-like   92.4    5e-18   Citrus sinensis [apfelsine]
gb|KDO66581.1|  hypothetical protein CISIN_1g001778mg                 92.4    5e-18   Citrus sinensis [apfelsine]
ref|XP_006853705.1|  hypothetical protein AMTR_s00056p00147890        92.4    5e-18   
ref|XP_010047675.1|  PREDICTED: receptor-like protein kinase 5        92.0    5e-18   Eucalyptus grandis [rose gum]
ref|XP_003517639.1|  PREDICTED: receptor-like protein kinase HSL1...  92.4    6e-18   Glycine max [soybeans]
ref|XP_010047253.1|  PREDICTED: LRR receptor-like serine/threonin...  92.0    6e-18   Eucalyptus grandis [rose gum]
ref|XP_010454934.1|  PREDICTED: receptor-like protein kinase 5        92.0    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010249486.1|  PREDICTED: receptor-like protein kinase HSL1     92.0    7e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010050393.1|  PREDICTED: receptor-like protein kinase 5        90.9    8e-18   
emb|CDP03251.1|  unnamed protein product                              91.7    8e-18   Coffea canephora [robusta coffee]
ref|XP_010495505.1|  PREDICTED: receptor-like protein kinase HSL1     91.3    8e-18   
gb|KCW79121.1|  hypothetical protein EUGRSUZ_C00562                   91.7    8e-18   Eucalyptus grandis [rose gum]
ref|XP_006286443.1|  hypothetical protein CARUB_v10000221mg           91.7    9e-18   
emb|CAN69391.1|  hypothetical protein VITISV_000950                   91.7    1e-17   Vitis vinifera
ref|XP_010050386.1|  PREDICTED: receptor-like protein kinase 5        91.3    1e-17   Eucalyptus grandis [rose gum]
ref|XP_006286985.1|  hypothetical protein CARUB_v10000132mg           91.3    1e-17   Capsella rubella
ref|XP_009381187.1|  PREDICTED: receptor-like protein kinase HSL1     90.9    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324752.1|  leucine-rich repeat family protein               90.9    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007152512.1|  hypothetical protein PHAVU_004G136500g           90.9    2e-17   Phaseolus vulgaris [French bean]
ref|XP_010910207.1|  PREDICTED: receptor-like protein kinase HSL1     90.1    2e-17   
ref|XP_008377967.1|  PREDICTED: receptor-like protein kinase HSL1     90.5    2e-17   
gb|KCW47028.1|  hypothetical protein EUGRSUZ_K00835                   89.7    2e-17   Eucalyptus grandis [rose gum]
ref|XP_003527853.1|  PREDICTED: receptor-like protein kinase HSL1...  90.5    2e-17   Glycine max [soybeans]
gb|KEH27208.1|  LRR receptor-like kinase family protein               90.5    2e-17   Medicago truncatula
emb|CAN80774.1|  hypothetical protein VITISV_042330                   90.5    2e-17   Vitis vinifera
gb|KCW79122.1|  hypothetical protein EUGRSUZ_C00563                   90.5    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010648291.1|  PREDICTED: receptor-like protein kinase HSL1     90.5    3e-17   Vitis vinifera
ref|XP_007152971.1|  hypothetical protein PHAVU_004G175700g           90.5    3e-17   Phaseolus vulgaris [French bean]
ref|XP_010050476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  90.1    3e-17   
ref|XP_010050389.1|  PREDICTED: receptor-like protein kinase HSL1     90.1    3e-17   
ref|XP_003631769.1|  PREDICTED: receptor-like protein kinase HSL1     90.1    3e-17   Vitis vinifera
ref|XP_010095354.1|  LRR receptor-like serine/threonine-protein k...  89.7    3e-17   
ref|XP_009601880.1|  PREDICTED: receptor-like protein kinase 5        90.1    3e-17   Nicotiana tomentosiformis
ref|XP_002278223.1|  PREDICTED: receptor-like protein kinase HSL1     90.1    4e-17   Vitis vinifera
gb|KCW79630.1|  hypothetical protein EUGRSUZ_C00989                   89.7    4e-17   Eucalyptus grandis [rose gum]
ref|XP_003523755.1|  PREDICTED: receptor-like protein kinase HSL1...  89.7    4e-17   Glycine max [soybeans]
ref|XP_010047672.1|  PREDICTED: receptor-like protein kinase 5        89.7    4e-17   Eucalyptus grandis [rose gum]
ref|XP_010050474.1|  PREDICTED: receptor-like protein kinase 5        89.7    4e-17   
gb|KCW79622.1|  hypothetical protein EUGRSUZ_C00979                   89.7    5e-17   Eucalyptus grandis [rose gum]
emb|CBI20580.3|  unnamed protein product                              89.7    5e-17   Vitis vinifera
ref|XP_010050387.1|  PREDICTED: receptor-like protein kinase 5        89.4    5e-17   
ref|XP_010050472.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  89.4    5e-17   
ref|XP_010095355.1|  putative LRR receptor-like serine/threonine-...  88.6    5e-17   
ref|XP_008451149.1|  PREDICTED: receptor-like protein kinase HSL1     86.7    5e-17   Cucumis melo [Oriental melon]
gb|KJB07471.1|  hypothetical protein B456_001G026000                  89.0    7e-17   Gossypium raimondii
gb|KCW79617.1|  hypothetical protein EUGRSUZ_C009701                  86.3    7e-17   Eucalyptus grandis [rose gum]
ref|XP_010050478.1|  PREDICTED: receptor-like protein kinase 5        88.6    8e-17   Eucalyptus grandis [rose gum]
gb|KCW79123.1|  hypothetical protein EUGRSUZ_C00564                   88.6    9e-17   Eucalyptus grandis [rose gum]
ref|XP_007152972.1|  hypothetical protein PHAVU_004G175800g           89.0    9e-17   Phaseolus vulgaris [French bean]
ref|XP_011010886.1|  PREDICTED: receptor-like protein kinase HSL1...  88.6    1e-16   Populus euphratica
ref|XP_011010885.1|  PREDICTED: receptor-like protein kinase HSL1...  88.6    1e-16   Populus euphratica
ref|XP_002309529.2|  leucine-rich repeat family protein               88.6    1e-16   
ref|XP_004513049.1|  PREDICTED: receptor-like protein kinase HSL1...  88.6    1e-16   
ref|XP_006388198.1|  hypothetical protein POPTR_0290s00240g           87.8    1e-16   
ref|XP_010047671.1|  PREDICTED: receptor-like protein kinase 5        88.6    1e-16   Eucalyptus grandis [rose gum]
ref|XP_009795019.1|  PREDICTED: receptor-like protein kinase HSL1     88.2    1e-16   Nicotiana sylvestris
ref|XP_004951508.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       88.2    1e-16   
emb|CBI39978.3|  unnamed protein product                              88.2    1e-16   Vitis vinifera
emb|CAN76607.1|  hypothetical protein VITISV_030396                   88.2    1e-16   Vitis vinifera
ref|XP_010661160.1|  PREDICTED: receptor-like protein kinase HSL1     88.2    1e-16   Vitis vinifera
ref|XP_010050477.1|  PREDICTED: receptor-like protein kinase 5        87.8    2e-16   Eucalyptus grandis [rose gum]
ref|XP_009409608.1|  PREDICTED: receptor-like protein kinase HSL1     88.2    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH27211.1|  LRR receptor-like kinase family protein               87.8    2e-16   Medicago truncatula
emb|CDP08192.1|  unnamed protein product                              87.4    2e-16   Coffea canephora [robusta coffee]
ref|XP_011019562.1|  PREDICTED: receptor-like protein kinase HSL1     87.4    2e-16   Populus euphratica
ref|XP_006648474.1|  PREDICTED: receptor-like protein kinase HSL1...  87.4    2e-16   
ref|XP_010924441.1|  PREDICTED: receptor-like protein kinase 5        87.4    3e-16   
ref|XP_002278863.1|  PREDICTED: receptor-like protein kinase HSL1     87.0    3e-16   Vitis vinifera
ref|XP_010648289.1|  PREDICTED: receptor-like protein kinase HSL1     87.0    3e-16   
ref|XP_006596182.1|  PREDICTED: receptor-like protein kinase HSL1...  87.0    3e-16   
ref|XP_006853707.1|  hypothetical protein AMTR_s00056p00148740        87.0    4e-16   Amborella trichopoda
ref|XP_010047673.1|  PREDICTED: receptor-like protein kinase 5        87.0    4e-16   Eucalyptus grandis [rose gum]
ref|XP_006596181.1|  PREDICTED: receptor-like protein kinase HSL1...  86.7    4e-16   Glycine max [soybeans]
gb|KCW82572.1|  hypothetical protein EUGRSUZ_C03972                   84.7    6e-16   Eucalyptus grandis [rose gum]
ref|XP_010047669.1|  PREDICTED: receptor-like protein kinase 5        86.3    7e-16   Eucalyptus grandis [rose gum]
ref|XP_008450784.1|  PREDICTED: receptor-like protein kinase 5        86.3    7e-16   Cucumis melo [Oriental melon]
ref|XP_010911190.1|  PREDICTED: receptor-like protein kinase HSL1     85.1    7e-16   Elaeis guineensis
ref|XP_008337667.1|  PREDICTED: receptor-like protein kinase HSL1     85.9    7e-16   
ref|XP_010051649.1|  PREDICTED: receptor-like protein kinase HSL1     84.3    7e-16   
ref|XP_010106712.1|  Receptor-like protein kinase HSL1                85.9    8e-16   
dbj|BAD17641.1|  putative CLAVATA1 receptor kinase                    85.9    9e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AFW85121.1|  hypothetical protein ZEAMMB73_943636                  85.5    9e-16   
gb|KJB54274.1|  hypothetical protein B456_009G027700                  85.1    1e-15   Gossypium raimondii
dbj|BAD17639.1|  putative CLAVATA1 receptor kinase                    85.1    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KGN66179.1|  hypothetical protein Csa_1G574950                     82.8    2e-15   Cucumis sativus [cucumbers]
gb|EAZ22277.1|  hypothetical protein OsJ_05933                        85.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110882.1|  Receptor-like protein kinase HSL1                85.1    2e-15   
ref|XP_010050467.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    2e-15   Eucalyptus grandis [rose gum]
ref|XP_004513052.1|  PREDICTED: receptor-like protein kinase HSL1...  84.7    2e-15   Cicer arietinum [garbanzo]
ref|XP_008657242.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  84.7    2e-15   Zea mays [maize]
ref|XP_004513051.1|  PREDICTED: receptor-like protein kinase HSL1...  84.7    2e-15   Cicer arietinum [garbanzo]
ref|XP_009415190.1|  PREDICTED: receptor-like protein kinase HSL1     84.7    2e-15   
ref|XP_003516786.2|  PREDICTED: receptor-like protein kinase 5-like   84.3    3e-15   Glycine max [soybeans]
gb|KCW79615.1|  hypothetical protein EUGRSUZ_C009681                  82.8    3e-15   Eucalyptus grandis [rose gum]
ref|XP_010047254.1|  PREDICTED: receptor-like protein kinase 5        83.6    4e-15   Eucalyptus grandis [rose gum]
ref|XP_008795523.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    5e-15   Phoenix dactylifera
ref|XP_009628517.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    6e-15   Nicotiana tomentosiformis
ref|XP_009628514.1|  PREDICTED: receptor-like protein kinase 2 is...  83.2    6e-15   Nicotiana tomentosiformis
ref|XP_009628516.1|  PREDICTED: receptor-like protein kinase 2 is...  83.2    6e-15   Nicotiana tomentosiformis
ref|XP_008242543.1|  PREDICTED: receptor-like protein kinase HSL1     83.2    7e-15   
gb|KJB65638.1|  hypothetical protein B456_010G104300                  83.2    7e-15   Gossypium raimondii
ref|XP_007203859.1|  hypothetical protein PRUPE_ppa022167mg           83.2    7e-15   
ref|XP_008390812.1|  PREDICTED: receptor-like protein kinase HSL1     82.8    8e-15   
ref|XP_008789188.1|  PREDICTED: receptor-like protein kinase HSL1     82.8    9e-15   Phoenix dactylifera
ref|XP_008362962.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  82.8    1e-14   
ref|XP_004951399.1|  PREDICTED: receptor-like protein kinase HSL1...  82.8    1e-14   
ref|XP_009352556.1|  PREDICTED: receptor-like protein kinase HSL1     82.8    1e-14   Pyrus x bretschneideri [bai li]
dbj|BAJ98312.1|  predicted protein                                    82.4    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY85092.1|  hypothetical protein OsI_06444                        81.6    1e-14   Oryza sativa Indica Group [Indian rice]
gb|KHN24418.1|  Receptor-like protein kinase HSL1                     80.1    1e-14   Glycine soja [wild soybean]
ref|XP_003548595.1|  PREDICTED: receptor-like protein kinase 5-like   82.4    1e-14   Glycine max [soybeans]
gb|KHN16977.1|  Receptor-like protein kinase HSL1                     82.0    1e-14   Glycine soja [wild soybean]
ref|XP_007152973.1|  hypothetical protein PHAVU_004G175900g           82.0    1e-14   Phaseolus vulgaris [French bean]
emb|CBI20589.3|  unnamed protein product                              81.3    1e-14   Vitis vinifera
ref|XP_010050392.1|  PREDICTED: receptor-like protein kinase 5        82.0    2e-14   
gb|EAY85088.1|  hypothetical protein OsI_06443                        82.0    2e-14   Oryza sativa Indica Group [Indian rice]
emb|CDM84035.1|  unnamed protein product                              81.6    2e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007013027.1|  Kinase family protein with leucine-rich repe...  81.6    2e-14   
ref|XP_007013028.1|  Kinase family protein with leucine-rich repe...  81.6    2e-14   
ref|XP_010924676.1|  PREDICTED: receptor-like protein kinase 5        81.6    2e-14   Elaeis guineensis
dbj|BAD25862.1|  putative LRR receptor-like kinase                    81.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910700.1|  PREDICTED: receptor-like protein kinase HSL1...  81.3    3e-14   Elaeis guineensis
ref|XP_007137253.1|  hypothetical protein PHAVU_009G112200g           81.3    3e-14   Phaseolus vulgaris [French bean]
ref|XP_010910701.1|  PREDICTED: receptor-like protein kinase HSL1...  81.3    3e-14   Elaeis guineensis
ref|XP_010910702.1|  PREDICTED: receptor-like protein kinase HSL1...  81.3    3e-14   Elaeis guineensis
ref|XP_010050469.1|  PREDICTED: receptor-like protein kinase 5        80.9    4e-14   
ref|XP_010915378.1|  PREDICTED: receptor-like protein kinase HSL1     80.9    4e-14   Elaeis guineensis
ref|XP_004251639.1|  PREDICTED: receptor-like protein kinase 5        80.9    4e-14   Solanum lycopersicum
ref|XP_004969910.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    5e-14   Setaria italica
ref|XP_004135804.1|  PREDICTED: receptor-like protein kinase 5-like   80.5    6e-14   
ref|XP_004157305.1|  PREDICTED: receptor-like protein kinase 5-like   80.5    6e-14   
ref|XP_004969911.1|  PREDICTED: receptor-like protein kinase HSL1...  80.1    7e-14   
gb|EYU30701.1|  hypothetical protein MIMGU_mgv1a000689mg              80.1    7e-14   Erythranthe guttata [common monkey flower]
ref|XP_008242547.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    7e-14   
ref|XP_008794105.1|  PREDICTED: receptor-like protein kinase 5        80.1    8e-14   Phoenix dactylifera
ref|XP_008354538.1|  PREDICTED: receptor-like protein kinase HSL1     79.7    9e-14   
ref|XP_010925541.1|  PREDICTED: receptor-like protein kinase HSL1     79.7    9e-14   Elaeis guineensis
gb|KHN16979.1|  Receptor-like protein kinase HSL1                     79.3    1e-13   Glycine soja [wild soybean]
ref|XP_006599802.1|  PREDICTED: receptor-like protein kinase HSL1...  79.0    1e-13   
ref|XP_004512684.1|  PREDICTED: receptor-like protein kinase HSL1...  79.0    2e-13   Cicer arietinum [garbanzo]
ref|XP_002437153.1|  hypothetical protein SORBIDRAFT_10g022060        79.0    2e-13   Sorghum bicolor [broomcorn]
ref|XP_008659674.1|  PREDICTED: receptor-like protein kinase 5        79.0    2e-13   Zea mays [maize]
ref|XP_010915380.1|  PREDICTED: receptor-like protein kinase HSL1     78.6    2e-13   Elaeis guineensis
ref|XP_009415677.1|  PREDICTED: receptor-like protein kinase HSL1     78.6    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004971946.1|  PREDICTED: receptor-like protein kinase HSL1...  77.4    3e-13   Setaria italica
ref|XP_004513050.1|  PREDICTED: receptor-like protein kinase HSL1...  78.2    3e-13   
tpg|DAA57705.1|  TPA: putative leucine-rich repeat receptor-like ...  77.8    5e-13   
ref|XP_010669046.1|  PREDICTED: receptor-like protein kinase HSL1     77.4    5e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002456337.1|  hypothetical protein SORBIDRAFT_03g034220        77.0    7e-13   Sorghum bicolor [broomcorn]
ref|XP_007203052.1|  hypothetical protein PRUPE_ppa022950mg           76.6    8e-13   
ref|XP_009416472.1|  PREDICTED: receptor-like protein kinase HSL1     77.0    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008242544.1|  PREDICTED: receptor-like protein kinase HSL1     77.0    9e-13   
ref|XP_009803852.1|  PREDICTED: receptor-like protein kinase HSL1     76.3    1e-12   Nicotiana sylvestris
ref|XP_007013026.1|  Kinase family protein with leucine-rich repe...  76.3    1e-12   
gb|KGN66180.1|  hypothetical protein Csa_1G574960                     76.3    1e-12   Cucumis sativus [cucumbers]
emb|CDI66500.1|  putative hypothetical protein                        76.3    1e-12   Saccharum hybrid cultivar R570
emb|CDI66503.1|  putative hypothetical protein                        76.3    2e-12   Saccharum hybrid cultivar R570
gb|EMT32870.1|  Receptor-like protein kinase HSL1                     75.9    2e-12   
ref|XP_009415678.1|  PREDICTED: receptor-like protein kinase 5        75.9    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25886.1|  Receptor-like protein kinase HSL1                     75.1    2e-12   
ref|XP_008649140.1|  PREDICTED: receptor-like protein kinase 5        75.5    3e-12   Zea mays [maize]
ref|XP_009759980.1|  PREDICTED: receptor-like protein kinase 5        75.1    3e-12   Nicotiana sylvestris
ref|XP_006387571.1|  hypothetical protein POPTR_0830s00200g           74.7    3e-12   
ref|XP_007203222.1|  hypothetical protein PRUPE_ppa000737mg           75.1    4e-12   Prunus persica
gb|EMS68150.1|  Receptor-like protein kinase HSL1                     74.7    5e-12   Triticum urartu
ref|XP_007204807.1|  hypothetical protein PRUPE_ppa019571mg           74.3    6e-12   Prunus persica
ref|XP_006656162.1|  PREDICTED: receptor-like protein kinase 5-like   73.9    7e-12   Oryza brachyantha
gb|EMS60554.1|  Leucine-rich repeat receptor-like protein kinase ...  73.9    7e-12   Triticum urartu
ref|XP_004245388.2|  PREDICTED: receptor-like protein kinase 2        73.9    7e-12   Solanum lycopersicum
gb|ACR61377.1|  putative serine-threonine protein kinase              73.2    9e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002451877.1|  hypothetical protein SORBIDRAFT_04g009110        73.6    9e-12   
ref|XP_004288894.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-11   Fragaria vesca subsp. vesca
ref|XP_010245908.1|  PREDICTED: receptor-like protein kinase 2        73.2    1e-11   
ref|XP_011008121.1|  PREDICTED: receptor-like protein kinase 5        73.6    1e-11   Populus euphratica
ref|XP_011007100.1|  PREDICTED: receptor-like protein kinase HSL1     73.2    1e-11   Populus euphratica
ref|XP_006450731.1|  hypothetical protein CICLE_v10010761mg           73.2    1e-11   
ref|XP_003619786.1|  Receptor-like protein kinase                     73.2    1e-11   Medicago truncatula
ref|XP_008242546.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  73.2    1e-11   
ref|XP_009627680.1|  PREDICTED: receptor-like protein kinase 5        73.2    1e-11   Nicotiana tomentosiformis
ref|XP_011014419.1|  PREDICTED: receptor-like protein kinase 5        73.2    1e-11   Populus euphratica
ref|XP_009619690.1|  PREDICTED: receptor-like protein kinase 5 is...  73.2    1e-11   
ref|XP_004972171.1|  PREDICTED: receptor-like protein kinase HSL1...  72.8    2e-11   
ref|XP_011007101.1|  PREDICTED: receptor-like protein kinase 5        72.0    3e-11   Populus euphratica
ref|XP_002324453.1|  hypothetical protein POPTR_0018s09510g           72.0    3e-11   
emb|CDM84001.1|  unnamed protein product                              71.2    4e-11   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001044213.1|  Os01g0742400                                     71.6    4e-11   
gb|EAZ13493.1|  hypothetical protein OsJ_03409                        71.6    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD87899.1|  putative LRK1 protein                                71.6    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011007104.1|  PREDICTED: receptor-like protein kinase HSL1     71.6    5e-11   Populus euphratica
ref|XP_004965611.1|  PREDICTED: receptor-like protein kinase 5-like   71.2    5e-11   Setaria italica
gb|KDP33797.1|  hypothetical protein JCGZ_07368                       71.2    6e-11   Jatropha curcas
gb|EMT24435.1|  Receptor-like protein kinase HSL1                     71.2    6e-11   
gb|KDP33799.1|  hypothetical protein JCGZ_07370                       70.9    7e-11   Jatropha curcas
ref|NP_001046355.1|  Os02g0228300                                     70.9    8e-11   
ref|XP_010232300.1|  PREDICTED: receptor-like protein kinase 5        70.9    9e-11   Brachypodium distachyon [annual false brome]
ref|XP_004287478.1|  PREDICTED: receptor-like protein kinase HSL1     70.5    9e-11   Fragaria vesca subsp. vesca
gb|EAY85094.1|  hypothetical protein OsI_06446                        70.5    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004288893.1|  PREDICTED: receptor-like protein kinase HSL1     70.5    1e-10   Fragaria vesca subsp. vesca
ref|XP_010278042.1|  PREDICTED: receptor-like protein kinase 5        70.5    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006364731.1|  PREDICTED: leucine-rich repeat receptor-like...  70.1    1e-10   
ref|XP_006372068.1|  hypothetical protein POPTR_0018s09520g           70.1    1e-10   
ref|XP_002324456.2|  hypothetical protein POPTR_0018s09550g           70.1    1e-10   
gb|EAZ01332.1|  hypothetical protein OsI_23363                        70.1    1e-10   
gb|KHN16978.1|  Receptor-like protein kinase HSL1                     69.7    2e-10   
ref|XP_003548596.1|  PREDICTED: receptor-like protein kinase HSL1...  69.7    2e-10   
gb|EMT20975.1|  hypothetical protein F775_02159                       65.1    2e-10   
ref|XP_008344114.1|  PREDICTED: receptor-like protein kinase HSL1     69.3    2e-10   
ref|XP_004972048.1|  PREDICTED: probable leucine-rich repeat rece...  68.9    2e-10   
ref|XP_010234069.1|  PREDICTED: receptor-like protein kinase HSL1     69.3    3e-10   
ref|NP_001057862.1|  Os06g0557700                                     68.9    3e-10   
ref|XP_002453561.1|  hypothetical protein SORBIDRAFT_04g008110        69.3    3e-10   
gb|EAZ37346.1|  hypothetical protein OsJ_21685                        68.9    3e-10   
ref|XP_004954582.1|  PREDICTED: receptor-like protein kinase 5-like   68.9    3e-10   
ref|XP_003563758.1|  PREDICTED: receptor-like protein kinase 5        68.9    3e-10   
gb|EAZ01331.1|  hypothetical protein OsI_23362                        68.2    4e-10   
ref|XP_004288943.1|  PREDICTED: receptor-like protein kinase HSL1     68.6    4e-10   
ref|XP_010258419.1|  PREDICTED: probable LRR receptor-like serine...  68.6    5e-10   
gb|EMT08520.1|  Receptor-like protein kinase HSL1                     67.8    5e-10   
ref|XP_006644690.1|  PREDICTED: receptor-like protein kinase 5-like   68.6    5e-10   
ref|XP_006364730.1|  PREDICTED: probable LRR receptor-like serine...  68.2    5e-10   
ref|XP_006364729.1|  PREDICTED: receptor-like protein kinase 5-like   67.8    6e-10   
ref|XP_002453620.1|  hypothetical protein SORBIDRAFT_04g009100        67.8    9e-10   
ref|XP_002324455.2|  hypothetical protein POPTR_0018s09540g           67.4    9e-10   
gb|EAY75774.1|  hypothetical protein OsI_03690                        67.4    1e-09   
ref|XP_009405958.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  67.4    1e-09   
emb|CBI20587.3|  unnamed protein product                              67.0    1e-09   
gb|KDP33800.1|  hypothetical protein JCGZ_07371                       67.0    1e-09   
gb|EAY85085.1|  hypothetical protein OsI_06441                        67.0    1e-09   
dbj|BAG99480.1|  unnamed protein product                              64.3    2e-09   
dbj|BAJ93662.1|  predicted protein                                    66.2    2e-09   
gb|AAV44033.1|  putative protein kinase                               66.2    2e-09   
gb|EAY98740.1|  hypothetical protein OsI_20670                        66.2    2e-09   
ref|XP_004512685.1|  PREDICTED: receptor-like protein kinase HSL1...  65.9    3e-09   
ref|XP_010325071.1|  PREDICTED: LRR receptor-like serine/threonin...  65.5    3e-09   
ref|XP_004965613.1|  PREDICTED: receptor-like protein kinase 5-like   65.5    4e-09   
ref|XP_008679785.1|  PREDICTED: receptor-like protein kinase 5        65.1    6e-09   
ref|XP_002441406.1|  hypothetical protein SORBIDRAFT_09g026090        64.7    8e-09   
ref|XP_002442400.1|  hypothetical protein SORBIDRAFT_08g019450        63.9    8e-09   
gb|AFW71250.1|  putative leucine-rich repeat receptor-like protei...  64.7    8e-09   
ref|XP_008645622.1|  PREDICTED: receptor-like protein kinase HSL1     64.7    9e-09   
gb|EEE56599.1|  hypothetical protein OsJ_05961                        63.9    9e-09   
ref|NP_001057860.1|  Os06g0557400                                     63.9    1e-08   
gb|EMT27892.1|  Receptor-like protein kinase HSL1                     62.0    3e-08   
ref|XP_004245385.2|  PREDICTED: LRR receptor-like serine/threonin...  62.0    4e-08   
ref|XP_002970031.1|  hypothetical protein SELMODRAFT_171048           61.6    7e-08   
ref|XP_006364719.1|  PREDICTED: receptor-like protein kinase HSL1...  60.8    1e-07   
ref|XP_002467666.1|  hypothetical protein SORBIDRAFT_01g031930        59.3    2e-07   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390           60.5    2e-07   
ref|XP_008649910.1|  PREDICTED: receptor-like protein kinase HSL1     60.5    2e-07   
emb|CBI20583.3|  unnamed protein product                              58.9    2e-07   
ref|XP_009393854.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-07   
dbj|BAJ98791.1|  predicted protein                                    58.9    3e-07   
ref|XP_010486908.1|  PREDICTED: polygalacturonase inhibitor 1-like    58.9    3e-07   
ref|NP_001050442.2|  Os03g0436600                                     57.0    3e-07   
gb|EMS63417.1|  Receptor-like protein kinase 2                        59.3    3e-07   
dbj|GAB58367.1|  hypothetical protein RNAN_1339                       59.3    4e-07   
ref|XP_010248262.1|  PREDICTED: probable LRR receptor-like serine...  58.9    4e-07   
emb|CDY52623.1|  BnaCnng23020D                                        58.2    5e-07   
gb|ACX42230.1|  polygalacturonase inhibitory protein                  58.2    5e-07   
ref|XP_009120892.1|  PREDICTED: polygalacturonase inhibitor 1-like    58.2    5e-07   
ref|XP_003576419.1|  PREDICTED: receptor-like protein kinase HSL1     58.9    5e-07   
gb|KHD07206.1|  hypothetical protein OT06_36890                       57.8    6e-07   
gb|EAZ27444.1|  hypothetical protein OsJ_11393                        57.4    7e-07   
ref|NP_001151303.1|  polygalacturonase inhibitor 1 precursor          57.4    7e-07   
gb|AAU89181.1|  leucine rich repeat containing protein                57.4    8e-07   
ref|XP_008812474.1|  PREDICTED: probable inactive receptor kinase...  57.8    1e-06   
gb|AEP14546.1|  clavata 1-like protein                                57.8    1e-06   
ref|XP_009404418.1|  PREDICTED: receptor-like protein kinase HSL1     57.8    1e-06   
ref|XP_008390699.1|  PREDICTED: leucine-rich repeat receptor-like...  57.8    1e-06   
ref|XP_010498562.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  57.0    1e-06   
ref|XP_008390700.1|  PREDICTED: leucine-rich repeat receptor-like...  57.4    1e-06   
gb|EDN71345.1|  receptor protein kinase                               57.4    2e-06   
ref|XP_004508707.1|  PREDICTED: probable LRR receptor-like serine...  57.4    2e-06   
ref|XP_010910915.1|  PREDICTED: probable inactive receptor kinase...  57.0    2e-06   
ref|XP_003525458.1|  PREDICTED: probable LRR receptor-like serine...  56.6    3e-06   
gb|EEE56600.1|  hypothetical protein OsJ_05963                        56.2    3e-06   
ref|NP_001057858.1|  Os06g0557100                                     56.6    3e-06   
ref|XP_006342870.1|  PREDICTED: receptor-like protein kinase-like     56.2    3e-06   
gb|AEP14545.1|  clavata 1-like protein                                56.2    3e-06   
ref|XP_006298126.1|  hypothetical protein CARUB_v10014170mg           55.5    4e-06   
ref|XP_010464968.1|  PREDICTED: polygalacturonase inhibitor 1-like    55.5    4e-06   
ref|XP_008453230.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-06   
ref|XP_007155271.1|  hypothetical protein PHAVU_003G187200g           55.8    4e-06   
gb|EAY85084.1|  hypothetical protein OsI_06440                        55.8    5e-06   
gb|KDP31632.1|  hypothetical protein JCGZ_14857                       55.8    5e-06   
gb|EEC75549.1|  hypothetical protein OsI_12188                        54.3    5e-06   
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    6e-06   
ref|XP_003571136.1|  PREDICTED: receptor-like protein kinase 5        55.5    6e-06   
ref|XP_006442219.1|  hypothetical protein CICLE_v10018604mg           55.5    7e-06   
ref|WP_036146006.1|  hypothetical protein                             54.7    8e-06   
dbj|GAK59691.1|  receptor protein kinase                              55.1    8e-06   
gb|EMT02283.1|  Receptor-like protein kinase HSL1                     54.7    9e-06   
ref|XP_003550794.1|  PREDICTED: probable LRR receptor-like serine...  55.1    1e-05   
ref|XP_006478014.1|  PREDICTED: leucine-rich repeat receptor-like...  55.1    1e-05   
gb|KDO44090.1|  hypothetical protein CISIN_1g001274mg                 55.1    1e-05   
gb|KDP37356.1|  hypothetical protein JCGZ_06810                       54.7    1e-05   
ref|XP_010110900.1|  Receptor-like protein kinase                     54.7    1e-05   
gb|AAG51067.1|AC069472_7  unknown protein; 756-145                    53.1    1e-05   
ref|XP_006650240.1|  PREDICTED: polygalacturonase inhibitor-like      53.5    1e-05   
ref|XP_003566022.1|  PREDICTED: receptor-like protein kinase HSL1     54.3    2e-05   
ref|XP_001774832.1|  CLL3 clavata1-like receptor S/T protein kina...  54.3    2e-05   
ref|XP_008377011.1|  PREDICTED: leucine-rich repeat receptor prot...  53.9    2e-05   
gb|AAL15279.1|  At3g12148/T23B7.11                                    53.5    2e-05   
gb|EPS62114.1|  hypothetical protein M569_12677                       53.9    2e-05   
ref|NP_974291.4|  leucine-rich repeat protein FLOR1                   53.1    2e-05   
gb|KFK23621.1|  hypothetical protein AALP_AAs71127U000200             52.4    2e-05   
gb|AAF65195.1|AF136588_1  leucine-rich repeat protein FLR1            53.1    2e-05   
ref|XP_004162958.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_009804334.1|  PREDICTED: leucine-rich repeat receptor-like...  53.9    2e-05   
ref|XP_006477604.1|  PREDICTED: probable LRR receptor-like serine...  53.9    2e-05   
gb|KHD04122.1|  hypothetical protein OT06_56150                       52.8    3e-05   
gb|KDO54556.1|  hypothetical protein CISIN_1g001384mg                 53.5    3e-05   
ref|XP_009626861.1|  PREDICTED: leucine-rich repeat receptor-like...  53.5    3e-05   
gb|EAY85054.1|  hypothetical protein OsI_06413                        53.5    3e-05   
ref|XP_011464344.1|  PREDICTED: probable LRR receptor-like serine...  53.5    3e-05   
ref|XP_007027992.1|  Leucine-rich repeat protein kinase family pr...  53.1    3e-05   
ref|XP_002322457.1|  Leucine-rich repeat receptor protein kinase ...  53.1    4e-05   
emb|CDY42131.1|  BnaC05g40880D                                        52.8    4e-05   
ref|XP_004235511.1|  PREDICTED: receptor-like protein kinase          53.1    4e-05   
ref|XP_004137566.1|  PREDICTED: probable inactive receptor kinase...  52.8    4e-05   
gb|EMT14228.1|  Receptor-like protein kinase HSL1                     52.8    5e-05   
ref|XP_010926113.1|  PREDICTED: probable inactive receptor kinase...  52.8    5e-05   
gb|KFK38578.1|  hypothetical protein AALP_AA3G131900                  52.4    5e-05   
gb|KGN63945.1|  hypothetical protein Csa_1G031200                     52.8    5e-05   
ref|XP_008377334.1|  PREDICTED: leucine-rich repeat receptor prot...  52.8    5e-05   
ref|XP_004138308.1|  PREDICTED: probable LRR receptor-like serine...  52.8    5e-05   
ref|XP_004155058.1|  PREDICTED: probable LRR receptor-like serine...  52.8    5e-05   
ref|XP_004961447.1|  PREDICTED: receptor-like protein kinase HSL1...  52.8    6e-05   
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...  52.4    6e-05   
ref|XP_004309904.1|  PREDICTED: receptor-like protein kinase HSL1     52.4    6e-05   
ref|XP_004295705.1|  PREDICTED: leucine-rich repeat receptor-like...  52.4    6e-05   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                   52.4    6e-05   
gb|EMT30343.1|  Putative LRR receptor-like serine/threonine-prote...  52.4    7e-05   
ref|XP_006407361.1|  hypothetical protein EUTSA_v10021132mg           52.0    7e-05   
ref|XP_002964083.1|  hypothetical protein SELMODRAFT_81328            52.4    7e-05   
ref|XP_004978077.1|  PREDICTED: polygalacturonase inhibitor-like      51.6    8e-05   
ref|XP_002884889.1|  leucine-rich repeat protein FLR1                 51.6    8e-05   
ref|XP_003522531.1|  PREDICTED: probable LRR receptor-like serine...  52.0    8e-05   
ref|XP_010932563.1|  PREDICTED: probable inactive receptor kinase...  52.0    8e-05   
gb|EMT06260.1|  Putative LRR receptor-like serine/threonine-prote...  52.0    9e-05   
ref|XP_001761434.1|  predicted protein                                49.3    9e-05   
ref|XP_006643977.1|  PREDICTED: receptor-like protein kinase HSL1...  52.0    1e-04   
ref|XP_009338809.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
ref|XP_009371306.1|  PREDICTED: leucine-rich repeat receptor prot...  52.0    1e-04   
ref|XP_008351890.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-04   
gb|KGN63699.1|  hypothetical protein Csa_1G011510                     51.6    1e-04   
ref|XP_002449858.1|  hypothetical protein SORBIDRAFT_05g024520        51.6    1e-04   
ref|XP_011048672.1|  PREDICTED: leucine-rich repeat receptor prot...  51.6    1e-04   
ref|XP_002975437.1|  hypothetical protein SELMODRAFT_30410            51.6    1e-04   
ref|XP_011073043.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-04   
ref|XP_009393471.1|  PREDICTED: receptor-like protein kinase HAIKU2   51.6    1e-04   
ref|XP_010923809.1|  PREDICTED: leucine-rich repeat receptor-like...  51.6    1e-04   
ref|XP_010923813.1|  PREDICTED: leucine-rich repeat receptor-like...  51.6    1e-04   
gb|KFK23620.1|  hypothetical protein AALP_AAs71127U000100             51.2    1e-04   
ref|XP_010923807.1|  PREDICTED: leucine-rich repeat receptor-like...  51.6    1e-04   
ref|XP_010923812.1|  PREDICTED: leucine-rich repeat receptor-like...  51.6    1e-04   
gb|KEH31978.1|  LRR receptor-like kinase family protein               51.6    1e-04   
ref|XP_008795782.1|  PREDICTED: LRR receptor-like serine/threonin...  51.6    1e-04   
emb|CDM82685.1|  unnamed protein product                              51.2    1e-04   
ref|XP_011030198.1|  PREDICTED: leucine-rich repeat receptor prot...  51.2    2e-04   
ref|XP_011012372.1|  PREDICTED: leucine-rich repeat receptor prot...  51.2    2e-04   
emb|CDP14389.1|  unnamed protein product                              51.2    2e-04   
emb|CDP20688.1|  unnamed protein product                              50.8    2e-04   
ref|XP_002281604.2|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
ref|XP_004955463.1|  PREDICTED: leucine-rich repeat receptor-like...  51.2    2e-04   
ref|XP_007214953.1|  hypothetical protein PRUPE_ppa003172mg           50.8    2e-04   
ref|XP_002514220.1|  serine-threonine protein kinase, plant-type,...  50.8    2e-04   
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...  50.8    2e-04   
ref|XP_006350342.1|  PREDICTED: receptor-like protein kinase HAIK...  50.8    2e-04   
emb|CBI15175.3|  unnamed protein product                              50.8    2e-04   
dbj|BAK02124.1|  predicted protein                                    50.8    2e-04   
ref|XP_010547240.1|  PREDICTED: receptor-like protein kinase 5        50.8    2e-04   
ref|XP_008785692.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  50.8    2e-04   
gb|AAG52993.2|  receptor-like protein kinase INRPK1b                  48.9    2e-04   
ref|XP_006376307.1|  leucine-rich repeat family protein               50.8    2e-04   
ref|XP_009146637.1|  PREDICTED: polygalacturonase inhibitor 1-like    50.4    2e-04   
gb|KJB17092.1|  hypothetical protein B456_002G264500                  50.8    2e-04   
ref|XP_008775508.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  50.4    2e-04   
ref|XP_010036979.1|  PREDICTED: probable inactive receptor kinase...  50.4    2e-04   
ref|XP_008463987.1|  PREDICTED: receptor-like protein kinase          50.8    2e-04   
gb|EYU25075.1|  hypothetical protein MIMGU_mgv1a000313mg              50.8    3e-04   
dbj|BAJ88113.1|  predicted protein                                    50.4    3e-04   
emb|CDY08448.1|  BnaA05g26840D                                        50.1    3e-04   
ref|XP_002318234.1|  Leucine-rich repeat receptor protein kinase ...  50.4    3e-04   
ref|XP_010045594.1|  PREDICTED: probable LRR receptor-like serine...  50.4    3e-04   
ref|XP_010110899.1|  Receptor-like protein kinase                     48.5    3e-04   
ref|XP_011462297.1|  PREDICTED: probable LRR receptor-like serine...  50.4    3e-04   
ref|XP_004297843.2|  PREDICTED: probable LRR receptor-like serine...  50.4    3e-04   
ref|XP_002512766.1|  Leucine-rich repeat receptor protein kinase ...  50.1    3e-04   
emb|CDP17990.1|  unnamed protein product                              49.7    3e-04   
ref|XP_007149249.1|  hypothetical protein PHAVU_005G054300g           50.1    3e-04   
ref|XP_007162306.1|  hypothetical protein PHAVU_001G140900g           50.1    3e-04   
ref|XP_002987123.1|  hypothetical protein SELMODRAFT_269219           50.1    4e-04   
gb|KHD04169.1|  hypothetical protein OT06_55860                       49.3    4e-04   
emb|CDY42130.1|  BnaC05g40890D                                        49.7    4e-04   
ref|WP_040578810.1|  hypothetical protein                             48.9    4e-04   
ref|XP_008812470.1|  PREDICTED: probable receptor protein kinase ...  50.1    4e-04   
ref|XP_011038146.1|  PREDICTED: leucine-rich repeat receptor-like...  50.1    4e-04   
ref|XP_010069429.1|  PREDICTED: probable inactive receptor kinase...  49.7    4e-04   
gb|KDP22307.1|  hypothetical protein JCGZ_26138                       50.1    4e-04   
ref|XP_004497928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  49.7    4e-04   
gb|EMS64651.1|  Receptor-like protein kinase HSL1                     49.7    5e-04   
emb|CDX88495.1|  BnaC06g39390D                                        49.7    5e-04   
ref|XP_006855397.1|  hypothetical protein AMTR_s00057p00145210        49.7    5e-04   
ref|XP_010245135.1|  PREDICTED: leucine-rich repeat receptor-like...  49.7    5e-04   
ref|XP_010486907.1|  PREDICTED: polygalacturonase inhibitor-like      48.5    5e-04   
ref|XP_007226293.1|  hypothetical protein PRUPE_ppa020377mg           49.7    5e-04   
ref|XP_009377697.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    5e-04   
gb|AFJ42363.1|  floral organ regulator 1                              49.3    5e-04   
ref|XP_010236758.1|  PREDICTED: polygalacturonase inhibitor 1-like    49.3    5e-04   
emb|CDX87418.1|  BnaA07g34550D                                        49.7    5e-04   
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5  49.7    5e-04   
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg           49.7    5e-04   
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    5e-04   
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    5e-04   
ref|XP_009596210.1|  PREDICTED: receptor-like protein kinase isof...  49.7    6e-04   
ref|XP_011466379.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    6e-04   
ref|XP_009596212.1|  PREDICTED: receptor-like protein kinase isof...  49.7    6e-04   
ref|XP_006443295.1|  hypothetical protein CICLE_v10018603mg           49.7    6e-04   
gb|KDO52509.1|  hypothetical protein CISIN_1g001253mg                 49.7    6e-04   
ref|XP_003563383.1|  PREDICTED: putative receptor-like protein ki...  49.3    6e-04   



>ref|XP_006366693.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=1032

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVT-DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            V SQSP T +RD LL++KR+WGNP +L+ WN+TSSPCSWPEIEC  G VTGI ++E DI 
Sbjct  30   VTSQSPATTERDTLLKIKRQWGNPLALDSWNSTSSPCSWPEIECDDGKVTGIIIQEKDIT  89

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             EIP++IC LKNLT L+L LNY+P  FPT LY CS
Sbjct  90   VEIPSSICELKNLTFLNLRLNYLPGKFPTFLYKCS  124



>gb|KDP34178.1| hypothetical protein JCGZ_07749 [Jatropha curcas]
Length=1026

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+  T++ ILL+++R  GNPP LE WN++S PC+W  ++C G +VTG+ L + +I  
Sbjct  27   VISQNANTEQTILLKLRRELGNPPLLESWNSSSPPCNWKGVQCIGNTVTGLVLSDVNITV  86

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IPA IC LKNL +LDLSLNYIP  FPT LYNCSK
Sbjct  87   TIPATICDLKNLISLDLSLNYIPGTFPTVLYNCSK  121



>ref|XP_009367420.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1021

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQS  TD+ ILL++K +WGNPPS++ WN +SSPC WPE+ C+ G+VTG+ L+  +I  
Sbjct  26   VISQS--TDQSILLKLKAQWGNPPSIQSWNPSSSPCDWPEVNCTNGAVTGLSLRNMNITK  83

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             IPA +C L +LT LDLS NYIP  FP+ LYNCS
Sbjct  84   RIPATLCELLSLTELDLSWNYIPGGFPSFLYNCS  117



>gb|KHG24857.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1012

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ    +RD+LL  K+R GNPP L+ WN++SSPC WPEI C+  SVT + L + +I +
Sbjct  20   VISQDINAERDVLLNFKQRLGNPPFLQSWNSSSSPCDWPEINCTANSVTEVHLHDKNITT  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP+ IC LKNLT LDL+ NYIP  FP  LYNCSK
Sbjct  80   PIPSTICDLKNLTLLDLAFNYIPGEFP-ALYNCSK  113



>ref|XP_008220120.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1022

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQS  T++ ILL++K +WGNPPS+  WN++S PC WPE+ C+ G+VTGIFL + +I  
Sbjct  28   VISQS--TEQSILLKLKDQWGNPPSIHSWNSSSLPCDWPEVNCTNGAVTGIFLSQKNITE  85

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IP  +C L +L  LDL+ N+IP  FP  LYNCSK
Sbjct  86   KIPETVCYLSSLAELDLAWNFIPGEFPDSLYNCSK  120



>ref|XP_009779466.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1019

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +3

Query  276  VISQSPVT--DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYD  446
            V SQSP T  +RDILL++KR+WGNP SL  WN+TSSPC WPEIECS  G VTGI L+E D
Sbjct  18   VNSQSPATTNERDILLKIKRQWGNPLSLSSWNSTSSPCDWPEIECSDDGEVTGIILQEKD  77

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            I  EIP++IC LKNLT L+L+LNY+P  FPT LYNCS
Sbjct  78   ITVEIPSSICDLKNLTFLNLALNYLPGKFPTFLYNCS  114



>gb|KJB54767.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=975

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            V SQ    +RD+LL  K++ GNPP L+ WN++SSPC WPEI C+  SVT + L++ +I +
Sbjct  20   VTSQDINAERDVLLNFKQQLGNPPFLQSWNSSSSPCDWPEINCTANSVTEVHLRDKNITT  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP+ IC LKNLT LDL+ NYIP  FP  LYNCSK
Sbjct  80   PIPSTICDLKNLTFLDLAFNYIPGEFP-ALYNCSK  113



>gb|KJB54766.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=1012

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            V SQ    +RD+LL  K++ GNPP L+ WN++SSPC WPEI C+  SVT + L++ +I +
Sbjct  20   VTSQDINAERDVLLNFKQQLGNPPFLQSWNSSSSPCDWPEINCTANSVTEVHLRDKNITT  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP+ IC LKNLT LDL+ NYIP  FP  LYNCSK
Sbjct  80   PIPSTICDLKNLTFLDLAFNYIPGEFP-ALYNCSK  113



>gb|KDO79911.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=969

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTD-RDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VI QSP T+ R ILL +K++ GNPPSL+ W +TSSPC WPEI C+  SVTGI L+  DI 
Sbjct  27   VIPQSPNTEERTILLNLKQQLGNPPSLQSWTSTSSPCDWPEITCTFNSVTGISLRHKDIT  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +IP  IC LKNLT +DLS N IP  FP  LYNC+K
Sbjct  87   QKIPPIICDLKNLTTIDLSSNSIPGEFPEFLYNCTK  122



>gb|KDO79910.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=1024

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTD-RDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VI QSP T+ R ILL +K++ GNPPSL+ W +TSSPC WPEI C+  SVTGI L+  DI 
Sbjct  27   VIPQSPNTEERTILLNLKQQLGNPPSLQSWTSTSSPCDWPEITCTFNSVTGISLRHKDIT  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +IP  IC LKNLT +DLS N IP  FP  LYNC+K
Sbjct  87   QKIPPIICDLKNLTTIDLSSNSIPGEFPEFLYNCTK  122



>ref|XP_004291157.1| PREDICTED: receptor-like protein kinase 5 [Fragaria vesca subsp. 
vesca]
Length=1020

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQS  +DR ILL++K+ WG+PPS++ WN++SSPC WPEI C+ G+VTG+ L E +I  
Sbjct  20   VISQSTDSDRSILLKLKQEWGDPPSIQSWNSSSSPCDWPEISCTAGAVTGLLLGEKNITE  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            EIPA IC L+NLT L+LS NYIP  FP  LYNC K
Sbjct  80   EIPATICDLRNLTVLNLSWNYIPGEFPVVLYNCFK  114



>ref|XP_006475995.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=1024

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTD-RDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VI QSP T+ R ILL +K++ GNPPSL+ W +TSSPC WPEI C+  SVTGI L+  DI 
Sbjct  27   VIPQSPNTEERTILLNLKQQLGNPPSLQSWTSTSSPCDWPEITCTFNSVTGISLRHKDIT  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +IP  IC LKNLT +DLS N IP  FP  LYNC+K
Sbjct  87   QKIPPIICDLKNLTTIDLSSNSIPGEFPEFLYNCTK  122



>ref|XP_007012181.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY29800.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1017

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ   T+R +LL +KR+ GNPPSL  WN++SSPC W EI C+  SVT + L++  I  
Sbjct  20   VISQDINTERTVLLNLKRQLGNPPSLGHWNSSSSPCDWQEIGCTNNSVTAVILRKIPITV  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  IC LKNL  LDLS N IP  FPT LYNCSK
Sbjct  80   RIPPTICDLKNLIGLDLSFNMIPGEFPTTLYNCSK  114



>ref|XP_010049140.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=1023

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +3

Query  276  VISQSPVT-DRDILLEVKRRWGNPPSLEGWNATS-SPCSWPEIECSGGSVTGIFLKEYDI  449
            VISQS  T +  +LL +K++W NP +L+ WN++S +PC WP++ C+ G+VTG+ L + +I
Sbjct  26   VISQSQATSELTVLLNLKQQWSNPRALQSWNSSSPTPCGWPKVNCTSGTVTGLLLHDMNI  85

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP +IC LKNLT LDLSLNYIP  FP  LYNCSK
Sbjct  86   TEPIPPSICDLKNLTQLDLSLNYIPGGFPKALYNCSK  122



>ref|XP_002516533.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45874.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1026

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  276  VISQ-SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYDI  449
            VISQ +   ++ ILL +K++ GNPPSL+ W  ++SPC+WPEI CS  GSVT + L++ +I
Sbjct  27   VISQITNTQEQSILLNIKQQLGNPPSLQSWTTSTSPCTWPEISCSDDGSVTALGLRDKNI  86

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
               IPA IC LKNLT LDL+ NYIP  FPT LYNCS
Sbjct  87   TVAIPARICDLKNLTVLDLAYNYIPGGFPTFLYNCS  122



>ref|XP_010668729.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=1026

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGG-SVTGIFLKEYDIV  452
            VISQS  +D+DILL+VK +WGN P ++ W+AT+  CSW  I C+GG +VTGI     +I 
Sbjct  27   VISQSLSSDQDILLKVKEQWGNQPPMDSWSATTPVCSWTGINCTGGETVTGISFNSQNIG  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             EIP +IC LKNLT LDL  N IP NFPT LYNC+K
Sbjct  87   GEIPPSICELKNLTILDLGNNSIPGNFPTFLYNCTK  122



>ref|XP_004148398.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN62796.1| hypothetical protein Csa_2G373400 [Cucumis sativus]
Length=1090

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEI  461
            SQ+   D+ ILL++K +WGNPPSL  WNA+S PC WPEI C   +V GI L+   I  ++
Sbjct  115  SQTVNVDQAILLDLKEQWGNPPSLWLWNASSLPCDWPEIICRDSTVIGISLRNKTITGKV  174

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            P  IC L+NLT LDLS NYIP  FP  LYNCSK
Sbjct  175  PTVICNLQNLTVLDLSWNYIPGEFPEVLYNCSK  207



>ref|XP_004164767.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
Length=1004

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEI  461
            SQ+   D+ ILL++K +WGNPPSL  WNA+S PC WPEI C   +V GI L+   I  ++
Sbjct  29   SQTVNVDQAILLDLKEQWGNPPSLWLWNASSLPCDWPEIICRDSTVIGISLRNKTITGKV  88

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            P  IC L+NLT LDLS NYIP  FP  LYNCSK
Sbjct  89   PTVICNLQNLTVLDLSWNYIPGEFPEVLYNCSK  121



>ref|XP_009587881.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=1026

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = +3

Query  276  VISQSPVT--DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYD  446
            V SQSP T  + DILL++KR+WG+P SL  WN+TSSPC WPEIECS  G VTGI L+E D
Sbjct  25   VNSQSPATTNESDILLKIKRQWGDPLSLSSWNSTSSPCDWPEIECSDDGKVTGIILQEKD  84

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            I  EIP++IC LKNLT L+L+LN++P  FPT LYNCS
Sbjct  85   ITVEIPSSICDLKNLTFLNLALNFLPGKFPTLLYNCS  121



>ref|XP_008444991.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
 ref|XP_008444992.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=1003

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query  282  SQSPV-TDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSE  458
            S  PV  D+ ILL++K +WGNP SL  WNA+S PC WPEI C  G+V GI L+  +I  +
Sbjct  27   SSQPVNVDQAILLDLKEQWGNPSSLWLWNASSLPCDWPEIICRDGTVIGISLRNKNITGK  86

Query  459  IPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +P  IC L+NLT LDLS NYIP  FP  LYNCSK
Sbjct  87   VPTVICNLQNLTVLDLSWNYIPGEFPEVLYNCSK  120



>gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Erythranthe guttata]
Length=1018

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYDIV  452
            V SQ    +R  LL +K+ W +PP+L+ WNATSSPC WPEI+CSG GSVTGIFLK  ++ 
Sbjct  27   VNSQFSPAERATLLNLKQVWDDPPALDSWNATSSPCDWPEIQCSGEGSVTGIFLKNCNLS  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              I  +I  L NLT LDLS N+ P NFPT + NCS
Sbjct  87   GSITDSISALANLTVLDLSYNFFPGNFPTAILNCS  121



>ref|XP_002280395.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
Length=1021

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECS-GGSVTGIFLKEYDIVS  455
            SQ+   +  ILL++K+ W NPP+++ W ++ SS C+WPEIEC+  GSVTGI L   +I +
Sbjct  29   SQASDQELSILLKLKQHWHNPPAIDHWTSSNSSYCTWPEIECAEDGSVTGISLVNINITN  88

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            EIP  IC LKN+T +DL LNYIP  FPTGLYNC+K
Sbjct  89   EIPPFICDLKNITTIDLQLNYIPGGFPTGLYNCTK  123



>ref|XP_011093340.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Sesamum indicum]
Length=1025

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYDIV  452
            V SQ    +R  LL +K+ WGNPP L+ WNATSSPC WPEI+CS  G VTGI LK Y++ 
Sbjct  27   VNSQFSPAERATLLSLKQEWGNPPVLDSWNATSSPCHWPEIQCSADGFVTGILLKNYNLN  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              IP +I  L+NLT LDL+ N    NFP  + NCSK
Sbjct  87   GSIPDSISTLENLTVLDLAFNLFAGNFPIAVLNCSK  122



>ref|XP_010095459.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXB60285.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1032

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECS--GGSVTGIFLKEYDI  449
            VISQS  T+R ILL+++++WGNPPSL  WN++S PC WPEI+CS  G  VTG+ L+E DI
Sbjct  27   VISQSLDTERSILLKLRQQWGNPPSLSSWNSSSLPCDWPEIQCSDDGTVVTGVLLREKDI  86

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +IPA IC LKNLT+LDL+LNY+P +FP  LYNCS+
Sbjct  87   TEKIPATICDLKNLTSLDLALNYVPGDFPKVLYNCSE  123



>ref|XP_010536218.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=1014

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL ++   G+PPSL  W   SSPC WPEIECSGG+VTGI    ++  
Sbjct  23   SVISQ--LDERSTLLRLQLELGDPPSLSSWGNKSSPCDWPEIECSGGNVTGISFYNFNFT  80

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P +IC   NL +LDLS NY P  FPT LYNCSK
Sbjct  81   VPVPGSICDFPNLRSLDLSFNYFPGQFPTVLYNCSK  116



>emb|CDY05509.1| BnaA02g31820D [Brassica napus]
Length=966

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ  + +R  LL +K   G+PPSL  WNATSSPC WP+I C+ G VTGI  K  +   
Sbjct  18   VISQ--LDERSTLLNLKSLLGHPPSLRLWNATSSPCHWPKITCAAGKVTGINFKNQNFTV  75

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +PA+IC   NL  LDLS NY P  FPT LYNC+K
Sbjct  76   AVPASICDFPNLDFLDLSYNYFPGEFPTALYNCTK  110



>ref|XP_010668734.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=1023

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGG-SVTGIFLKEYDIV  452
            VISQS  +D+DILL + ++WGNP  ++ WN+T   C WP I C+ G SVTGI L   +I 
Sbjct  27   VISQSHSSDQDILLNIAQQWGNPLPMQSWNSTIPVCVWPGINCTDGESVTGISLNSQNID  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              IPA+IC LKNLT LDL  N I  NFPT LYNC+K
Sbjct  87   GAIPASICDLKNLTLLDLGNNSITGNFPTFLYNCTK  122



>ref|XP_004245143.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=1043

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +3

Query  297  TDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            T+RD LL++KR+WGNP +L+ WN+TSSPCSWPEIEC  G VTGI L+E DI  EIP +IC
Sbjct  49   TERDTLLKIKRQWGNPSALDSWNSTSSPCSWPEIECDDGKVTGIILQEKDITVEIPTSIC  108

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT L+L LNY+P  FPT LY CS
Sbjct  109  ELKNLTLLNLRLNYLPGEFPTFLYKCS  135



>ref|XP_002872190.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48449.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1005

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +V SQS   D+  LL VKR  G+PPSL+ WN TSSPC+W EI C+ G+VTGI  K  +  
Sbjct  19   SVFSQS--NDQSTLLNVKRDLGDPPSLQLWNNTSSPCNWSEITCTAGNVTGINFKNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  IC L NL  LDLS NY    FPT LYNC+K
Sbjct  77   GTVPTTICDLSNLNFLDLSFNYFAGEFPTVLYNCTK  112



>ref|XP_010267130.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1045

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEI  461
            SQS + +  ILL++K+ WG+ P +  WN++ SPC+W  I C  GSVT I     +I  +I
Sbjct  47   SQSGIDELSILLKLKQHWGDQPPMNSWNSSLSPCNWTGISCVHGSVTKISFYNQNITGKI  106

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            P  ICGL NLT LDLS NYIP  FPT LYNCSK
Sbjct  107  PPAICGLNNLTYLDLSYNYIPGEFPTLLYNCSK  139



>emb|CDY05337.1| BnaC02g40450D [Brassica napus]
Length=972

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
             VISQ  + +R  LL +K   G+PPSL  WNATSSPC WP+I C+ G VTGI  K  +  
Sbjct  17   TVISQ--LDERSTLLNLKSLLGHPPSLRLWNATSSPCHWPKITCAAGKVTGINFKNQNFT  74

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P +IC   NL  LDLS NY P +FPT LYNC+K
Sbjct  75   VAVPTSICDFPNLNFLDLSYNYFPGDFPTTLYNCTK  110



>emb|CDP03253.1| unnamed protein product [Coffea canephora]
Length=934

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            ++ ILL++K++W NPPSL  W ++S  C+WPEI C+GGSVT + +    I   IP+ IC 
Sbjct  38   EQTILLKLKQQWLNPPSLSHWTSSSDHCTWPEINCTGGSVTELNVSNLAITETIPSFICD  97

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            LKNLT LDL  N+IP +FPT LYNCSK
Sbjct  98   LKNLTVLDLKNNFIPGSFPTVLYNCSK  124



>ref|XP_002278306.2| PREDICTED: receptor-like protein kinase 5 isoform X1 [Vitis vinifera]
Length=1021

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++S PC WPEI C+  +VT I L    I  
Sbjct  27   VISQNLDDERSILLDVKQQLGNPPSLQSWNSSSLPCDWPEITCTDNTVTAISLHNKTIRE  86

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LDLS NYI   FP  + NCSK
Sbjct  87   KIPATICDLKNLIVLDLSNNYIVGEFP-DILNCSK  120



>ref|XP_009350259.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1017

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQS  T++ ILL +K +WGNPP ++ WN++SSPC WP I C+ G VTG+ L + +I  
Sbjct  23   VISQS--TEQSILLRIKAQWGNPPFIQSWNSSSSPCDWPGINCTNGMVTGLSLPDVNITE  80

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             IP  IC L  L  L L+ NYIP  FP  LYNCS
Sbjct  81   RIPEAICELPRLAELHLAWNYIPGEFPKFLYNCS  114



>ref|XP_010519875.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=1009

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ    +R +LL +KR  G+PPS+  W+  SSPC+WPEI CS G+VTGI     +  
Sbjct  23   SVISQ--FDERSLLLRLKRELGDPPSIRSWDDRSSPCNWPEIHCSDGNVTGISFYNLNFT  80

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P +IC   NL +LDLS NY P  FPT LYNC+K
Sbjct  81   VPVPVSICDFPNLRSLDLSYNYFPGEFPTVLYNCTK  116



>emb|CDX80549.1| BnaC07g28950D [Brassica napus]
Length=349

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TS+PC W EI C  G+VTGI LK   I 
Sbjct  19   SVISQ--LDERSTLLTLKRGLGDPPSLRLWNTTSTPCDWSEITCVSGNVTGISLKNKIIT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC   NL  LDLS N    +FPT LYNC+K
Sbjct  77   ATVPTNICDFPNLETLDLSSNRFSGDFPTVLYNCTK  112



>emb|CDP08193.1| unnamed protein product [Coffea canephora]
Length=984

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECS-GGSVTGIFLKEYDIV  452
            V SQ+ VT+R ILL +K +WGNP +L+ WN+TSSPCSW EI CS GG+VTGI L +  I 
Sbjct  27   VNSQASVTERSILLNLKEKWGNPGALQSWNSTSSPCSWREINCSGGGTVTGIHLSDKSIS  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYN  551
              IP  IC LKNLT++ L+ N+I   FPT   N
Sbjct  87   GAIPDFICNLKNLTSIALANNFIFQTFPTSFGN  119



>ref|XP_009151498.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Brassica rapa]
Length=317

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TSSPC W EI C  G+VTGI LK   I 
Sbjct  19   SVISQ--LDERSTLLTLKRGLGDPPSLRLWNTTSSPCDWSEITCFAGNVTGISLKNKIIT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P N C   NL  LDLS N    +FPT LYNC+K
Sbjct  77   ATVPTNTCDFPNLETLDLSSNRFSGDFPTVLYNCTK  112



>ref|NP_197965.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
 gb|AAD40144.1|AF149413_25 contains similarity to protein kinase domains (Pfam F00069, Score=162.6, 
E=6.8e-45, N=1) and leucien rich repeats (Pfam PF00560, 
Score=210.7, E=2.2e-59, N=10) [Arabidopsis thaliana]
 gb|AAO42089.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59374.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED93502.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
Length=1005

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S   D+  LL +KR  G+PPSL  WN TSSPC+W EI C+ G+VTGI  K  +    +P 
Sbjct  22   SQFNDQSTLLNLKRDLGDPPSLRLWNNTSSPCNWSEITCTAGNVTGINFKNQNFTGTVPT  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC L NL  LDLS NY    FPT LYNC+K
Sbjct  82   TICDLSNLNFLDLSFNYFAGEFPTVLYNCTK  112



>dbj|BAH19649.1| AT5G25930 [Arabidopsis thaliana]
Length=835

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S   D+  LL +KR  G+PPSL  WN TSSPC+W EI C+ G+VTGI  K  +    +P 
Sbjct  22   SQFNDQSTLLNLKRDLGDPPSLRLWNNTSSPCNWSEITCTAGNVTGINFKNQNFTGTVPT  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC L NL  LDLS NY    FPT LYNC+K
Sbjct  82   TICDLSNLNFLDLSFNYFAGEFPTVLYNCTK  112



>ref|XP_011081744.1| PREDICTED: receptor-like protein kinase 5 [Sesamum indicum]
Length=730

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +3

Query  297  TDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +++ ILL  K+ WG+PPSL+ WN+TSSPC WPEIEC  G+VT + L   D+   IP+ IC
Sbjct  27   SEQTILLSFKQHWGSPPSLDSWNSTSSPCDWPEIECISGTVTALHLSGKDLSGTIPSTIC  86

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNL +++L  N I  + P  LYNCS
Sbjct  87   QLKNLVSINLFDNNISGDVPAALYNCS  113



>emb|CDX80547.1| BnaC07g28970D [Brassica napus]
Length=902

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TSSPC W EI C  G+VTGI  K  +  
Sbjct  19   SVISQ--LNERSTLLTLKRDLGDPPSLRLWNTTSSPCDWSEITCVAGNVTGISFKNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC   NL  LDLS N +P +FPT LYNC+K
Sbjct  77   A-VPTNICDFPNLETLDLSFNLLPGDFPTVLYNCTK  111



>gb|KFK26382.1| hypothetical protein AALP_AA8G241000 [Arabis alpina]
Length=1011

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQS   +R  LL +KR +G+PPSL  WN TSSPC W EI C  G++T I     +   
Sbjct  24   VISQS--NERSTLLNLKRVFGDPPSLHLWNDTSSPCDWSEITCVSGNITEINFNNQNFTV  81

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            E+P  IC   NL +LDLS NY P  FPT LYNC+K
Sbjct  82   ELPTTICDFPNLESLDLSYNYFPGEFPTVLYNCTK  116



>emb|CDX88207.1| BnaA06g27980D [Brassica napus]
Length=348

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TSSPC W EI C  G+VTGI LK   I 
Sbjct  19   SVISQ--LDERSTLLTLKRGLGDPPSLRLWNTTSSPCDWSEITCFAGNVTGISLKNKIIS  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC    L  LDLS N    +FPT LYNC+K
Sbjct  77   ATVPTNICDFPKLETLDLSSNRFSGDFPTVLYNCTK  112



>ref|XP_010519877.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=975

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S +  R +LL +K   G+PP L  W+  SSPC+WPEI CS G+VTGI     +    +PA
Sbjct  24   SQLDQRSMLLRLKLELGDPPPLRSWDDISSPCNWPEIHCSAGNVTGISFFNLNFTVPVPA  83

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IC   NL +LDLS NY P  FPT LYNC+K
Sbjct  84   SICDFPNLRSLDLSYNYFPGGFPTVLYNCTK  114



>ref|XP_010050470.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=530

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            A +SQ    +  +LL++++ W +P SL+ W A+  SS C+WPEI+C  GS+T + L   +
Sbjct  33   AAVSQIQDQELQVLLKLRQSWQDPSSLDRWVASNSSSHCAWPEIKCQEGSITELNLVSLN  92

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LDLS NYIP  FPT LYNCSK
Sbjct  93   INYSIPPYICDLKNLTKLDLSYNYIPGEFPTVLYNCSK  130



>ref|XP_003603644.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES73895.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1033

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VISQ+  T++ ILL +KR+  NPPSLE W  + SSPC+WPEI C+GG+VT + L   +I 
Sbjct  27   VISQTTTTEQTILLNLKRQLNNPPSLESWKPSLSSPCNWPEINCTGGTVTELLLLNKNIT  86

Query  453  SE-IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            ++ +P+ IC LKNL  LDLS N I  +FPT L NCS
Sbjct  87   TQKLPSIICNLKNLIKLDLSNNSIAGDFPTWLQNCS  122



>ref|XP_004501092.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=889

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VISQ+  ++  ILL +KR+ GNPPSL+ W  + SSPC+WPEI C G +VT + L   +I 
Sbjct  27   VISQTTNSEETILLTLKRQLGNPPSLQSWKPSPSSPCNWPEIRCIGSTVTELLLPSENIT  86

Query  453  SE-IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            ++ +P+ IC LKNLT LDLS N I   FPT LYNC+
Sbjct  87   TQKLPSTICDLKNLTKLDLSNNSIAGEFPTWLYNCT  122



>ref|XP_004501091.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1030

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VISQ+  ++  ILL +KR+ GNPPSL+ W  + SSPC+WPEI C G +VT + L   +I 
Sbjct  27   VISQTTNSEETILLTLKRQLGNPPSLQSWKPSPSSPCNWPEIRCIGSTVTELLLPSENIT  86

Query  453  SE-IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            ++ +P+ IC LKNLT LDLS N I   FPT LYNC+
Sbjct  87   TQKLPSTICDLKNLTKLDLSNNSIAGEFPTWLYNCT  122



>ref|XP_010910570.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Elaeis guineensis]
Length=416

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +3

Query  279  ISQSPVTDRDILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECS-GGSVTGIFLKEYDI  449
            ++ S +T R ILL +K  WGNP  L  WN +  +S C+W  I+CS  GSVT I L   +I
Sbjct  22   LAASQMTTRQILLRIKEDWGNPSVLSSWNDSIPTSHCNWTGIQCSTDGSVTNITLSNQNI  81

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
               IPA IC LKNL+ LDLS N IP  FPT LYNCS
Sbjct  82   AQTIPAAICKLKNLSILDLSYNDIPGTFPTSLYNCS  117



>ref|XP_010421450.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S + DR  LL +KR  G+PPSL  WN TSSPC+WPEI C+ G+VT I  +  +    +P 
Sbjct  22   SQINDRSTLLNLKRVLGDPPSLRLWNDTSSPCNWPEITCTAGNVTEINFQNQNFTGTVPT  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC    L +L+LS NY    FPT LYNC+K
Sbjct  82   TICDFPKLKSLNLSFNYFSGEFPTILYNCTK  112



>ref|XP_009151112.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=904

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ    +R  LL +KR  G+PPSL  WN TSSPC W EI C  G+VTGI LK   I 
Sbjct  17   SVISQ--FDERSTLLNLKRSLGDPPSLRLWNNTSSPCDWSEIPCVAGNVTGISLKN-QIT  73

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC   NL  LDLS N    +FPT LYNC+K
Sbjct  74   TAVPTNICDFPNLETLDLSSNRFSGDFPTFLYNCTK  109



>ref|XP_003533283.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1008

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +  +LL +K+   +PP L  WN+TSS CSW EI C+  SVT + L + +I   IP  ICG
Sbjct  36   EHAVLLNIKQYLQDPPFLSHWNSTSSHCSWSEITCTTNSVTSLTLSQSNINRTIPTFICG  95

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            L NLT LD S N+IP  FPT LYNCSK
Sbjct  96   LTNLTHLDFSFNFIPGEFPTSLYNCSK  122



>ref|XP_009151111.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=1006

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TSSPC W  I C  G+VTGI     +  
Sbjct  19   SVISQ--INERSTLLALKRGLGDPPSLRLWNDTSSPCDWSGITCVDGNVTGISFYNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC   NL ALDLS N     FPT LYNC+K
Sbjct  77   ATVPTNICDFPNLEALDLSFNLFSGEFPTVLYNCTK  112



>ref|XP_010648290.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Vitis vinifera]
Length=982

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++S PC WPEI C+  +VT I L    I  
Sbjct  27   VISQNLDDERSILLDVKQQLGNPPSLQSWNSSSLPCDWPEITCTDNTVTAISLHNKTIRE  86

Query  456  EIPANICGLKNLTALDLSLNYI----PNNF  533
            +IPA IC LKNL  LDLS NYI     NNF
Sbjct  87   KIPATICDLKNLIVLDLSNNYIVDLTANNF  116



>emb|CBI20588.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++S PC WPEI C+  +VT I L    I  
Sbjct  27   VISQNLDDERSILLDVKQQLGNPPSLQSWNSSSLPCDWPEITCTDNTVTAISLHNKTIRE  86

Query  456  EIPANICGLKNLTALDLSLNYI----PNNF  533
            +IPA IC LKNL  LDLS NYI     NNF
Sbjct  87   KIPATICDLKNLIVLDLSNNYIVDLTANNF  116


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  321  VKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICGLKNLTAL  500
            VK++ GNPPSL+ WN++SSPC W EI C+  +VT I L    I  +IPA IC LKNL  L
Sbjct  677  VKQQLGNPPSLQSWNSSSSPCDWSEITCTNNTVTAISLHNKTIREKIPATICDLKNLIVL  736

Query  501  DLSLNYIPNNFPTGLYNCSK  560
             LS NYIP+ F + + NCSK
Sbjct  737  HLSNNYIPDEF-SDILNCSK  755



>ref|XP_008778617.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=291

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = +3

Query  282  SQSPVTD--RDILLEVKRRWGNPPSLEGWNATSS--PCSWPEIECSG-GSVTGIFLKEYD  446
            SQ   TD  R ILL++K+ W NP +LE WN ++S   C+W  I CSG GSVT I L   +
Sbjct  24   SQPATTDGERQILLQIKKGWRNPSALESWNDSTSTNHCTWAGIGCSGNGSVTNITLVNQN  83

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IPA IC L++L+ LDLS NYI  +FP  LYNCSK
Sbjct  84   ISQPIPATICELRSLSFLDLSYNYITTSFPKSLYNCSK  121



>ref|XP_002872187.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48446.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=303

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +V SQS   D+  LL +KR  G+PPSL  WN TSSPC+W EI C+ G++TGI  K  +  
Sbjct  19   SVFSQS--NDQSTLLNLKRDLGDPPSLRLWNDTSSPCNWSEIICTAGNITGINFKNKNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  IC L NL  LDLS N     F T LY C+K
Sbjct  77   GTVPTTICDLSNLNFLDLSFNNFAGEFTTVLYKCTK  112



>emb|CDX80548.1| BnaC07g28960D [Brassica napus]
Length=906

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TSSPC W EI C  G+VTGI +K     
Sbjct  17   SVISQ--LDERSTLLNLKRSLGDPPSLRLWNDTSSPCDWSEITCVAGNVTGISIKN-QFT  73

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC   NL  LDLS N    +FPT LYNC+K
Sbjct  74   TAVPTNICDFPNLKTLDLSSNRFSGDFPTVLYNCTK  109



>ref|XP_011078243.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=1018

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  PVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPAN  470
            P  ++ ILL +K+ W NP SL  W  +S  CSWPEI C+ GSVT I +    I   IP +
Sbjct  34   PDQEQSILLSLKQHWSNPSSLSHWTPSSDHCSWPEIACTDGSVTRIAIINGSITETIPPS  93

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            IC LKNL+ +DL  N+IP  FPT LYNC K
Sbjct  94   ICDLKNLSYIDLQWNFIPGFFPTVLYNCPK  123



>gb|AAO00824.1| disease resistance protein - like [Arabidopsis thaliana]
 gb|AAP75809.1| At5g25910 [Arabidopsis thaliana]
Length=448

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S   DR  LL +KR  G+P SL  WN TSSPC+WP I C+ G+VT I  +  +    +P 
Sbjct  22   SQYNDRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPT  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC   NL +L+LS NY    FPT LYNC+K
Sbjct  82   TICNFPNLKSLNLSFNYFAGEFPTVLYNCTK  112



>emb|CBI27997.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECS-GGSVTGIFLKEYDIVS  455
            SQ+   +  ILL++K+ W NPP+++ W ++ SS C+WPEIEC+  GSVTGI L   +I +
Sbjct  29   SQASDQELSILLKLKQHWHNPPAIDHWTSSNSSYCTWPEIECAEDGSVTGISLVNINITN  88

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGL  545
            EIP  IC LKN+T +DL LNYIP  FPT L
Sbjct  89   EIPPFICDLKNITTIDLQLNYIPGGFPTVL  118



>gb|KEH27214.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=953

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNA--TSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANI  473
            + + L+++K+ + NPP+L  W +  TS   SWPEI C+ GSVTG+ L  Y+I   IP+ I
Sbjct  34   EHETLMKIKQHFQNPPNLNHWTSSNTSYCSSWPEITCTNGSVTGLTLFNYNINQTIPSFI  93

Query  474  CGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            C LKNLT +D + NYIP  FPT LYNCSK
Sbjct  94   CDLKNLTHVDFNNNYIPGMFPTDLYNCSK  122



>emb|CDX88206.1| BnaA06g27970D [Brassica napus]
Length=1007

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +VISQ  + +R  LL +KR  G+PPSL  WN TSSPC W  I C  G+VTGI     +  
Sbjct  19   SVISQ--INERSTLLALKRGLGDPPSLRLWNDTSSPCDWSGITCVDGNVTGISFYNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + +P NIC   NL  LDLS N     FPT LYNC+K
Sbjct  77   ATVPTNICDFPNLEVLDLSFNLFSGEFPTVLYNCTK  112



>ref|XP_010493845.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010493847.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Camelina 
sativa]
Length=1007

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +V SQ+   D   LL +KR  G+PPSL  WN TSSPC+WPEI C+ G+V GI  +  +  
Sbjct  19   SVFSQT--NDGSTLLNLKRVLGDPPSLRLWNDTSSPCNWPEITCADGNVNGINFQNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  IC   NL +LDLS N     FPT LYNC+K
Sbjct  77   GTVPTTICDFPNLRSLDLSFNLFSGKFPTVLYNCTK  112



>gb|KEH27213.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1015

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNA--TSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANI  473
            + + L+++K+ + NPP+L  W +  TS   SWPEI C+ GSVTG+ L  Y+I   IP+ I
Sbjct  34   EHETLMKIKQHFQNPPNLNHWTSSNTSYCSSWPEITCTNGSVTGLTLFNYNINQTIPSFI  93

Query  474  CGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            C LKNLT +D + NYIP  FPT LYNCSK
Sbjct  94   CDLKNLTHVDFNNNYIPGMFPTDLYNCSK  122



>ref|XP_008780256.1| PREDICTED: receptor-like protein kinase HSL1, partial [Phoenix 
dactylifera]
Length=273

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  282  SQSPVTD--RDILLEVKRRWGNPPSLEGWNATSSP--CSWPEIECSG-GSVTGIFLKEYD  446
            SQ   TD  R ILL++K+ W NP +LE WN ++S   C+W  I CS  GSVT I L   +
Sbjct  24   SQPATTDGERQILLQIKKDWRNPSALESWNNSTSANHCTWTGIGCSANGSVTNITLVNQN  83

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IPA IC L++L+ LDLS NYI  +FP  LYNCSK
Sbjct  84   ISQPIPATICELRSLSFLDLSYNYITTSFPKSLYNCSK  121



>gb|KHG19858.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1009

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +R +LL VK++ GNPPS+  WN++SSPC WPEI C+ GSVTG+ L++ +I++ IP +IC 
Sbjct  28   ERTLLLNVKQQLGNPPSISSWNSSSSPCDWPEIICTAGSVTGLHLRDKNIMTTIPPSICD  87

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            LKNLT LDLSLN+IP  FP+ LYNCSK
Sbjct  88   LKNLTFLDLSLNFIPGEFPSTLYNCSK  114



>ref|NP_197963.1| receptor like protein 52 [Arabidopsis thaliana]
 gb|AAD40136.1|AF149413_17 contains similarity to leucine rich repeats (Pfam PF00560, Score=225.3, 
E=9.2e-64, N=12); may be a pseudogene [Arabidopsis 
thaliana]
 gb|AED93500.1| receptor like protein 52 [Arabidopsis thaliana]
Length=811

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S   DR  LL +KR  G+P SL  WN TSSPC+WP I C+ G+VT I  +  +    +P 
Sbjct  22   SQYNDRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPT  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC   NL +L+LS NY    FPT LYNC+K
Sbjct  82   TICNFPNLKSLNLSFNYFAGEFPTVLYNCTK  112



>ref|XP_010047668.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79625.1| hypothetical protein EUGRSUZ_C00984 [Eucalyptus grandis]
Length=1026

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W  + +SS C+WPEI C  GS+T + L   +
Sbjct  33   VAESQIQDQEQQVLLKLRQSWQDPSSLDHWVTSNSSSHCTWPEITCQDGSITALNLVNLN  92

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  93   INYSIPPFICDLKNLTKLDLSFNNIPGEFPTVLYNCSK  130



>gb|KHG25031.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=959

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
             ISQ    +R +LL++K++ GNPPS+  WN++S PC+WPEI C+ GSVT + L++ +I  
Sbjct  20   AISQDINAERTLLLKLKQQLGNPPSIGSWNSSSPPCTWPEINCTDGSVTEVHLRDKNITV  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +P  IC LKNLT LDL  N+IP  FP  LY+CSK
Sbjct  80   RVPPTICDLKNLTVLDLCDNFIPGEFPI-LYSCSK  113



>ref|XP_010050465.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=743

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D++  +LL++++ W +P SL+ W A+  SS C+WPEI+C  GS+T + L   +I
Sbjct  34   AESQIQDQELQVLLKLRQSWQDPSSLDHWVASNSSSHCAWPEIKCQEGSITELNLVNLNI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  94   NYSIPPFICDLKNLTKLDLSYNNIPGEFPTVLYNCSK  130



>gb|KCW79613.1| hypothetical protein EUGRSUZ_C00967 [Eucalyptus grandis]
Length=986

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D++  +LL++++ W +P SL+ W A+  SS C+WPEI+C  GS+T + L   +I
Sbjct  34   AESQIQDQELQVLLKLRQSWQDPSSLDHWVASNSSSHCAWPEIKCQEGSITELNLVNLNI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  94   NYSIPPFICDLKNLTKLDLSYNNIPGEFPTVLYNCSK  130



>ref|XP_006394841.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
 gb|ESQ32127.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
Length=1005

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            AVISQ  + +R  LL++KR  G+PPSL  WN  SSPC W EI C  G+VT I     +  
Sbjct  19   AVISQ--LDERSTLLKLKRELGDPPSLRRWNDRSSPCDWSEITCVAGNVTKINFYNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  IC   NL++LDLS N     FPT LYNC+K
Sbjct  77   VTVPTTICDFPNLSSLDLSYNLFSGEFPTVLYNCTK  112



>gb|KEH27215.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1012

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNA--TSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANI  473
            + +ILL++K  + NP  L  W    TS  CSWPEI C+  SVT + +   DI   +P  +
Sbjct  36   EHEILLKIKNHFQNPSFLSHWTISNTSLHCSWPEIHCTKNSVTSLLMMNKDITQTLPPFL  95

Query  474  CGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            C LKNLT +D   NYIPN FPT LYNCS
Sbjct  96   CELKNLTHIDFQYNYIPNEFPTSLYNCS  123



>emb|CAN78716.1| hypothetical protein VITISV_009349 [Vitis vinifera]
Length=176

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 3/95 (3%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ    +R ILL+VK++ GNPPSL+ WN++SSPC WPEI+C+  +VT I L    I  
Sbjct  28   VISQD--DERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEIKCTDNTVTAISLHNKAISE  85

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LDLS N IP  FP  + NCSK
Sbjct  86   KIPATICDLKNLIVLDLSNNDIPGEFP-DILNCSK  119



>ref|XP_003549165.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
 gb|KHN24478.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1009

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSP-CSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL +K+   +PP L  W +TSS  CSWPEI C+  SVT + L + +I   IP+ IC
Sbjct  36   EHAVLLNIKQYLQDPPFLSNWTSTSSSHCSWPEIICTTNSVTSLTLSQSNINRTIPSFIC  95

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            GL NLT LD S N+IP  FPT LYNCSK
Sbjct  96   GLTNLTHLDFSFNFIPGGFPTPLYNCSK  123



>ref|XP_010248386.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Nelumbo nucifera]
Length=150

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEI  461
            SQ+   ++ ILL++++ W N P +  W+++   C+W  I C  GSVT I    ++I  +I
Sbjct  7    SQTTNDEQFILLKLQQNWQNQPPMNSWHSSFPFCNWTGITCHDGSVTAISFYNWNITGKI  66

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            P  IC L+NL  LDL+ NY+   FPT LYNCSK
Sbjct  67   PPVICNLENLNHLDLAYNYVTGEFPTFLYNCSK  99



>gb|KCW79632.1| hypothetical protein EUGRSUZ_C00991, partial [Eucalyptus grandis]
Length=725

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W A+  SS C+WPEI C  GS+T + L   +
Sbjct  31   VAESQIQDQEQKVLLKLRQSWQDPSSLDHWVASNSSSHCTWPEITCQEGSITELNLVNLN  90

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LD+S N IP  FPT LYNCSK
Sbjct  91   INYSIPPFICDLKNLTKLDISYNNIPGGFPTVLYNCSK  128



>ref|XP_006475586.1| PREDICTED: receptor-like protein kinase 5-like [Citrus sinensis]
Length=1014

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            + S + DR+  +LL++K+ W NPP +  W  T SS C+WPEI C+ GSVT + L   ++ 
Sbjct  25   ANSQLYDREHAVLLKLKQHWQNPPPISHWATTNSSHCTWPEIACTDGSVTELHLTNMNMN  84

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               P  IC L+NLT LDL  NYI + FP  LYNCSK
Sbjct  85   GTFPPFICDLRNLTILDLQFNYIISQFPRVLYNCSK  120



>gb|KDO66581.1| hypothetical protein CISIN_1g001778mg [Citrus sinensis]
Length=1014

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            + S + DR+  +LL++K+ W NPP +  W  T SS C+WPEI C+ GSVT + L   ++ 
Sbjct  25   ANSQLYDREHAVLLKLKQHWQNPPPISHWATTNSSHCTWPEIACTDGSVTELHLTNMNMN  84

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               P  IC L+NLT LDL  NYI + FP  LYNCSK
Sbjct  85   GTFPPFICDLRNLTILDLQFNYIISQFPRVLYNCSK  120



>ref|XP_006853705.1| hypothetical protein AMTR_s00056p00147890 [Amborella trichopoda]
 gb|ERN15172.1| hypothetical protein AMTR_s00056p00147890 [Amborella trichopoda]
Length=865

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS-SPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  ILL++KR+WGNPP L  WN+TS   C+W  I C   S+ GI L   +I  +IP +IC
Sbjct  38   EDQILLKIKRQWGNPPPLLSWNSTSGHHCNWFGITCDSNSIRGISLSNQNITEKIPDSIC  97

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKNLT LD+S NYI   FP  L+NCS 
Sbjct  98   DLKNLTHLDVSYNYITGEFPEVLFNCSH  125



>ref|XP_010047675.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=731

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W A+  SS C+WPEI C  GS+T + L   +
Sbjct  31   VAESQIQDQEQKVLLKLRQSWQDPSSLDHWVASNSSSHCTWPEITCQEGSITELNLVNLN  90

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LD+S N IP  FPT LYNCSK
Sbjct  91   INYSIPPFICDLKNLTKLDISYNNIPGGFPTVLYNCSK  128



>ref|XP_003517639.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1010

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTD--RDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIEC-SGGSVTGIFLKEYDI  449
            SQS + D  R  LL++K    NP  L  W  ++SS CSWPEI+C S GSVTG+ L    I
Sbjct  28   SQSQLHDQERATLLKIKEYLENPEFLSHWTPSSSSHCSWPEIKCTSDGSVTGLTLSNSSI  87

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP+ IC LKNLT +D   NYIP  FPT LYNCSK
Sbjct  88   TQTIPSFICDLKNLTVVDFYNNYIPGEFPTTLYNCSK  124



>ref|XP_010047253.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW79117.1| hypothetical protein EUGRSUZ_C00558 [Eucalyptus grandis]
Length=1026

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W  + +SS C+WPEI C  GS+T + L   +
Sbjct  33   VAESQIQDQEQQVLLKLRQSWQDPSSLDHWVTSNSSSHCTWPEITCQDGSITELNLVNLN  92

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  93   INYSIPPFICDLKNLTKLDLSSNNIPGEFPTVLYNCSK  130



>ref|XP_010454934.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +V +Q+   +R  LL +KR  G+PPSL  WN TSSPC+WP I C GG+VT I  +  +  
Sbjct  19   SVFAQT--NERSTLLNLKRVLGDPPSLRLWNDTSSPCNWPMINCIGGNVTEINFQNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  IC   NL  LDLS N     FPT LYNC+K
Sbjct  77   GTVPTMICDFPNLRFLDLSFNLFAGEFPTVLYNCTK  112



>ref|XP_010249486.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1034

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
             ISQ+   ++ ILL++K+ W N P ++ W ++   C+W  I C  GSVTGI    ++I  
Sbjct  29   AISQTTYDEQSILLKLKQDWKNQPPMDSWKSSLPFCNWTGITCDNGSVTGISFGNWNING  88

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  IC L NL  LDL+LNYI   FPT LYNCSK
Sbjct  89   PIPPIICNLSNLNHLDLTLNYITGEFPTFLYNCSK  123



>ref|XP_010050393.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=532

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D++  +L ++++ W +P SL+ W A+  SS C+WPEI+C  GS+T + L   +I
Sbjct  31   AESQIQDQELQVLSKLRQSWQDPSSLDHWVASNLSSHCAWPEIKCQEGSITELNLVNLNI  90

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  91   NYSIPPFICDLKNLTKLDLSYNIIPGEFPTVLYNCSK  127



>emb|CDP03251.1| unnamed protein product [Coffea canephora]
Length=982

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            ++ ILL++K++W NPPSL  W ++S PC+WPEI C+ GSVT + +    I   IP+ IC 
Sbjct  38   EQTILLKLKQQWLNPPSLSHWTSSSDPCTWPEINCTSGSVTKLNVSNLAITETIPSFICD  97

Query  480  LKNLTALDLSLNYIPNNFPTGL  545
            LKNLT LDL+ N IP +FPT L
Sbjct  98   LKNLTVLDLNNNSIPGSFPTYL  119



>ref|XP_010495505.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=724

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S + DR  LL +K    +PPSL  WN TSSPC+WPEI C+ G+VT I  +  +    +P 
Sbjct  22   SQINDRSTLLNLKSVLSDPPSLRLWNDTSSPCNWPEITCTAGNVTEINFQNQNFTGTVPP  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC    L  L+LS NY    FPT LYNC+K
Sbjct  82   TICDFPKLKYLNLSFNYFSGEFPTILYNCTK  112



>gb|KCW79121.1| hypothetical protein EUGRSUZ_C00562 [Eucalyptus grandis]
Length=1002

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +3

Query  273  AVISQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKE  440
            A   +S + D++  +LL++++ W +P SL+ W A+  SS  +WPEIEC  GS+T + L +
Sbjct  22   AHAQESQIQDQELQVLLKLRQSWRDPSSLDHWVASNSSSHYAWPEIECQEGSITELNLVD  81

Query  441  YDIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +I   IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  82   LNINYSIPPFICDLKNLTKLDLSYNNIPGEFPTVLYNCSK  121



>ref|XP_006286443.1| hypothetical protein CARUB_v10000221mg [Capsella rubella]
 gb|EOA19341.1| hypothetical protein CARUB_v10000221mg [Capsella rubella]
Length=834

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            S + D+  LL +K   G+PPSL  WN TSSPC+WP I C+ G+VT I  +  +    +P 
Sbjct  22   SQINDQSTLLNLKSVLGDPPSLRLWNDTSSPCNWPCITCTAGNVTEINFQNQNFTGTVPT  81

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC   NL +LDLS N     FPT LYNC+K
Sbjct  82   KICDFPNLKSLDLSFNLFSGEFPTVLYNCTK  112



>emb|CAN69391.1| hypothetical protein VITISV_000950 [Vitis vinifera]
Length=1041

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC W EI C+  +VT + L+   I+ 
Sbjct  30   VISQNLDAERSILLDVKQQLGNPPSLQSWNSSSSPCDWSEITCTDNTVTNVSLRNRIIIE  89

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  90   KIPARICDLKNLIVLDVSYNYIPGEFP-DILNCSK  123



>ref|XP_010050386.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1026

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL +++ W +P SL  W A+  SS C+WPE+ C GGS+T + L   +
Sbjct  33   VAESQIQDQEQQVLLNLRQSWQDPSSLSHWVASNSSSHCTWPEVTCQGGSITELNLVNLN  92

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT L++S N IP +FPT LYNCSK
Sbjct  93   INYSIPPFICDLKNLTKLNVSSNKIPGDFPTVLYNCSK  130



>ref|XP_006286985.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
 gb|EOA19883.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
Length=1006

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +V SQ+   DR  LL +KR  G+P SL  WN TSSPC WP I C+ G+VT I  +  +  
Sbjct  19   SVFSQT--NDRSTLLNLKRVLGDPTSLRQWNNTSSPCDWPLITCTAGNVTEINFQNQNFT  76

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  IC   NL  LDLS N     FPT LYNC+K
Sbjct  77   GTVPTTICDFPNLQFLDLSYNLFSGEFPTVLYNCTK  112



>ref|XP_009381187.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1025

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            A ++     +  +LL +KR+W + P+L  WN +S  C WP IECS GSVT I L   +I 
Sbjct  38   ATVAHGNDQEELLLLNLKRQWSSVPALGSWNDSSPHCDWPGIECSDGSVTQISLSNINIT  97

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              IP  +C L +L  LDLS NYIP  FPT LY CS
Sbjct  98   KPIPPFLCNLTSLAYLDLSNNYIPGGFPTSLYRCS  132



>ref|XP_002324752.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF03317.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=1019

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ    ++ ILL +K++ GNP S++ WN++SSPC WP++ C  G+VTG+ L   +I  
Sbjct  21   VISQDVNAEKTILLNLKQQLGNPSSIQSWNSSSSPCEWPDVYCVEGAVTGLDLGNKNITQ  80

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IPA++C LKNLT L+L+ NYIP  FP  LYNC K
Sbjct  81   TIPASVCDLKNLTYLNLNWNYIPGGFPKLLYNCKK  115



>ref|XP_007152512.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
 gb|ESW24506.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
Length=1003

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +  +LL++K+   +P  L  WN+TSS CSW EI C+ GSVT + L   +I   IP   C 
Sbjct  35   EHAVLLKIKQYLEDPSFLSHWNSTSSHCSWAEITCTSGSVTSLTLSHSNINKTIPPFTCD  94

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            L NLT LD S N IP +FPT LYNCSK
Sbjct  95   LTNLTHLDFSFNLIPGDFPTPLYNCSK  121



>ref|XP_010910207.1| PREDICTED: receptor-like protein kinase HSL1, partial [Elaeis 
guineensis]
Length=711

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = +3

Query  282  SQSPVTD--RDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYD  446
            SQ+   D  R ILL +++ WGNP  L  WN ++    C W  I+CS  GSVT I L   +
Sbjct  24   SQTKTEDGERQILLRIRKDWGNPSVLGSWNDSTPTRHCKWTGIQCSADGSVTNITLSNQN  83

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            I   IPA IC LKNL+ LDLS N IP  FPT LYNCS
Sbjct  84   IAQPIPAAICKLKNLSILDLSYNDIPGTFPTSLYNCS  120



>ref|XP_008377967.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQS  T++ ILL++K +WGNPPS++ WN++SSPC WP I C+ G VTG+ L + +I  
Sbjct  24   VISQS--TEQSILLKIKAQWGNPPSIQSWNSSSSPCEWPGINCTNGMVTGLSLPDVNITE  81

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             IP  +C L  L  L L+ NYIP  FP  LYNCS
Sbjct  82   RIPEAVCELPXLAELHLAWNYIPGEFPKFLYNCS  115



>gb|KCW47028.1| hypothetical protein EUGRSUZ_K00835 [Eucalyptus grandis]
Length=574

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D++  +L ++++ W  P SL+ W A+  SS C+WPEI+C  GS+T + L + +I
Sbjct  34   AESQIQDQELQVLSKLRQSWQAPSSLDHWVASDSSSHCAWPEIKCQEGSITELNLVDLNI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  94   NYSIPPFICDLKNLTKLDLSYNNIPGEFPTVLYNCSK  130



>ref|XP_003527853.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1021

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            V SQS  T++ +LL +KR  G+PPSL  W  + S+PC W EI C  GSVT + L   +I 
Sbjct  27   VFSQSENTEQTVLLSLKRELGDPPSLRSWEPSPSAPCDWAEIRCDNGSVTRLLLSRKNIT  86

Query  453  SE---IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            +    + + IC LK+L  LDLS N+I   FPT LYNCS
Sbjct  87   TNTKNLSSTICNLKHLFKLDLSSNFISGEFPTTLYNCS  124



>gb|KEH27208.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=981

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWNA--TSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ    + +ILL +K  + NP  L  W    TSS C WPEI C+  SVT + +   +I  
Sbjct  17   SQLYNQEHEILLSIKNHFQNPSFLSHWTKSNTSSHCLWPEILCTKNSVTSLSMINKNITQ  76

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  +C LKNLT +D   NYIPN FPT LYNCSK
Sbjct  77   TIPLFLCELKNLTYIDFQYNYIPNEFPTSLYNCSK  111



>emb|CAN80774.1| hypothetical protein VITISV_042330 [Vitis vinifera]
Length=983

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            +ISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC WPEI C+  ++  I L    I  
Sbjct  28   IISQNLHDERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEITCTNNTIIAISLHNKTIRE  87

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LDLS NYIP  FP  + NCSK
Sbjct  88   KIPATICDLKNLIILDLSNNYIPGEFPD-ILNCSK  121



>gb|KCW79122.1| hypothetical protein EUGRSUZ_C00563 [Eucalyptus grandis]
Length=962

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +3

Query  276  VISQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEY  443
            ++++S + D++  +LL++++ W +P SL+ W A+  SS C+WPEI+C  G +T + L   
Sbjct  14   LVNKSQIQDQELQVLLKLRQSWQDPSSLDHWVASNSSSHCAWPEIKCQEGLITELNLVNL  73

Query  444  DIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +I   IP  IC LKNLT L+LS N IP  FPT LYNCSK
Sbjct  74   NINYSIPLFICDLKNLTKLNLSYNNIPGEFPTVLYNCSK  112



>ref|XP_010648291.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1029

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            +ISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC WPEI C+  ++  I L    I  
Sbjct  28   IISQNLHDERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEITCTNNTIIAISLHNKTIRE  87

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LDLS NYIP  FP  + NCSK
Sbjct  88   KIPATICDLKNLIILDLSNNYIPGEFPD-ILNCSK  121



>ref|XP_007152971.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
 gb|ESW24965.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
Length=1011

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 3/96 (3%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            S S + D++  +LL++K+   NPP L  W  + SS C+WPEI C+ GSVT + +   +I 
Sbjct  29   SHSLLYDQEHAVLLKIKQYLQNPPFLHHWIPSNSSHCTWPEIRCTNGSVTSLTMYNTNIT  88

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              +P  +C LK+LT +D  LN+IP  FPT LYNCSK
Sbjct  89   QTLPPFLCDLKSLTHIDFQLNFIPGEFPTSLYNCSK  124



>ref|XP_010050476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Eucalyptus grandis]
Length=916

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ P  ++ +LL++++ W +P SL+ W  + ++S C+WPE+ C  GS+T + L   +I  
Sbjct  32   SQIPDQEQHVLLKLRQTWQDPSSLDNWVPSNSTSHCTWPEVTCQDGSITELKLANLNINY  91

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             IP  IC LKNLT LDLS N IP  FPT LYNCS
Sbjct  92   PIPPFICDLKNLTKLDLSNNNIPGGFPTVLYNCS  125



>ref|XP_010050389.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=908

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            S+S + D++  +LL++++ W +P SL+ W A+  SS C+WPEI+C  G +T + L   +I
Sbjct  23   SESQIQDQELQVLLKLRQSWQDPSSLDHWVASNSSSHCAWPEIKCQEGLITELNLVNLNI  82

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT L+LS N IP  FPT LYNCSK
Sbjct  83   NYSIPLFICDLKNLTKLNLSYNNIPGEFPTVLYNCSK  119



>ref|XP_003631769.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=999

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC WPEI C    VT I L    I  
Sbjct  28   VISQNLDAERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEITCIDNIVTEISLSYKTITK  87

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  88   KIPARICDLKNLIVLDVSYNYIPGEFP-DILNCSK  121



>ref|XP_010095354.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Morus 
notabilis]
 gb|EXB59773.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Morus 
notabilis]
Length=694

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +R +LL++K+ WGN   ++ W  + +S CSWP I C+  SVTG+ L   +I   +P+ IC
Sbjct  18   ERSVLLKLKQHWGNISFMDEWTPSNNSHCSWPGITCTSNSVTGLSLNNVNITGPVPSFIC  77

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKNLT +DL  NYIP  FP  ++NCSK
Sbjct  78   DLKNLTTIDLGDNYIPGEFPRAVFNCSK  105



>ref|XP_009601880.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1018

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +  ILL++K+ W   P++  WN++S+ CSWP I C+  SVTGI +    I   IP+ IC 
Sbjct  35   ENTILLKLKQHWSTSPNITSWNSSSNHCSWPGIICNHNSVTGIQIYFGQISEPIPSFICD  94

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            LKNLT LDL+ N+IP  FPT LYNCS
Sbjct  95   LKNLTFLDLNHNFIPGPFPTILYNCS  120



>ref|XP_002278223.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1004

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC WPEI C    VT I L    I  
Sbjct  28   VISQNLDAERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEITCIDNIVTEISLSYKTITK  87

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  88   KIPARICDLKNLIVLDVSYNYIPGEFP-DILNCSK  121



>gb|KCW79630.1| hypothetical protein EUGRSUZ_C00989, partial [Eucalyptus grandis]
Length=939

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ P  ++ +LL++++ W +P SL+ W  + ++S C+WPE+ C  GS+T + L   +I  
Sbjct  1    SQIPDQEQQVLLKLRQTWQDPSSLDNWVPSNSTSHCTWPEVTCQDGSITELKLANLNINY  60

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  IC L NLT LDLS N IP  FPT LYNCSK
Sbjct  61   PIPPFICDLNNLTRLDLSNNNIPGEFPTVLYNCSK  95



>ref|XP_003523755.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1011

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            VISQS  T++ ILL +K   G+PPSL  W  + S+PC W EI C+GGSVT + L   +I 
Sbjct  27   VISQSENTEQTILLTLKHELGDPPSLRSWIPSPSAPCDWAEIRCAGGSVTRLLLSGKNIT  86

Query  453  S---EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            +    + + IC LK+L  LD S N+I + FPT LYNC+
Sbjct  87   TTTKNLSSTICNLKHLFKLDFSGNFISDEFPTTLYNCT  124



>ref|XP_010047672.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=985

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ P  ++ +LL++++ W +P SL+ W  + ++S C+WPE+ C  GS+T + L   +I  
Sbjct  32   SQIPDQEQQVLLKLRQTWQDPSSLDNWVPSNSTSHCTWPEVTCQDGSITELKLANLNINY  91

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  IC L NLT LDLS N IP  FPT LYNCSK
Sbjct  92   PIPPFICDLNNLTRLDLSNNNIPGEFPTVLYNCSK  126



>ref|XP_010050474.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=978

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D++  +LL++++ W  P SL+ W A+  SS C+WPEI+C  GS+T + L    I
Sbjct  34   AESQIQDQELQVLLKLRQSWQEPSSLDHWVASNSSSHCAWPEIKCQEGSITKLNLTNLSI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N I   FPT LYNCSK
Sbjct  94   NYSIPPFICDLKNLTKLDLSYNNITGEFPTVLYNCSK  130



>gb|KCW79622.1| hypothetical protein EUGRSUZ_C00979 [Eucalyptus grandis]
Length=992

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D++  +LL++++ W  P SL+ W A+  SS C+WPEI+C  GS+T + L    I
Sbjct  34   AESQIQDQELQVLLKLRQSWQEPSSLDHWVASNSSSHCAWPEIKCQEGSITKLNLTNLSI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N I   FPT LYNCSK
Sbjct  94   NYSIPPFICDLKNLTKLDLSYNNITGEFPTVLYNCSK  130



>emb|CBI20580.3| unnamed protein product [Vitis vinifera]
Length=1269

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC WPEI C    VT I L    I  
Sbjct  83   VISQNLDAERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEITCIDNIVTEISLSYKTITK  142

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  143  KIPARICDLKNLIVLDVSYNYIPGEFP-DILNCSK  176


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC W EI C    VT I L    I  
Sbjct  825  VISQNLDAERSILLDVKQQLGNPPSLQSWNSSSSPCDWSEITCIDNIVTEISLSYKTITK  884

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  885  KIPARICDLKNLIVLDVSYNYIPGEFP-DILNCSK  918



>ref|XP_010050387.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1000

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W  +  SS C+WPEI C   S+T + L   +
Sbjct  31   VAESQIQDQEQQVLLKLRQSWQDPSSLDHWVTSNPSSHCTWPEITCQESSITELNLVNLN  90

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LDLS N IP  FPT LYNCSK
Sbjct  91   INYSIPPFICDLKNLTKLDLSYNIIPGEFPTVLYNCSK  128



>ref|XP_010050472.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Eucalyptus grandis]
Length=1101

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSS--PCSWPEIECSGGSVTGIFLKEYD  446
            A  SQ    ++ +LL++++ W +P SL+ W A++S   C+WPEI C  GS+T + L + +
Sbjct  138  AAESQIQDQEQQVLLKLRQSWQDPSSLDHWVASNSFSHCAWPEITCQDGSITELNLVDLN  197

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            I   IP  IC LKNLT LDLS N IP  FPT LYNCS
Sbjct  198  INYPIPPFICDLKNLTKLDLSNNNIPGGFPTVLYNCS  234



>ref|XP_010095355.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB59774.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=526

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS-SPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +R +LL++K+ WGN   ++ W  +S S CSWP I C+  SVTG+ L+  +I   +P+ IC
Sbjct  35   ERSVLLKLKQHWGNISFMDEWTPSSNSHCSWPGITCTSNSVTGLSLRNVNITGPVPSFIC  94

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKN+T ++L  NYIP  FP  ++NCSK
Sbjct  95   DLKNVTTINLGDNYIPGEFPRAVFNCSK  122



>ref|XP_008451149.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=355

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            V SQ    +  +LL +   W N   +  W  + +S CSW E++C+  SVTG+F   Y++ 
Sbjct  26   VNSQLYQQEHSVLLRLNHFWQNQAPITHWLTSNASHCSWTEVQCNNNSVTGLFFSSYNLN  85

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              IP+ IC LKNLT LDL  N+I   FPT LY+CS
Sbjct  86   GTIPSFICDLKNLTHLDLHFNFITGTFPTTLYHCS  120



>gb|KJB07471.1| hypothetical protein B456_001G026000 [Gossypium raimondii]
Length=1011

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +R +LL VK++  NPPS+  WN++SSPC WPEI C+ GSVT + L++ +I++ IP +IC 
Sbjct  28   ERTLLLNVKQQLDNPPSISSWNSSSSPCDWPEIICTAGSVTRLHLRDKNIMTTIPPSICD  87

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            LKNLT LDLSLN+IP  FP+ LYNCSK
Sbjct  88   LKNLTFLDLSLNFIPGEFPSTLYNCSK  114



>gb|KCW79617.1| hypothetical protein EUGRSUZ_C009701, partial [Eucalyptus grandis]
Length=362

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ P  ++ +L ++++ W +P SL+ W  + +SS C+WPEI C  GS+T + L   +I  
Sbjct  32   SQIPDQEQQVLFKLRQSWQDPSSLDHWVTSNSSSHCTWPEITCQDGSITELNLVNLNINY  91

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP   C LKNLT LDLS N I   FPT LY+CS+
Sbjct  92   SIPPFFCDLKNLTKLDLSYNNIHGEFPTVLYHCSE  126



>ref|XP_010050478.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=680

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            AV SQ    ++ +LL++++ W +P SL+ W A+  SS C+WPEI C  G ++ + L    
Sbjct  31   AVESQIQDQEQQVLLKLRQSWQDPSSLDHWVASNSSSHCTWPEITCQEGWISELNLVNLS  90

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LD+S N IP  FPT LYNCSK
Sbjct  91   INYSIPPFICNLKNLTKLDISYNNIPGGFPTVLYNCSK  128



>gb|KCW79123.1| hypothetical protein EUGRSUZ_C00564, partial [Eucalyptus grandis]
Length=958

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +3

Query  285  QSPVTDRD--ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYDIV  452
            +S + D++  +L ++++ W  P SL+ W A+  SS C+WPEI+C  GS+T + L   +I 
Sbjct  5    KSQIQDQELQVLSKLRQSWQEPSSLDHWVASNSSSHCAWPEIKCQEGSITELNLVNLNIN  64

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              IP  IC LKN+T LDLS N IP  FPT LYNCSK
Sbjct  65   YSIPPFICDLKNMTKLDLSYNNIPGEFPTVLYNCSK  100



>ref|XP_007152972.1| hypothetical protein PHAVU_004G175800g [Phaseolus vulgaris]
 gb|ESW24966.1| hypothetical protein PHAVU_004G175800g [Phaseolus vulgaris]
Length=1016

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRD--ILLEVKRRWGNPPSLEGWNATS-SPCSWPEIECSGG-SVTGIFLKEYDI  449
            SQS + D++  ILL +K  + NPP L  W +++ S CSWPEI+CS   SVTG+ L    I
Sbjct  34   SQSQLHDQEHAILLRIKEYFENPPFLSHWTSSNFSHCSWPEIKCSDDDSVTGLTLSNNSI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP+ IC LKNLT +D   NYIP  FPT L NCSK
Sbjct  94   HQTIPSFICDLKNLTHVDFYNNYIPGEFPTYLVNCSK  130



>ref|XP_011010886.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Populus 
euphratica]
Length=991

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ    ++ ILL +K++ GNP S++ WN++SSPC WP++ C  G+VTG++L   +I  
Sbjct  21   VISQDVNAEKTILLNLKQQLGNPSSIQSWNSSSSPCEWPDVYCVEGTVTGLYLGNKNITR  80

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IPA++C LKNLT L L  N IP  FP  LYNC+K
Sbjct  81   TIPASVCDLKNLTYLSLYWNNIPGGFPKLLYNCTK  115



>ref|XP_011010885.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Populus 
euphratica]
Length=1020

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ    ++ ILL +K++ GNP S++ WN++SSPC WP++ C  G+VTG++L   +I  
Sbjct  21   VISQDVNAEKTILLNLKQQLGNPSSIQSWNSSSSPCEWPDVYCVEGTVTGLYLGNKNITR  80

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IPA++C LKNLT L L  N IP  FP  LYNC+K
Sbjct  81   TIPASVCDLKNLTYLSLYWNNIPGGFPKLLYNCTK  115



>ref|XP_002309529.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE93052.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=1015

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYDIV  452
            VISQ   T++ ILL++K++ GNPPS++ WN++SSPC+W  + C G GSV+ + L + +I 
Sbjct  28   VISQDANTEKTILLKLKQQLGNPPSIQSWNSSSSPCNWTGVTCGGDGSVSELHLGDKNIT  87

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              IPA +C LKNLT L+++ N+IP  FP  LY+C+K
Sbjct  88   ETIPATVCDLKNLTFLEMNFNHIPGGFPKVLYSCTK  123



>ref|XP_004513049.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1012

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +3

Query  294  VTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIVSEIPAN  470
            V +  ILL++K    NP  L  WN + +S CSWPEI C+ GSVTG+ L   +I   IP  
Sbjct  33   VEEHLILLKIKFHLQNPSFLTHWNTSNTSYCSWPEITCTSGSVTGLTLVNSNITQTIPFF  92

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +C LKNLT +D   N+IP  FP  LY CSK
Sbjct  93   LCDLKNLTHVDFHKNFIPGEFPKNLYTCSK  122



>ref|XP_006388198.1| hypothetical protein POPTR_0290s00240g, partial [Populus trichocarpa]
 gb|ERP47112.1| hypothetical protein POPTR_0290s00240g, partial [Populus trichocarpa]
Length=577

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYDIV  452
            VISQ   T++ ILL++K++ GNPPS++ WN++SSPC+W  + C G GSV+ + L + +I 
Sbjct  28   VISQDANTEKTILLKLKQQLGNPPSIQSWNSSSSPCNWTGVTCGGDGSVSELHLGDKNIT  87

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              IPA +C LKNLT L+++ N+IP  FP  LY+C+K
Sbjct  88   ETIPATVCDLKNLTFLEMNFNHIPGGFPKVLYSCTK  123



>ref|XP_010047671.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ P  ++ +LL+++  W +P SL+ W  + ++S C+WPE+ C  GS+T +     +I  
Sbjct  32   SQIPDQEQQVLLKLRHTWQDPSSLDNWVPSNSTSHCTWPEVTCQDGSITELKFANLNINY  91

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  IC L NLT LDLS N IP  FPT LYNCSK
Sbjct  92   PIPPFICDLNNLTRLDLSNNNIPGEFPTVLYNCSK  126



>ref|XP_009795019.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1018

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +  ILL++K+ W   P++  WN++S+ CSWP I C+  SVTGI +    I   IP+ IC 
Sbjct  35   ENTILLKLKQHWSTSPNITSWNSSSNHCSWPGIICNNNSVTGIQIYFGQISEPIPSFICD  94

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            LKNLT LDL+ N IP  FPT LYNCS
Sbjct  95   LKNLTFLDLNHNLIPGPFPTILYNCS  120



>ref|XP_004951508.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Setaria italica]
Length=885

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +3

Query  285  QSPVTDRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEI  461
            Q+  +D + LL VK+ WG+P +L  W +  SS CSW  + C+ G VT +  + ++I++ I
Sbjct  23   QTNSSDYETLLTVKKAWGSPSALSSWISQNSSYCSWAGVSCNNGRVTKLSFQNFNIINPI  82

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            PA+IC LKNL+ LDLS N + + FPT LY CS
Sbjct  83   PASICSLKNLSYLDLSYNNLTDQFPTVLYGCS  114



>emb|CBI39978.3| unnamed protein product [Vitis vinifera]
Length=912

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +  ILL+VK++ GNPPS++ WN++SSPC WPEI C+  ++T I L    I  
Sbjct  36   VISQNLDAELSILLQVKQQLGNPPSIQSWNSSSSPCDWPEITCTDNTITEISLYGKSITH  95

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  96   KIPARICDLKNLMVLDVSNNYIPGEFPD-ILNCSK  129



>emb|CAN76607.1| hypothetical protein VITISV_030396 [Vitis vinifera]
Length=974

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +  ILL+VK++ GNPPS++ WN++SSPC WPEI C+  ++T I L    I  
Sbjct  113  VISQNLDAELSILLQVKQQLGNPPSIQSWNSSSSPCDWPEITCTDNTITEISLYGKSITH  172

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  L NCSK
Sbjct  173  KIPARICDLKNLMVLDVSNNYIPGEFPDIL-NCSK  206



>ref|XP_010661160.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1007

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +  ILL+VK++ GNPPS++ WN++SSPC WPEI C+  ++T I L    I  
Sbjct  27   VISQNLDAELSILLQVKQQLGNPPSIQSWNSSSSPCDWPEITCTDNTITEISLYGKSITH  86

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  87   KIPARICDLKNLMVLDVSNNYIPGEFPD-ILNCSK  120



>ref|XP_010050477.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79634.1| hypothetical protein EUGRSUZ_C00993 [Eucalyptus grandis]
Length=731

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSGGSVTGIFLKEYD  446
            A  SQ    ++ +LL++++ W +P SL+ W A+  SS C+WPEI C  GS++ + L   +
Sbjct  31   AAESQIQDQEQQVLLKLRQSWRDPSSLDHWVASNSSSHCTWPEITCQEGSISELNLVNLN  90

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LK+LT LD+S N IP  FPT LYNCSK
Sbjct  91   INYSIPPFICDLKSLTKLDISYNNIPGGFPTVLYNCSK  128



>ref|XP_009409608.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1042

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            A ++     +R +L +++  W N P+L  W+ +S  C+WP I CS GSVT + L   +I 
Sbjct  90   AAVAHGDDQERLVLFDIRSHWSNAPALSSWDVSSPYCNWPGIRCSNGSVTSMSLPNINIT  149

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              IP   C L +LT LDLS N IP  FPT LY+CS
Sbjct  150  EPIPPFFCNLTSLTHLDLSYNEIPGGFPTCLYSCS  184



>gb|KEH27211.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=868

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ    + +ILL +K+ + NP  L  W  + TSS CSWPEI C+  SVT + +   +I  
Sbjct  17   SQLYNQEHEILLNIKKHFQNPSFLSHWIKSNTSSHCSWPEILCTKNSVTSLSMINTNITQ  76

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  +C LKNLT +D   N IPN FP  LYNCSK
Sbjct  77   TIPPFLCELKNLTYIDFQFNCIPNEFPKSLYNCSK  111



>emb|CDP08192.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDI  449
            A+   + + ++ ILL++K+ +GNPPSLE W  ++SSPC W EI CS G+V  I L   +I
Sbjct  5    AISPATRIEEQRILLKIKQIFGNPPSLESWKPSSSSPCDWLEISCSNGTVIYISLGRKNI  64

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             + +P  IC L NL  +DLS N+IP NFP  L +C K
Sbjct  65   STTLPRIICDLPNLQGIDLSDNHIPGNFPDFLCSCKK  101



>ref|XP_011019562.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
 ref|XP_011019563.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
 ref|XP_011019564.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
 ref|XP_011019565.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=1014

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIEC-SGGSVTGIFLKEYDIV  452
            VISQ   T+  ILL +K++ GNP S++ WN++SSPC W  + C   GSV+G+ L E +I 
Sbjct  27   VISQDANTENTILLNLKQQLGNPSSIQSWNSSSSPCDWTGVTCGDDGSVSGLDLGEKNIT  86

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
              IPA +C LKNLT L ++LNYIP  FP  LYNC+K
Sbjct  87   ETIPATVCDLKNLTFLYMNLNYIPGGFPKVLYNCTK  122



>ref|XP_006648474.1| PREDICTED: receptor-like protein kinase HSL1-like [Oryza brachyantha]
Length=1017

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +3

Query  312  LLEVKRRWGNPPSLEGW----NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            LL +KR WG+P +L  W    + +S  CSW  + C+ G VT +F   + I + IPA++C 
Sbjct  34   LLTIKRDWGSPAALSSWKVRNSGSSGHCSWAGVACTDGHVTALFFSSFQIANPIPASVCS  93

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            LKNL  LDLS N +  +FPT LYNCS
Sbjct  94   LKNLQYLDLSYNNLTGDFPTVLYNCS  119



>ref|XP_010924441.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=1057

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +3

Query  282  SQSPVTD--RDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYD  446
            SQ+   D  R ILL +++ WGNP  L  WN ++    C W  I+CS  GSVT I L   +
Sbjct  44   SQTKTEDGERQILLRIRKDWGNPSVLGSWNDSTPTGHCKWIGIQCSADGSVTTITLSNQN  103

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            I   IPA IC LKNL+ LDLS   IP  FPT LYNCS
Sbjct  104  IAQPIPAAICKLKNLSILDLSHTGIPGTFPTSLYNCS  140



>ref|XP_002278863.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=990

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 3/95 (3%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ    +R ILL+VK++ GNPPSL+ WN++SSPC WPEI+C+  +VT I L    I  
Sbjct  28   VISQD--DERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEIKCTDNTVTAISLHNKAISE  85

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LDLS N IP  FP  + NCSK
Sbjct  86   KIPATICDLKNLIVLDLSNNDIPGEFPN-ILNCSK  119



>ref|XP_010648289.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1008

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            VISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC W EI C    VT I L    I  
Sbjct  28   VISQNLDAERSILLDVKQQLGNPPSLQSWNSSSSPCDWSEITCIDNIVTEISLSYKTITK  87

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            +IPA IC LKNL  LD+S NYIP  FP  + NCSK
Sbjct  88   KIPARICDLKNLIVLDVSYNYIPGEFP-DILNCSK  121



>ref|XP_006596182.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Glycine max]
Length=883

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 4/94 (4%)
 Frame = +3

Query  288  SPVTDRD---ILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS-  455
            SPV  +D    LL +KR++G+PP+L  W ++S PC+WPEI CSGG VT + L   +I + 
Sbjct  25   SPVISQDQQTTLLGIKRQFGDPPALRSWKSSSPPCAWPEIRCSGGFVTELHLAGKNISAV  84

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            ++PA IC L +L  L+LS N I   FP  L NCS
Sbjct  85   QLPAAICDLAHLAHLNLSDNNIAGQFPAFLSNCS  118



>ref|XP_006853707.1| hypothetical protein AMTR_s00056p00148740 [Amborella trichopoda]
 gb|ERN15174.1| hypothetical protein AMTR_s00056p00148740 [Amborella trichopoda]
Length=1015

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS-SPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL++K++WGNPP L  WN+TS   C+W  I C   S+TGI L   +I  +IP +IC
Sbjct  38   EDQVLLKIKQQWGNPPPLLSWNSTSGHHCNWFGITCDSNSITGISLSNLNITEKIPDSIC  97

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNC  554
             LKNLT LD+S N I + FP  L+NC
Sbjct  98   DLKNLTHLDVSYNCITSEFPEVLFNC  123



>ref|XP_010047673.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W  + +SS C+WPE+ C  GS+T + L   +
Sbjct  29   VAESQIQDQEQQVLLKLRQSWQDPSSLDHWVTSNSSSHCTWPEVTCQDGSITELKLASLN  88

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNL  LDLS N IP  FPT LY CS+
Sbjct  89   INYSIPPFICNLKNLNKLDLSYNNIPGEFPTVLYYCSE  126



>ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=1032

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 4/94 (4%)
 Frame = +3

Query  288  SPVTDRD---ILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS-  455
            SPV  +D    LL +KR++G+PP+L  W ++S PC+WPEI CSGG VT + L   +I + 
Sbjct  25   SPVISQDQQTTLLGIKRQFGDPPALRSWKSSSPPCAWPEIRCSGGFVTELHLAGKNISAV  84

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            ++PA IC L +L  L+LS N I   FP  L NCS
Sbjct  85   QLPAAICDLAHLAHLNLSDNNIAGQFPAFLSNCS  118



>gb|KCW82572.1| hypothetical protein EUGRSUZ_C03972 [Eucalyptus grandis]
Length=433

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 65/98 (66%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL  W  + +SS C+WPEI C  GS+T + L   +
Sbjct  33   VAESRIQDQELQVLLKLRQSWQDPSSLAHWVTSNSSSHCTWPEITCQDGSITELGLINLN  92

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC L+NLT L++S N IP  FPT LYNCSK
Sbjct  93   INYSIPPFICDLENLTKLNVSDNKIPGEFPTVLYNCSK  130



>ref|XP_010047669.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++ + W +P SL+ W  + +SS C+WPEI C  GS+T + L   +
Sbjct  29   VAESQIQDQEQQVLLKLTQSWQDPSSLDHWVTSNSSSHCTWPEITCQDGSITELNLVNLN  88

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LDLS N IP  FPT LY CS+
Sbjct  89   INYSIPPFICDLKNLTKLDLSNNNIPGEFPTVLYYCSE  126



>ref|XP_008450784.1| PREDICTED: receptor-like protein kinase 5 [Cucumis melo]
Length=995

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            V SQ    +  +LL + R W N   +  W ++  S CSWPE++C+  SVT +F   Y++ 
Sbjct  29   VNSQLYQREHSVLLRINRFWKNQAPITHWLSSNVSHCSWPEVQCTNNSVTALFFSFYNLN  88

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              IP+ IC LKNLT LD  LN+    FPT LY+CS
Sbjct  89   GTIPSFICDLKNLTHLDFQLNFFTGGFPTALYSCS  123



>ref|XP_010911190.1| PREDICTED: receptor-like protein kinase HSL1, partial [Elaeis 
guineensis]
Length=482

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 5/98 (5%)
 Frame = +3

Query  282  SQSPVTD--RDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYD  446
            SQ+   D  + ILL +K+ WGNP +L  WN ++  S C+W  I CS  GS+T I L   +
Sbjct  24   SQTTTADGEKQILLRIKKDWGNPSALSSWNDSTFTSHCNWTGIGCSADGSITNITLVNQN  83

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IPA IC L++L+ LDLS NYI   FP  LYNCS 
Sbjct  84   ISQPIPATICDLRSLSILDLSYNYITTPFPKSLYNCSN  121



>ref|XP_008337667.1| PREDICTED: receptor-like protein kinase HSL1, partial [Malus 
domestica]
Length=1013

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW----NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +L ++K    +PP L  W    + TSS CSWPEI C+  SVT +FL   +I   +P+
Sbjct  30   EQAVLXKLKSYLNSPPFLSHWILSKSNTSSHCSWPEISCTNNSVTKLFLDNKNITLPVPS  89

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY+P  FP  +Y CSK
Sbjct  90   FICDLKNLTVIDLSYNYLPGAFPKAVYKCSK  120



>ref|XP_010051649.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=433

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 65/98 (66%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL  W  + +SS C+WPEI C  GS+T + L   +
Sbjct  33   VAESRIQDQELQVLLKLRQSWQDPSSLAHWVTSNSSSHCTWPEITCQDGSITELGLINLN  92

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC L+NLT L++S N IP  FPT LYNCSK
Sbjct  93   INYSIPPFICDLENLTKLNVSDNKIPGEFPTVLYNCSK  130



>ref|XP_010106712.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC11523.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1194

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  AVISQS-PVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYD  446
             V+SQ+    ++ +LL++K+ WGN   ++ W  + +S CSWP I C+  SV G+ L   +
Sbjct  201  GVLSQTLQEQEQSVLLKLKQHWGNISFMDEWTPSDNSHCSWPGITCTSNSVKGLSLYNVN  260

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   +P+ IC LKNLT +DL  NYIP  FP  ++NCSK
Sbjct  261  ITGPVPSFICDLKNLTTIDLGDNYIPGEFPRAVFNCSK  298


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  AVISQS-PVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYD  446
             V+SQ+    ++ +LL++K+ WGN   ++ W  + +S CSWP I C+  SV G+ L   +
Sbjct  25   GVLSQTLQEQEQSVLLKLKQHWGNISFMDEWTPSDNSHCSWPGITCTSNSVKGLSLYNVN  84

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   +P+ IC LKN+T ++L  NYIP  FP  ++NCSK
Sbjct  85   ITGPVPSFICDLKNVTTINLGDNYIPGEFPRAVFNCSK  122



>dbj|BAD17641.1| putative CLAVATA1 receptor kinase [Oryza sativa Japonica Group]
 gb|EAZ22278.1| hypothetical protein OsJ_05934 [Oryza sativa Japonica Group]
Length=993

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSP-CSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  ILLE+K  WG+ P+L  WN+T++  C+W  I C+ G+V GI L     +  IP +IC
Sbjct  34   EHQILLELKNHWGSSPALGRWNSTTTAHCNWEGITCTNGAVIGISLPNQTFIKPIPPSIC  93

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT LDLS N    +FPT LYNCS
Sbjct  94   LLKNLTRLDLSYNNFSTSFPTMLYNCS  120



>gb|AFW85121.1| hypothetical protein ZEAMMB73_943636 [Zea mays]
Length=791

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +3

Query  309  ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIEC-SGGSVTGIFLKEYDIVSEIPANICG  479
            +LL++KR WG+PP L GWNA+  S+ C+WP + C + GSVTG+ L + ++    P  + G
Sbjct  32   LLLQIKRAWGDPPVLAGWNASAASAHCTWPYVACDTAGSVTGLALADANVSGPFPDAVGG  91

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            L  LT LD+S N I   FPT LY C+
Sbjct  92   LAGLTHLDISNNSITGAFPTTLYRCA  117



>gb|KJB54274.1| hypothetical protein B456_009G027700 [Gossypium raimondii]
Length=1005

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSP---CSWPEIECSGGSVTGIFLKEYDIVSEIPAN  470
            ++ IL+ +K+ W NP S+  W  +++    CSWPEI C   SVT + L   +I   IP+ 
Sbjct  34   EQAILINLKQYWQNPSSISHWTLSANSTNHCSWPEITCINNSVTALGLPNKNINGTIPSF  93

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            ICGL+NL +LDL+ NYI   FP  LYNCSK
Sbjct  94   ICGLQNLASLDLNYNYIIGEFPKTLYNCSK  123



>dbj|BAD17639.1| putative CLAVATA1 receptor kinase [Oryza sativa Japonica Group]
Length=997

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSP-CSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  ILLE+KR WG+ P L  W++ S+  C+W  I C+ G VTGI L     +  IP +IC
Sbjct  34   EHQILLEIKRHWGSSPVLGRWSSNSAAHCNWGGITCTDGVVTGISLPNQTFIKPIPPSIC  93

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT LD+S N I + FPT LYNCS
Sbjct  94   LLKNLTHLDVSYNNISSPFPTMLYNCS  120



>gb|KGN66179.1| hypothetical protein Csa_1G574950 [Cucumis sativus]
Length=371

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            V SQ    +  +LL +   W N   +  W  + +S CSW E++C+  SVTG+    Y++ 
Sbjct  42   VNSQLYQQEHSVLLRLNHFWQNQAPISHWLTSNASHCSWTEVQCTNNSVTGLIFSSYNLN  101

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              IP+ IC LKNLT L+L  N+I   FPT LY+CS
Sbjct  102  GTIPSFICDLKNLTHLNLHFNFITGTFPTTLYHCS  136



>gb|EAZ22277.1| hypothetical protein OsJ_05933 [Oryza sativa Japonica Group]
Length=997

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSP-CSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  ILLE+KR WG+ P L  W++ S+  C+W  I C+ G VTGI L     +  IP +IC
Sbjct  34   EHQILLEIKRHWGSSPVLGRWSSNSAAHCNWGGITCTDGVVTGISLPNQTFIKPIPPSIC  93

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT LD+S N I + FPT LYNCS
Sbjct  94   LLKNLTHLDVSYNNISSPFPTMLYNCS  120



>ref|XP_010110882.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC28701.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1055

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  273  AVISQS-PVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYD  446
             V+SQ+    ++ +LL++K+ WGN   ++ W  + +S CSWP I C+  SV G+ L   +
Sbjct  25   GVLSQTLQEQEQSVLLKLKQHWGNISFMDEWTPSDNSHCSWPGITCTSNSVKGLSLNNVN  84

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   +P+ IC LKNL  +DL  NYIP  FP  ++NCSK
Sbjct  85   ITGPVPSFICDLKNLATIDLGDNYIPGEFPRAVFNCSK  122



>ref|XP_010050467.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Eucalyptus grandis]
Length=456

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W  + +SS C+WPEI C   S+T + L   +
Sbjct  29   VAESQIQDQEQQVLLKLRQSWRDPSSLDHWVTSNSSSHCTWPEITCLDNSITVLNLVNLN  88

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNLT LDLS N IP  FPT LY CS+
Sbjct  89   INYSIPPFICDLKNLTKLDLSYNNIPGEFPTVLYYCSE  126



>ref|XP_004513052.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=908

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            + + L+++K  + NP  L  W ++ SS CSWPEI C   S+T + +   +I   +P  +C
Sbjct  33   EHETLMKIKNYFHNPFFLSHWTSSNSSHCSWPEIICKNDSITSLSMINTNITQTLPIFLC  92

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKNLT +D  LNYIP  FP  LYNCSK
Sbjct  93   DLKNLTHIDFQLNYIPKEFPKSLYNCSK  120



>ref|XP_008657242.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Zea mays]
Length=1025

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +3

Query  309  ILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIEC-SGGSVTGIFLKEYDIVSEIPANICG  479
            +LL++KR WG+PP L GWNA+  S+ C+WP + C + GSVTG+ L + ++    P  + G
Sbjct  32   LLLQIKRAWGDPPVLAGWNASAASAHCTWPYVACDTAGSVTGLALADANVSGPFPDAVGG  91

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            L  LT LD+S N I   FPT LY C+
Sbjct  92   LAGLTHLDISNNSITGAFPTTLYRCA  117



>ref|XP_004513051.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1012

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            + + L+++K  + NP  L  W ++ SS CSWPEI C   S+T + +   +I   +P  +C
Sbjct  33   EHETLMKIKNYFHNPFFLSHWTSSNSSHCSWPEIICKNDSITSLSMINTNITQTLPIFLC  92

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKNLT +D  LNYIP  FP  LYNCSK
Sbjct  93   DLKNLTHIDFQLNYIPKEFPKSLYNCSK  120



>ref|XP_009415190.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1066

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = +3

Query  303  RDILLEVKRRWGNPPSLEGWNATS-------SPCSWPEIECSG-GSVTGIFLKEYD---I  449
            + ILL +KR WG  P+L+ WN  +       S C WP + C+  GSV  I L   D   I
Sbjct  69   QQILLRIKREWGGEPALDSWNVDTTNTSSSFSYCDWPGVGCADDGSVVNITLSGQDAPKI  128

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
               IPA++CGLKNLT LD+S N IP  FPT LYNCS
Sbjct  129  SRPIPASLCGLKNLTRLDVSYNNIPGPFPTSLYNCS  164



>ref|XP_003516786.2| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1013

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL +K+   NPP L  W  + SS C+WPEI C+ GSVT + +   +I   +P  +C
Sbjct  39   EHAVLLRIKQHLQNPPFLNHWTPSNSSHCTWPEISCTNGSVTSLTMINTNITQTLPPFLC  98

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             L NLT +D   N+IP  FP  LYNCSK
Sbjct  99   DLTNLTHVDFQWNFIPGEFPKYLYNCSK  126



>gb|KCW79615.1| hypothetical protein EUGRSUZ_C009681, partial [Eucalyptus grandis]
Length=421

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            SQ    ++ +LL++++ W +P SL+ W  + +SS C+WPEI C   S+T + L   +I  
Sbjct  15   SQIQDQEQQVLLKLRQSWRDPSSLDHWVTSNSSSHCTWPEITCLDNSITVLNLVNLNINY  74

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IP  IC LKNLT LDLS N IP  FPT LY CS+
Sbjct  75   SIPPFICDLKNLTKLDLSYNNIPGEFPTVLYYCSE  109



>ref|XP_010047254.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79116.1| hypothetical protein EUGRSUZ_C00557 [Eucalyptus grandis]
Length=1020

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  279  ISQSPVTDRD--ILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            +++S + D++  +LL++++ W +P SL+ W  + +SS C+WPEI C  GS+T + L   +
Sbjct  29   VAESQIQDQEQQVLLKLRQSWRDPSSLDHWVTSKSSSHCTWPEITCQDGSITELNLVNLN  88

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP  IC LKNL  LDLS N I   FPT LY CS+
Sbjct  89   INYSIPPFICDLKNLNKLDLSYNNIHGEFPTVLYYCSE  126



>ref|XP_008795523.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Phoenix dactylifera]
Length=314

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSS--PCSWPEIECSG-GSVTGIFLKEYDIVSEIPAN  470
            +R ILL ++  WG P  L  WN ++S   C+W  I CS  GSVT I L    I   IP  
Sbjct  32   ERQILLRIREDWGKPSVLSAWNDSTSTNHCNWTGIGCSAHGSVTEITLVNESISQPIPTT  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            IC L++L+ LDLS NYI  +FPT LYNCS
Sbjct  92   ICELRSLSFLDLSDNYITTSFPTSLYNCS  120



>ref|XP_009628517.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 isoform X3 [Nicotiana tomentosiformis]
Length=710

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = +3

Query  303  RDILLEVKRRWGNPPSLEG-WNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            R ILL++K   GN   ++  WN +SSPC+WPEI CS G + GI L EY  ++ IP  IC 
Sbjct  3    RPILLKLKSYLGNTSDIQQRWNLSSSPCTWPEISCSRGFIIGINL-EYQYLAAIPPIICK  61

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            LKNLT L L+  ++   FPT +YNCSK
Sbjct  62   LKNLTHLILASTFLSGAFPTVVYNCSK  88



>ref|XP_009628514.1| PREDICTED: receptor-like protein kinase 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628515.1| PREDICTED: receptor-like protein kinase 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=770

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = +3

Query  303  RDILLEVKRRWGNPPSLEG-WNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            R ILL++K   GN   ++  WN +SSPC+WPEI CS G + GI L EY  ++ IP  IC 
Sbjct  3    RPILLKLKSYLGNTSDIQQRWNLSSSPCTWPEISCSRGFIIGINL-EYQYLAAIPPIICK  61

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            LKNLT L L+  ++   FPT +YNCSK
Sbjct  62   LKNLTHLILASTFLSGAFPTVVYNCSK  88



>ref|XP_009628516.1| PREDICTED: receptor-like protein kinase 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=765

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = +3

Query  303  RDILLEVKRRWGNPPSLEG-WNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            R ILL++K   GN   ++  WN +SSPC+WPEI CS G + GI L EY  ++ IP  IC 
Sbjct  3    RPILLKLKSYLGNTSDIQQRWNLSSSPCTWPEISCSRGFIIGINL-EYQYLAAIPPIICK  61

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCSK  560
            LKNLT L L+  ++   FPT +YNCSK
Sbjct  62   LKNLTHLILASTFLSGAFPTVVYNCSK  88



>ref|XP_008242543.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=938

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L + +I   +P 
Sbjct  37   EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVDMNITLSVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY P  FP  LYNCSK
Sbjct  97   FICDLKNLTLVDLSYNYFPGEFPKALYNCSK  127



>gb|KJB65638.1| hypothetical protein B456_010G104300 [Gossypium raimondii]
 gb|KJB65639.1| hypothetical protein B456_010G104300 [Gossypium raimondii]
Length=1018

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
             ISQ    +R +LL++K++  NPPS+  WN++SSPC WPEI C+ GSVT + L++ +I  
Sbjct  20   AISQDINAERTLLLKLKQQLDNPPSIGSWNSSSSPCDWPEINCTAGSVTEVHLRDKNITV  79

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +P  ICGLKNLT LDL  N+IP  FP  LYNCSK
Sbjct  80   RVPPTICGLKNLTVLDLWDNFIPGEFPI-LYNCSK  113



>ref|XP_007203859.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
 gb|EMJ05058.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
Length=1016

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L + +I   +P 
Sbjct  37   EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWGPEINCTNNSVTGLSLVDTNITLSVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY P  FP  LYNCSK
Sbjct  97   FICDLKNLTLIDLSYNYFPGEFPKALYNCSK  127



>ref|XP_008390812.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW----NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PPSL  W    + TSS CSWPEI C+  SVTG+ L   +I   +P 
Sbjct  38   EQAVLLKLKSYLDSPPSLSHWIPSNSNTSSHCSWPEISCTNNSVTGLLLVNLNITLPVPP  97

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC L NLT +DL+ NY+   FP  LY CSK
Sbjct  98   FICDLTNLTLVDLNXNYLXGEFPKSLYKCSK  128



>ref|XP_008789188.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=1035

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIVSE  458
            S S   ++  LL++K  WGNP +L  WN + ++ C+W  I C  G VT IFL    +  +
Sbjct  40   STSQEDEKRTLLKIKADWGNPSALSSWNNSAATHCNWTGILCDDGFVTEIFLSNQGLAEQ  99

Query  459  IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            IP  +C  KNL+ LDLS N +P  FPT LY CS
Sbjct  100  IPPAMCDFKNLSYLDLSYNNLPGPFPTTLYKCS  132



>ref|XP_008362962.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Malus domestica]
Length=1018

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW----NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PPSL  W    + TSS CSWPEI C+  SVTG+ L   +I   +P 
Sbjct  37   EQAVLLKLKSYLXSPPSLSHWIPSNSNTSSHCSWPEISCTNNSVTGLLLVNLNITLPVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC L NLT +DL+ NY+   FP  LY CSK
Sbjct  97   FICDLTNLTLVDLNXNYLXGEFPKSLYKCSK  127



>ref|XP_004951399.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1075

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +3

Query  279  ISQSPVTDRDILLEVKRRWGNPPSLEGWNA-TSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            ++Q   +D + LL VK+ WG+P +L  W +  SS CSW  + C+ G VT +    ++I +
Sbjct  72   MAQINSSDYETLLTVKKAWGSPSALSSWTSQNSSYCSWAGVSCNNGRVTKLSFPNFNITN  131

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             IPA+IC LKNL+ LDLS N + ++FP  +Y CS
Sbjct  132  PIPASICSLKNLSYLDLSYNNLTDHFPIVIYGCS  165



>ref|XP_009352556.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1023

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW----NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    +  SS CSWPEI C+  SVT +FL   +I   +P+
Sbjct  40   EQAVLLKLKSYLNSPPFLSHWILSKSNASSHCSWPEISCTNYSVTKLFLDNKNITLPVPS  99

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY+   FP  +Y CSK
Sbjct  100  FICDLKNLTVIDLSYNYLTGAFPKAVYKCSK  130



>dbj|BAJ98312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=917

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            +R +L+++K  WG+PP+L  WN +   C+WP + C  G VT + L    +    P  I G
Sbjct  34   ERRLLMQIKGVWGDPPALAAWNGSGDHCTWPHVTCDAGRVTSLSLGNTGVAGPFPDAIGG  93

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            L +LT+L++S N + + FPT LY C+
Sbjct  94   LSSLTSLNISYNNVNDTFPTSLYRCA  119



>gb|EAY85092.1| hypothetical protein OsI_06444 [Oryza sativa Indica Group]
Length=477

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +3

Query  312  LLEVKRRWGNPPSLEGW---NATS-SPCSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            LL +KR WG+P +L  W   N++S S C+W  I C  G VT +    + I + IPA+IC 
Sbjct  290  LLTIKRDWGSPAALSSWKVRNSSSFSHCNWAGIGCRNGQVTSLSFHNFQIANLIPASICS  349

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            LKNL  LDLS N +   FPT LY+CS
Sbjct  350  LKNLKYLDLSFNNLTGEFPTALYSCS  375



>gb|KHN24418.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=352

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSP-CSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL +K+   +PP L  W +TSS  CSWPEI C+  SVT + L + +I   IP  IC
Sbjct  27   EHAVLLNIKQYLQDPPFLSHWTSTSSSHCSWPEILCTTNSVTSLNLSQSNINRTIPPFIC  86

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            GL NLT LD S N+IP  FPT LYNCSK
Sbjct  87   GLTNLTHLDFSFNFIPGGFPTPLYNCSK  114



>ref|XP_003548595.1| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1011

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 5/100 (5%)
 Frame = +3

Query  276  VISQSPVTDRD--ILLEVKRRWGNPPSLEGWNA--TSSPCSWPEIEC-SGGSVTGIFLKE  440
            V SQ+ + D++  +L+ +KR   NP  L  W    T+S C+WPEI C S  SVTG+ L  
Sbjct  20   VHSQTQLQDQEHAVLMNIKRHLKNPSFLSHWTTSNTASHCTWPEITCTSDYSVTGLTLVN  79

Query  441  YDIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +I   +P  +C LKNLT ++ S N+IP  FPT LY CSK
Sbjct  80   SNITQTLPPFMCDLKNLTLVNFSRNFIPGEFPTFLYKCSK  119



>gb|KHN16977.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1011

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 5/100 (5%)
 Frame = +3

Query  276  VISQSPVTDRD--ILLEVKRRWGNPPSLEGWNA--TSSPCSWPEIEC-SGGSVTGIFLKE  440
            V SQ+ + D++  +L+ +KR   NP  L  W    T+S C+WPEI C S  SVTG+ L  
Sbjct  20   VHSQTQLQDQEHAVLMNIKRHLKNPSFLSHWTTSNTASHCTWPEITCTSDYSVTGLTLVN  79

Query  441  YDIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             +I   +P  +C LKNLT ++ S N+IP  FPT LY CSK
Sbjct  80   SNITQTLPPFMCDLKNLTLVNFSRNFIPGEFPTFLYKCSK  119



>ref|XP_007152973.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
 gb|ESW24967.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
Length=1005

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 59/98 (60%), Gaps = 3/98 (3%)
 Frame = +3

Query  276  VISQSPVTDRD--ILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYD  446
            V SQ+ + D++  +LL +K+   NP  L  W  + +S CSWPEI C+  SVTG+ L    
Sbjct  18   VHSQTQLQDQEHAVLLRIKQHLQNPSFLTHWTPSNTSHCSWPEITCTSDSVTGLTLFNSG  77

Query  447  IVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   +P  +C LKNLT ++ S N IP  FPT LY CSK
Sbjct  78   IHQTLPNFLCDLKNLTHVNFSTNSIPGEFPTFLYKCSK  115



>emb|CBI20589.3| unnamed protein product [Vitis vinifera]
Length=516

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            +ISQ+   +R ILL+VK++ GNPPSL+ WN++SSPC WPEI C+  ++  I L    I  
Sbjct  28   IISQNLHDERSILLDVKQQLGNPPSLQSWNSSSSPCDWPEITCTNNTIIAISLHNKTIRE  87

Query  456  EIPANICGLKNLTALDLSLNYIP----NNF  533
            +IPA IC LKNL  LDLS NYIP    NNF
Sbjct  88   KIPATICDLKNLIILDLSNNYIPDLTANNF  117



>ref|XP_010050392.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1011

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +3

Query  282  SQSPVTDRDI--LLEVKRRWGNPPSLEGWNATSSP--CSWPEIECSGGSVTGIFLKEYDI  449
            ++S + D+++  LL++++ W +  SL  W A+ S   C+WPEI+C  G +T + L   +I
Sbjct  34   AESQIQDQELQMLLKLRKSWQDLSSLNHWVASYSSFHCAWPEIKCQEGLITELNLTNLNI  93

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
               IP  IC LKNLT LDLS N I   FPT LYNCSK
Sbjct  94   NYSIPPFICDLKNLTKLDLSYNNITGEFPTVLYNCSK  130



>gb|EAY85088.1| hypothetical protein OsI_06443 [Oryza sativa Indica Group]
Length=1003

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  312  LLEVKRRWGNPPSLEGWNATSSP----CSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            LL +KR WG+P +   W   SS     C W  + C+ G VT +  + + I + IPA+IC 
Sbjct  32   LLTIKRHWGSPAAFSSWEVRSSNSFGYCDWVGVACTDGQVTSLSFQSFQIANPIPASICS  91

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            LKNL  LDLS N +  +FPT LYNCS
Sbjct  92   LKNLKYLDLSYNNLTGDFPTVLYNCS  117



>emb|CDM84035.1| unnamed protein product [Triticum aestivum]
Length=665

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIEC--SGGSVTGIFLKEYDIVSEIPANI  473
            +R  L+++KR WG+PP L  WN +S  C+WP + C  S G VT + L    +    P  I
Sbjct  31   ERHSLMQIKRAWGDPPVLAAWNGSSDHCTWPYVTCDASSGRVTSLSLANTGVAGPFPDAI  90

Query  474  CGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             GL  LT+L++S N I + FPT LY C+
Sbjct  91   GGLSRLTSLNISNNDITSAFPTSLYRCA  118



>ref|XP_007013027.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30646.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
Length=1097

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPAN  470
            ++ IL+E+KR W NP S+  W   + +S  CSWPEI C   SV  + L    I   IP++
Sbjct  44   EQAILIELKRHWQNPSSINHWIPSSNSSYHCSWPEITCINNSVAELHLANKTIGVTIPSS  103

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            IC LK LT++DL+ N +   FP  LYNCSK
Sbjct  104  ICDLKKLTSIDLNYNNLVGKFPKTLYNCSK  133



>ref|XP_007013028.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
 gb|EOY30647.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
Length=1019

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPAN  470
            ++ IL+E+KR W NP S+  W   + +S  CSWPEI C   SV  + L    I   IP++
Sbjct  44   EQAILIELKRHWQNPSSINHWIPSSNSSYHCSWPEITCINNSVAELHLANKTIGVTIPSS  103

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            IC LK LT++DL+ N +   FP  LYNCSK
Sbjct  104  ICDLKKLTSIDLNYNNLVGKFPKTLYNCSK  133



>ref|XP_010924676.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=864

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYDIVSEIPAN  470
            +R ILL +K  WGNP  L  WN ++  S C W  I+CS  GSVT I L   +I   IPA 
Sbjct  32   ERQILLRIKEDWGNPSVLSSWNDSTPISHCKWTGIQCSSDGSVTNISLVNQNITQPIPAA  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            I  LK+L+ LDLS N   ++FPT LYNCS
Sbjct  92   IGKLKSLSFLDLSYNNFTSSFPTSLYNCS  120



>dbj|BAD25862.1| putative LRR receptor-like kinase [Oryza sativa Japonica Group]
 gb|EAZ22308.1| hypothetical protein OsJ_05962 [Oryza sativa Japonica Group]
 dbj|BAH01630.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1004

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +3

Query  312  LLEVKRRWGNPPSLEGWNATSSP----CSWPEIECSGGSVTGIFLKEYDIVSEIPANICG  479
            LL +KR WG P +   W   SS     C W  + C+ G VT +  + + I + IPA+IC 
Sbjct  32   LLTIKRHWGRPAAFSSWEVRSSNSFGYCDWVGVACTDGQVTSLSFQSFQIANPIPASICS  91

Query  480  LKNLTALDLSLNYIPNNFPTGLYNCS  557
            LKNL  LDLS N +  +FPT LYNCS
Sbjct  92   LKNLKYLDLSYNNLTGDFPTVLYNCS  117



>ref|XP_010910700.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Elaeis 
guineensis]
Length=934

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYDIVSEIPAN  470
            +R  LL +K  W NP  L  WN ++  S C+W  IECS  G VT I L + +I   IPA 
Sbjct  32   ERQTLLRIKEDWRNPSVLSSWNDSTPTSHCNWTGIECSADGFVTNIALVDQNITQPIPAA  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            +C LKNL+ LDL  N I  +FPT LYNCS
Sbjct  92   VCKLKNLSILDLGDNDITGSFPTSLYNCS  120



>ref|XP_007137253.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
 gb|ESW09247.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
Length=1018

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 7/98 (7%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIEC-SGGSVTGIFLKEYDI  449
            VIS+   T++ ILL +KR+ G+PPSL  W  + S+PC W EI C S G+VT + L    I
Sbjct  24   VISE---TEQTILLTLKRQLGDPPSLRSWKPSPSAPCDWTEIGCGSDGAVTKLLLSSKGI  80

Query  450  VSE--IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             +   +P+ IC LKNL  LDLS N I   FPT LY CS
Sbjct  81   TTSKSLPSTICNLKNLLMLDLSNNSIAGEFPTTLYECS  118



>ref|XP_010910701.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Elaeis 
guineensis]
Length=895

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYDIVSEIPAN  470
            +R  LL +K  W NP  L  WN ++  S C+W  IECS  G VT I L + +I   IPA 
Sbjct  32   ERQTLLRIKEDWRNPSVLSSWNDSTPTSHCNWTGIECSADGFVTNIALVDQNITQPIPAA  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            +C LKNL+ LDL  N I  +FPT LYNCS
Sbjct  92   VCKLKNLSILDLGDNDITGSFPTSLYNCS  120



>ref|XP_010910702.1| PREDICTED: receptor-like protein kinase HSL1 isoform X3 [Elaeis 
guineensis]
Length=894

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIECSG-GSVTGIFLKEYDIVSEIPAN  470
            +R  LL +K  W NP  L  WN ++  S C+W  IECS  G VT I L + +I   IPA 
Sbjct  32   ERQTLLRIKEDWRNPSVLSSWNDSTPTSHCNWTGIECSADGFVTNIALVDQNITQPIPAA  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            +C LKNL+ LDL  N I  +FPT LYNCS
Sbjct  92   VCKLKNLSILDLGDNDITGSFPTSLYNCS  120



>ref|XP_010050469.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1021

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGW--NATSSPCSWPEIECSGGSVTGIFLKEYD  446
            A  SQ    +  +L ++++ W +P SL+ W  + +SS C+W EI+C  GS+T + L + +
Sbjct  33   AAESQIQYQELQVLSKLRQSWQDPSSLDHWVTSNSSSHCAWHEIKCQEGSITELNLVDLN  92

Query  447  IVSEIPA-NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            I   IP   IC LKNLT L+LS N IP  FPT LYNCSK
Sbjct  93   INYSIPPPFICDLKNLTKLNLSYNNIPGEFPTVLYNCSK  131



>ref|XP_010915378.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1033

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIVSE  458
            S S   ++  LL++K  WG+P +L  WN + ++ CSWP I C    VT I L    + + 
Sbjct  40   STSQEDEKRTLLKIKADWGSPSNLSSWNNSAANYCSWPGIRCVDSFVTEISLSNQGLAAP  99

Query  459  IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            IP  +CGLKNL+ LDLS N +P  FPT LY CS
Sbjct  100  IPPAVCGLKNLSFLDLSYNNLPGPFPTTLYKCS  132



>ref|XP_004251639.1| PREDICTED: receptor-like protein kinase 5 [Solanum lycopersicum]
Length=1008

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  QSPVTDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIP  464
            Q+P  ++ ILL++K+ W   P++  W ++S+ CSW  I C+  SV+GI +   +I   IP
Sbjct  23   QTPNQEKAILLQLKQYWFTSPNVTKWISSSNHCSWEGIICTQNSVSGIQIPYGNISKPIP  82

Query  465  ANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
              IC LKNLT LD + N+IP NFP  +YNCS
Sbjct  83   NFICDLKNLTFLDFNHNFIPGNFPD-IYNCS  112



>ref|XP_004969910.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1052

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATSSP--CSWPEIEC-SGGSVTGIFLKEY  443
            A     P  +  +LLE+KR WG+PP+L GWNAT +   CSWP + C + G V  + L   
Sbjct  31   AAAQSPPAGEARVLLEIKRAWGDPPALAGWNATDAATLCSWPHVGCDAAGRVVNLTLANA  90

Query  444  DIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            ++    P  +  L  LT LD+S N I   FPT LY C+
Sbjct  91   NVAGPFPDAVGDLTGLTYLDVSSNNITGVFPTTLYRCA  128



>ref|XP_004135804.1| PREDICTED: receptor-like protein kinase 5-like [Cucumis sativus]
Length=921

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL +   W N   +  W  + +S CSW E++C+  SVTG+    Y++   IP+ IC
Sbjct  20   EHSVLLRLNHFWQNQAPISHWLTSNASHCSWTEVQCTNNSVTGLIFSSYNLNGTIPSFIC  79

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT L+L  N+I   FPT LY+CS
Sbjct  80   DLKNLTHLNLHFNFITGTFPTTLYHCS  106


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL + + W N   +  W ++  S CSWPE++C+  SVT +F   Y++   IP+ I 
Sbjct  308  EHSVLLRLNQFWKNQAPITHWLSSNVSHCSWPEVQCTNNSVTALFFPSYNLNGTIPSFIS  367

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNC  554
             LKNLT L+  +NY    FPT LY+C
Sbjct  368  DLKNLTYLNFQVNYFTGGFPTTLYSC  393



>ref|XP_004157305.1| PREDICTED: receptor-like protein kinase 5-like [Cucumis sativus]
Length=1267

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL +   W N   +  W  + +S CSW E++C+  SVTG+    Y++   IP+ IC
Sbjct  20   EHSVLLRLNHFWQNQAPISHWLTSNASHCSWTEVQCTNNSVTGLIFSSYNLNGTIPSFIC  79

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT L+L  N+I   FPT LY+CS
Sbjct  80   DLKNLTHLNLHFNFITGTFPTTLYHCS  106


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL + + W N   +  W ++  S CSWPE++C+  SVT +F   Y++   IP+ I 
Sbjct  308  EHSVLLRLNQFWKNQAPITHWLSSNVSHCSWPEVQCTNNSVTALFFPSYNLNGTIPSFIS  367

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNC  554
             LKNLT L+  +NY    FPT LY C
Sbjct  368  DLKNLTYLNFQVNYFTGGFPTTLYTC  393



>ref|XP_004969911.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1044

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIEC-SGGSVTGIFLKEYDIVSEIPAN  470
            D  +LLE+KR WG+PP L GWNA++  + C+WP + C + G V  + L   ++    P  
Sbjct  32   DARLLLEIKRAWGDPPVLAGWNASAAGAHCAWPYVACDTAGRVVNLTLASANVAGPFPDA  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            + GL  LT LD+S N I   FPT LY CS
Sbjct  92   VGGLTGLTYLDVSSNNITGVFPTALYRCS  120



>gb|EYU30701.1| hypothetical protein MIMGU_mgv1a000689mg [Erythranthe guttata]
Length=1017

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG-GSVTGIFLKEYDIVSEIPANIC  476
            ++ ILL +K++W NP SL  W  +S  C+WPEI C+   SVT + L     ++EIP +IC
Sbjct  35   EQAILLTLKQQWSNPASLSHWTPSSDHCTWPEITCTATSSVTKLELIN-KTIAEIPPSIC  93

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             L+NLT +DL  N I   FPT LYNC+
Sbjct  94   RLENLTHIDLQWNEITGIFPTALYNCT  120



>ref|XP_008242547.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Prunus mume]
Length=979

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L   +I   +P 
Sbjct  37   EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNTNITLPVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY P  FP   YNCSK
Sbjct  97   FICDLKNLTLIDLSYNYFPGEFPKAFYNCSK  127



>ref|XP_008794105.1| PREDICTED: receptor-like protein kinase 5 [Phoenix dactylifera]
Length=1033

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 53/94 (56%), Gaps = 4/94 (4%)
 Frame = +3

Query  288  SPVTDRDILLEVKRRWGNPPSLEGWN----ATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            S   D+  LL++K  WGNPP+L  W+    A    C+W  I C+ GSVT I L E  I  
Sbjct  37   SQEDDKRTLLKIKADWGNPPALSSWSNSGGAAGDHCNWDGILCTNGSVTDISLGEQSITG  96

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             I   IC LKNL+ LDL  N +   FPT LYNCS
Sbjct  97   PISPAICDLKNLSLLDLHDNDLSGPFPTILYNCS  130



>ref|XP_008354538.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1016

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW----NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + TSS CSWPEI C+  SVTG+ L + +I   +P 
Sbjct  35   EQAVLLKLKSYLQSPPFLSHWIPSNSNTSSHCSWPEISCTNNSVTGLSLVBLNITLPVPP  94

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC L NLT +DL+ NY+   FP  LY CSK
Sbjct  95   FICDLTNLTXVDLNYNYLXGEFPKSLYKCSK  125



>ref|XP_010925541.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1033

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN--ATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            S SP  ++  LL++K  WGNPP+L  W+   T   C W  I C+ GS+T I L   +I  
Sbjct  40   STSPEDEKQTLLKIKAGWGNPPALGSWSNSGTRDHCDWAGILCTNGSITEISLPAQNITG  99

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             IP  IC LKNL  LDL  N +   FP  LYNC+
Sbjct  100  PIPPAICDLKNLFILDLPYNDLSGPFPITLYNCT  133



>gb|KHN16979.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=744

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL++K+   NPP L  W ++ SS C+WPEI C+ GSVT + +   +I   +P  +C
Sbjct  37   EHAVLLKIKQYLQNPPFLNHWTSSNSSHCTWPEISCTNGSVTSLSMINTNITQTLPPFLC  96

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             L NLT +D   N+IP  F   LY CSK
Sbjct  97   DLTNLTHVDFQWNFIPGEFLKSLYKCSK  124



>ref|XP_006599802.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=718

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNAT-SSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  +LL++K+   NPP L  W ++ SS C+WPEI C+ GSVT + +   +I   +P  +C
Sbjct  34   EHAVLLKIKQYLQNPPFLNHWTSSNSSHCTWPEISCTNGSVTSLSMINTNITQTLPPFLC  93

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             L NLT +D   N+IP  F   LY CSK
Sbjct  94   DLTNLTHVDFQWNFIPGEFLKSLYKCSK  121



>ref|XP_004512684.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1025

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 58/102 (57%), Gaps = 9/102 (9%)
 Frame = +3

Query  282  SQSPV----TDRDILLEVKRRWGN----PPSLEGWN-ATSSPCSWPEIECSGGSVTGIFL  434
            SQSP      +  +LL +K+   N    P  L  W  + S+ CSW EI C+  SVTGI L
Sbjct  33   SQSPQLYYNQEHKLLLNIKQYLQNQNQNPSFLSHWIPSNSNHCSWNEITCTNDSVTGITL  92

Query  435  KEYDIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             + +I   IP  IC LKNLT +D S N+IP +FP   YNCSK
Sbjct  93   SKINITKTIPPFICDLKNLTHVDFSFNFIPGDFPKIFYNCSK  134



>ref|XP_002437153.1| hypothetical protein SORBIDRAFT_10g022060 [Sorghum bicolor]
 gb|EER88520.1| hypothetical protein SORBIDRAFT_10g022060 [Sorghum bicolor]
Length=1051

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +3

Query  297  TDRDILLEVKRRWGNPPSLEGWNATSSP--CSWPEIECS---GGSVTGIFLKEYDIVSEI  461
            +DRD LL VK+ WGNPP L+ W+  ++P  C+W  + C+   GG VT + L    +   +
Sbjct  35   SDRDKLLAVKKDWGNPPQLKSWDPAAAPNHCNWTGVRCATGGGGVVTELILPGLKLTGSV  94

Query  462  PANICGLKNLTALDLSLNYIPNNFP-TGLYNC  554
            PA++C L++LT LDLS N +   FP   LY+C
Sbjct  95   PASVCALESLTRLDLSYNNLTGAFPGAALYSC  126



>ref|XP_008659674.1| PREDICTED: receptor-like protein kinase 5 [Zea mays]
 gb|AFW86925.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1047

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECS---GGSVTGIFLKEYDI  449
            + +  +DRD LL VK+ WG+PP L+ W+ A  + C+W  + C+   GG V+G+ L    +
Sbjct  32   AAASTSDRDTLLAVKKDWGSPPQLKTWDPAAPNHCNWTGVTCATGGGGVVSGLTLSSMKL  91

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFP-TGLYNCS  557
               +PA++C LK+LT LDLS + +  +FP   LY C+
Sbjct  92   TGSVPASVCALKSLTHLDLSYDNLTGDFPGAALYACA  128



>ref|XP_010915380.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1034

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIVSE  458
            S S   ++  LL++K  WGNP +L  WN + ++ C+WP I C+ G VT I L    +   
Sbjct  40   STSQEDEKRTLLKIKADWGNPSNLSSWNNSAANYCNWPGIRCADGFVTEISLGYQGLAEP  99

Query  459  IPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            IP  +C LKNL+ LDLS N +   FPT LY CS
Sbjct  100  IPPAVCDLKNLSYLDLSCNNLTGPFPTALYKCS  132



>ref|XP_009415677.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1024

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = +3

Query  303  RDILLEVKRRWGNPPSLEGWNATSSP--CSWPEIECSG-GSVTGIFLKEYD---IVSEIP  464
            + ILL +KR WG  P+L+ WN  +S   C W  + C+  GSV  I L + +   I   IP
Sbjct  35   KQILLRIKREWGGEPALDSWNVDTSTTYCQWQGVGCAADGSVVNITLSDQNGTRITRPIP  94

Query  465  ANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            A++C LKNLT LDLS   I   FPT LY+CS
Sbjct  95   ASLCDLKNLTHLDLSYQRIHTRFPTSLYDCS  125



>ref|XP_004971946.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=499

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIEC-SGGSVTGIFLKEYDIVSEIPAN  470
            D  +LLE+KR WG+PP L GWNA++  + C+WP + C + G V  + L   ++    P  
Sbjct  32   DAWLLLEIKRAWGDPPVLAGWNASAAGAHCAWPYVACDTAGRVVNLTLASANVAGPFPDA  91

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            + GL  LT LD+S N I   FPT LY CS 
Sbjct  92   VGGLTGLTYLDVSSNNITGVFPTTLYRCSA  121



>ref|XP_004513050.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1014

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            + + L+++K+ + NP  L  W ++ +S CSW EI C+ GS+T + L + +I   IP  IC
Sbjct  35   EHETLMKLKQHFENPSKLTHWISSNTSHCSWQEIICTNGSITQLNLFDTNINQTIPPFIC  94

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKNLT +D + N+IP  FPT L NCSK
Sbjct  95   DLKNLTHVDFNNNFIPGMFPTYLNNCSK  122



>tpg|DAA57705.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1054

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +3

Query  273  AVISQSPVTDRDILLEVKRRWGNPPSLEGWNATS--SPCSWPEIEC-SGGSVTGIFLKEY  443
            A     P  D+ +LL +K  WG+PP+L  WNA+S  +PC+W  + C + G VT + L   
Sbjct  30   AGAQSQPADDKHLLLRIKSAWGDPPALAVWNASSPGAPCAWTFVGCDTAGRVTNLTLGSA  89

Query  444  DIVSEIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             +    P  + GL  LT LD+S N I   FPT LY C+
Sbjct  90   GVAGPFPDAVGGLSALTHLDVSNNSISGAFPTALYRCA  127



>ref|XP_010669046.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=950

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +3

Query  351  LEGWNATSSPCSWPEIEC-SGGSVTGIFLKEYDIVSEIPANICGLKNLTALDLSLNYIPN  527
            ++ W+AT+  CSW  I C SG +VTGI     +I  EIP +IC LKNLT LDL  N IP 
Sbjct  1    MDSWSATTPVCSWIGINCTSGNTVTGISFNSQNIGGEIPPSICDLKNLTILDLGNNSIPG  60

Query  528  NFPTGLYNCSK  560
            NFPT LYNC+K
Sbjct  61   NFPTFLYNCTK  71



>ref|XP_002456337.1| hypothetical protein SORBIDRAFT_03g034220 [Sorghum bicolor]
 gb|EES01457.1| hypothetical protein SORBIDRAFT_03g034220 [Sorghum bicolor]
Length=1044

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +3

Query  288  SPVTDR-DILLEVKRRWGNPPSLEGWNATSSPCSWPEIEC-SGGSVTGIFLKEYDIVSEI  461
            +P  D   +LL++KR WG+PP L GWNA+ + C+WP + C + G VT + L + ++    
Sbjct  34   APAADEAHLLLQIKRAWGDPPVLAGWNASDAHCAWPYVGCDTAGRVTNLTLADVNVSGPF  93

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            P  +  L  LT L++S N I + FP+ LY C+
Sbjct  94   PDAVGELAGLTYLNVSNNSIADVFPSTLYRCA  125



>ref|XP_007203052.1| hypothetical protein PRUPE_ppa022950mg [Prunus persica]
 gb|EMJ04251.1| hypothetical protein PRUPE_ppa022950mg [Prunus persica]
Length=656

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L    I   +P 
Sbjct  37   EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWQPEITCTNNSVTGLSLVNTKITLPVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY    FP   YNCSK
Sbjct  97   FICDLKNLTLIDLSYNYFAGEFPKAFYNCSK  127



>ref|XP_009416472.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1014

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWN--ATSSPCSWPEIECSG-GSVTGIFLKEY---DIVSEI  461
            ++ ILL++KR W + P L  WN   TSS C+W  + C+  GSV  I L       I   I
Sbjct  34   EKRILLQIKREWRDQPVLASWNDTTTSSYCAWTGVGCAADGSVANITLSGQTTPKISQPI  93

Query  462  PANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            P ++C L+NL+ LDLS N IP +FPT LYNCS
Sbjct  94   PNSLCSLRNLSYLDLSYNNIPGSFPTSLYNCS  125



>ref|XP_008242544.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1858

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L   +I   +P 
Sbjct  37   EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWQPEITCTNNSVTGLSLVNTNITLPVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY    FP   YNCSK
Sbjct  97   FICDLKNLTLIDLSYNYFAGEFPKAFYNCSK  127


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L   +I   +P 
Sbjct  879  EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWQPEITCTNNSVTGLSLVHTNITLSVPP  938

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNL  +DLS N     FP   YNCSK
Sbjct  939  FICDLKNLILIDLSYNNFAGEFPKAFYNCSK  969



>ref|XP_009803852.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=709

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +3

Query  297  TDRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSG--GSVTGIFLKEYDIVSEIPAN  470
            T++ +LL +K+ W NP   + W+   SPCSW  + C    G VT + L   +I   IP+ 
Sbjct  24   TEKSVLLSLKQHWSNPEIFQSWDLKYSPCSWSGVSCMNGFGRVTQLVLGGNNITGTIPST  83

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
            IC LKNLT +DLS N I    P  L +CSK
Sbjct  84   ICQLKNLTLIDLSNNNIFGTIPVSLMDCSK  113



>ref|XP_007013026.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY30645.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1006

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query  297  TDRDILLEVKRRWGNPPSLEGW---NATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPA  467
            +++ +LL++K  W NPPS   W   + +SS CSWPEI C   SVTG+ L    I   IP 
Sbjct  34   SEQALLLKLKTYWQNPPSFNHWAPSSNSSSHCSWPEITCLNDSVTGLTLANKGINEAIPP  93

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT++DL+ N +   FP  LYNCSK
Sbjct  94   FICDLKNLTSIDLNYNNLVGEFPKTLYNCSK  124



>gb|KGN66180.1| hypothetical protein Csa_1G574960 [Cucumis sativus]
Length=996

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +3

Query  276  VISQSPVTDRDILLEVKRRWGNPPSLEGW-NATSSPCSWPEIECSGGSVTGIFLKEYDIV  452
            V SQ    +  +LL + + W N   +  W ++  S CSWPE++C+  SVT +F   Y++ 
Sbjct  29   VNSQLYQQEHSVLLRLNQFWKNQAPITHWLSSNVSHCSWPEVQCTNNSVTALFFPSYNLN  88

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFPTGLYNC  554
              IP+ I  LKNLT L+  +NY    FPT LY+C
Sbjct  89   GTIPSFISDLKNLTYLNFQVNYFTGGFPTTLYSC  122



>emb|CDI66500.1| putative hypothetical protein [Saccharum hybrid cultivar R570]
 emb|CDI66506.1| putative hypothetical protein [Saccharum hybrid cultivar R570]
Length=1010

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  279  ISQSPVTDRDILLEVKRRWGNPPSLEGWNA-TSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            ++Q+  ++   LL +K+ WGNP +L  W++  +S CSW  + C    V+ +    ++  +
Sbjct  1    MAQTDASELATLLTIKKDWGNPSALSSWSSQNASYCSWKGVRCVNSQVSALSFPNFNTTN  60

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             +P +IC LKNL+ LDLS N +   FPT LY CS
Sbjct  61   PVPNSICLLKNLSCLDLSYNNLTGQFPTALYGCS  94



>emb|CDI66503.1| putative hypothetical protein [Saccharum hybrid cultivar R570]
Length=1006

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  279  ISQSPVTDRDILLEVKRRWGNPPSLEGWNA-TSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            ++Q+  ++   LL +K+ WGNP +L  W++  +S CSW  + C    V+ +    ++  +
Sbjct  1    MAQTDASELATLLTIKKDWGNPSALSSWSSQNASYCSWKGVRCVNSQVSALSFPNFNTTN  60

Query  456  EIPANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
             +P +IC LKNL+ LDLS N +   FPT LY CS
Sbjct  61   PVPNSICLLKNLSYLDLSYNNLTGQFPTALYGCS  94



>gb|EMT32870.1| Receptor-like protein kinase HSL1 [Aegilops tauschii]
Length=1149

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSS-PCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  ILL ++R WG+ P L  W+ TSS  C W  I C+ G VT I L +      IP ++C
Sbjct  57   EHQILLGLERYWGSSPVLGRWSLTSSNHCKWGGITCTDGLVTAISLPQQTFRKPIPPSLC  116

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNLT LDLS N    +FPT LYNCS
Sbjct  117  LLKNLTNLDLSYNNFSTSFPTILYNCS  143



>ref|XP_009415678.1| PREDICTED: receptor-like protein kinase 5 [Musa acuminata subsp. 
malaccensis]
Length=1029

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 6/91 (7%)
 Frame = +3

Query  303  RDILLEVKRRWGNPPSLEGWNAT--SSPCSWPEIECSG-GSVTGIFLKEYD---IVSEIP  464
            + ILL +KR WG  P+L+ WN    ++ C W  + C+  GSV  I L +     I   IP
Sbjct  35   KRILLRIKREWGGEPALDSWNVDNPTTYCKWLGVGCAADGSVVNITLSDQTWTRITRPIP  94

Query  465  ANICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            A++C LKNLT LDLS   I   FPT LYNCS
Sbjct  95   ASLCDLKNLTHLDLSYQRIHTRFPTSLYNCS  125



>gb|EMT25886.1| Receptor-like protein kinase HSL1 [Aegilops tauschii]
Length=650

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSS-PCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            +  ILL +KR WG+   L  WN+ SS  C W  + C+ G VT I L +  ++  IP ++C
Sbjct  34   EHQILLGLKRYWGSSTVLGRWNSISSDHCRWGGLTCTKGEVTAISLPQQTLMKPIPPSLC  93

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LKNL  LDLS N    +FPT LYNCS
Sbjct  94   LLKNLAYLDLSYNNFSTSFPTILYNCS  120



>ref|XP_008649140.1| PREDICTED: receptor-like protein kinase 5 [Zea mays]
 gb|AFW76496.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1043

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query  297  TDRDILLEVKRRWGNPPSLEGWNATSSP--CSWPEIECSGGS---VTGIFLKEYDIVSEI  461
            +DRD LL VK+ WG+PP L+ W+  ++P  C+W  + C+ G    VT + L    +   +
Sbjct  36   SDRDTLLAVKKAWGSPPQLKSWDPAAAPDHCNWTGVTCATGGVGVVTELILSRQKLTGSV  95

Query  462  PANICGLKNLTALDLSLNYIPNNFP-TGLYNCSK  560
            PA +C L +LT LDLS N +   FP   LY C++
Sbjct  96   PAPVCALASLTHLDLSYNNLTGAFPGAALYACAR  129



>ref|XP_009759980.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana sylvestris]
Length=1042

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +3

Query  300  DRDILLEVKRRWG--NPPSLEGWNATSSPCSWPEIECS-GGSVTGIFLKEYDIVSEIPAN  470
            ++ ILL++K+++   +P  L  W ++S  C+WPEI C+   SV+ I L   +I   IP  
Sbjct  62   EKTILLQLKQQFSTTSPFFLNHWTSSSDHCTWPEISCTHDNSVSAIRLVNLNISKPIPPF  121

Query  471  ICGLKNLTALDLSLNYIPNNFPTGLYNCS  557
            IC LKNLT LD++ N IP  FPT LYNCS
Sbjct  122  ICDLKNLTFLDVNYNIIPGPFPTLLYNCS  150



>ref|XP_006387571.1| hypothetical protein POPTR_0830s00200g, partial [Populus trichocarpa]
 gb|ERP46485.1| hypothetical protein POPTR_0830s00200g, partial [Populus trichocarpa]
Length=589

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWN-ATSSPCSWPEIECSGGSVTGIFLKEYDIVSEIPANIC  476
            ++ ILL +K+ W NP SL+ W  ++SS C+WP + C+  S+T + L   DI   IP  I 
Sbjct  32   EQAILLRLKQYWQNPSSLDRWTPSSSSHCTWPGVACANNSITQLLLDNKDITGTIPPFIS  91

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             LKNL  L+ S N I   FP  +YN SK
Sbjct  92   DLKNLKVLNFSNNSIIGKFPVAVYNFSK  119



>ref|XP_007203222.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
 gb|EMJ04421.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
Length=1018

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L   +I   +P 
Sbjct  37   EQAVLLKIKSYLQSPPFLSHWIPSTSNTSHCSWQPEITCTNNSVTGLSLVHTNITLPVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS N     FP   YNCSK
Sbjct  97   FICDLKNLTLIDLSYNNFAGEFPKAFYNCSK  127



>gb|EMS68150.1| Receptor-like protein kinase HSL1 [Triticum urartu]
Length=939

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 7/100 (7%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN--ATSSPCSWPEIECSGGS----VTGIFLKEY  443
            SQ    D+  LL +K+ WG+P  L  W+  A +  CSW  + C G      VTG+ L++ 
Sbjct  23   SQPASGDQATLLAIKKGWGDPAQLASWDPAAHADHCSWTGVACEGAGAGRVVTGLSLQKL  82

Query  444  DIVSEIPANICGLKNLTALDLSLNYIPNNFP-TGLYNCSK  560
            +I  E+P ++C L NL  LDLS N +   FP   LY C++
Sbjct  83   NISGEVPGSVCDLANLARLDLSYNNLTGAFPGAALYRCAR  122



>ref|XP_007204807.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
 gb|EMJ06006.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
Length=1018

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGW---NATSSPCSW-PEIECSGGSVTGIFLKEYDIVSEIPA  467
            ++ +LL++K    +PP L  W    + +S CSW PEI C+  SVTG+ L   +I   +P 
Sbjct  37   EQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNMNITLPVPP  96

Query  468  NICGLKNLTALDLSLNYIPNNFPTGLYNCSK  560
             IC LKNLT +DLS NY    FP    NCSK
Sbjct  97   FICDLKNLTLIDLSYNYFAGEFPKAFNNCSK  127



>ref|XP_006656162.1| PREDICTED: receptor-like protein kinase 5-like [Oryza brachyantha]
Length=1036

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 10/97 (10%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWN---ATSSPCSWPEIECSGG------SVTGIFLKEYDIV  452
            DRD L+ +++ WGNPP L  W+   A +  CSW  + CS G      +VT + L++ ++ 
Sbjct  26   DRDTLVALRKAWGNPPKLASWDPATAATDHCSWQGVTCSDGTGGGGRAVTELSLRDMNLT  85

Query  453  SEIPANICGLKNLTALDLSLNYIPNNFP-TGLYNCSK  560
              +PA +C L +LT LDLS N +   FP   LY CS+
Sbjct  86   GTVPAAVCDLPSLTRLDLSGNNLSGAFPAAALYRCSR  122



>gb|EMS60554.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Triticum 
urartu]
Length=900

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query  309  ILLEVKRRWGNPPSLEGWNATSSPCSWPEIEC-SGGSVTGIFLKEYDIVSEIPANICGLK  485
            +L+++K  WG+PP L  WN +   C+W  + C + G VTG+ L    +    P  I GL 
Sbjct  35   LLMQIKSVWGDPPVLAAWNGSGDHCTWSYVTCDASGRVTGLHLANTGVAGPFPDAIGGLS  94

Query  486  NLTALDLSLNYIPNNFPTGLYNCS  557
             LT+L++S N I   FPT LY C+
Sbjct  95   GLTSLNISSNNITGAFPTSLYRCA  118



>ref|XP_004245388.2| PREDICTED: receptor-like protein kinase 2 [Solanum lycopersicum]
Length=807

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  300  DRDILLEVKRRWGNPPSLEGWNATSSPCSWPEIECSGGSVTGIFLKEYDI-VSEIPANIC  476
            +++ILLE+K+ WG       W++ SS C W  I+C  GSVT I +++ ++    IP  +C
Sbjct  87   EKNILLELKQVWGFEKL---WDSNSSHCDWYGIDCRNGSVTSISIQDVNLHTGTIPPILC  143

Query  477  GLKNLTALDLSLNYIPNNFPTGLYNCS  557
             LK+L  +DL  NYI   FPT LYNCS
Sbjct  144  ELKSLYLIDLKTNYIRGEFPTSLYNCS  170



>gb|ACR61377.1| putative serine-threonine protein kinase [Hordeum vulgare subsp. 
vulgare]
Length=520

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 57/98 (58%), Gaps = 5/98 (5%)
 Frame = +3

Query  282  SQSPVTDRDILLEVKRRWGNPPSLEGWN--ATSSPCSWPEIECSGG--SVTGIFLKEYDI  449
            SQ    D+D LL +K+ WGNP  L  W+  A +  C+W  + CS G  +VTGI L    +
Sbjct  25   SQPTSGDQDTLLAIKQDWGNPTHLHSWDPVANADHCNWTGVVCSDGERAVTGISLPGLKL  84

Query  450  VSEIPANICGLKNLTALDLSLNYIPNNFPTG-LYNCSK  560
              ++P ++C L +LT LDLS N +   FP   LY+CS+
Sbjct  85   SGKVPESLCHLPSLTHLDLSYNNLTGEFPGAQLYDCSQ  122



>ref|XP_002451877.1| hypothetical protein SORBIDRAFT_04g009110 [Sorghum bicolor]
 gb|EES04853.1| hypothetical protein SORBIDRAFT_04g009110 [Sorghum bicolor]
Length=1022

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 13/95 (14%)
 Frame = +3

Query  312  LLEVKRRWGNPPSLEGW------------NATSSPCSWPEIECSGGSVTGIFLKEYDIVS  455
            LL +K+ WGNP +L  W            +A+S+ C W  I C+ G VT +  + ++I  
Sbjct  32   LLTMKKDWGNPAALRSWKMSNRSSETTAASASSTHCRWAGIACTNGQVTALSFQNFNISR  91

Query  456  EIPANICGLKNLTALDLSLNYIPNNFP-TGLYNCS  557
             IPA+IC L+NLT +DLS N +   FP   LY CS
Sbjct  92   PIPASICSLRNLTYIDLSHNNLTGEFPAAALYGCS  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840