BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012O19

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    196   3e-55   Nicotiana tomentosiformis
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    193   2e-54   Solanum tuberosum [potatoes]
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    191   2e-53   
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    187   4e-52   Nicotiana sylvestris
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    181   5e-52   Nicotiana tabacum [American tobacco]
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    182   2e-50   Nicotiana sylvestris
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    182   3e-50   Nicotiana tomentosiformis
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  172   4e-50   Citrus sinensis [apfelsine]
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    181   4e-50   Sesamum indicum [beniseed]
emb|CAN77623.1|  hypothetical protein VITISV_007589                     165   3e-48   Vitis vinifera
ref|XP_002298197.2|  beta-glucosidase family protein                    175   8e-48   
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     175   1e-47   Tarenaya hassleriana [spider flower]
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              174   1e-47   Populus tremula x Populus alba [gray poplar]
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    174   2e-47   Citrus sinensis [apfelsine]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             174   2e-47   Citrus clementina [clementine]
ref|XP_002303181.1|  beta-glucosidase family protein                    174   2e-47   
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    173   4e-47   Populus euphratica
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    172   6e-47   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    172   7e-47   Populus euphratica
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    172   1e-46   
gb|EPS65933.1|  hypothetical protein M569_08842                         172   1e-46   Genlisea aurea
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      171   1e-46   Solanum lycopersicum
ref|XP_002513707.1|  Beta-glucosidase, putative                         171   2e-46   Ricinus communis
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         171   2e-46   Jatropha curcas
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    171   3e-46   Nelumbo nucifera [Indian lotus]
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              170   3e-46   Populus tremula x Populus alba [gray poplar]
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    171   3e-46   Solanum tuberosum [potatoes]
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    170   4e-46   
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    170   4e-46   Pyrus x bretschneideri [bai li]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    170   5e-46   
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    170   6e-46   
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    169   1e-45   Eucalyptus grandis [rose gum]
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    169   1e-45   Vitis vinifera
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    169   2e-45   Medicago sativa subsp. x varia
emb|CBI40687.3|  unnamed protein product                                168   2e-45   Vitis vinifera
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                168   2e-45   Brassica rapa
emb|CDY18705.1|  BnaA09g06900D                                          168   2e-45   Brassica napus [oilseed rape]
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    168   3e-45   Vitis vinifera
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    167   4e-45   Cicer arietinum [garbanzo]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    167   4e-45   Medicago truncatula
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      167   4e-45   Morus notabilis
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                167   5e-45   Erythranthe guttata [common monkey flower]
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    167   5e-45   Eucalyptus grandis [rose gum]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    167   7e-45   
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             167   7e-45   Phaseolus vulgaris [French bean]
ref|XP_007043027.1|  Beta-D-xylosidase 4                                167   9e-45   
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    166   1e-44   Arabis alpina [alpine rockcress]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    166   1e-44   Nelumbo nucifera [Indian lotus]
emb|CDY46812.1|  BnaC02g43200D                                          166   2e-44   Brassica napus [oilseed rape]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             166   2e-44   Capsella rubella
emb|CDX81229.1|  BnaC09g06400D                                          166   2e-44   
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             165   3e-44   Eutrema salsugineum [saltwater cress]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    165   3e-44   Gossypium raimondii
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           165   3e-44   Gossypium arboreum [tree cotton]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    164   6e-44   Glycine max [soybeans]
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             164   8e-44   Prunus persica
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                164   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    164   1e-43   Eucalyptus grandis [rose gum]
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    163   1e-43   Glycine max [soybeans]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                163   2e-43   Brassica rapa
emb|CDY31313.1|  BnaA02g34280D                                          163   2e-43   Brassica napus [oilseed rape]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                163   2e-43   Camelina sativa [gold-of-pleasure]
ref|NP_201262.1|  beta-D-xylosidase 4                                   163   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866623.1|  beta-xylosidase 4                                  163   2e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    163   2e-43   
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                162   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     163   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    162   4e-43   Sesamum indicum [beniseed]
gb|KCW63061.1|  hypothetical protein EUGRSUZ_G006532                    151   4e-43   Eucalyptus grandis [rose gum]
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    161   9e-43   Sesamum indicum [beniseed]
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    161   1e-42   Prunus mume [ume]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             160   1e-42   Phaseolus vulgaris [French bean]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   2e-42   Fragaria vesca subsp. vesca
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   2e-42   Fragaria vesca subsp. vesca
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    159   4e-42   Elaeis guineensis
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    159   7e-42   
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    158   1e-41   Eucalyptus grandis [rose gum]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    158   1e-41   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    158   2e-41   
emb|CDY51290.1|  BnaA06g23560D                                          157   3e-41   Brassica napus [oilseed rape]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     157   3e-41   Brassica rapa
emb|CDY56487.1|  BnaCnng30450D                                          157   3e-41   Brassica napus [oilseed rape]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            157   4e-41   Raphanus sativus
emb|CDY52884.1|  BnaC06g27770D                                          151   4e-41   Brassica napus [oilseed rape]
ref|NP_196535.1|  beta-xylosidase 3                                     156   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    156   4e-41   Arabis alpina [alpine rockcress]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          156   7e-41   Amborella trichopoda
ref|XP_002873418.1|  beta-xylosidase 3                                  155   1e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    155   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    154   3e-40   Cicer arietinum [garbanzo]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             154   3e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                154   3e-40   Camelina sativa [gold-of-pleasure]
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           148   5e-40   Glycine soja [wild soybean]
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          153   7e-40   Camelina sativa [gold-of-pleasure]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    153   7e-40   Gossypium raimondii
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        153   9e-40   Medicago truncatula
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          153   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   2e-39   Fragaria vesca subsp. vesca
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           152   2e-39   Gossypium arboreum [tree cotton]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    151   3e-39   Beta vulgaris subsp. vulgaris [field beet]
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    151   4e-39   Medicago sativa subsp. x varia
emb|CDY21595.1|  BnaC09g46970D                                          152   4e-39   Brassica napus [oilseed rape]
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   5e-39   
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                150   9e-39   Erythranthe guttata [common monkey flower]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                150   9e-39   Erythranthe guttata [common monkey flower]
emb|CDY01780.1|  BnaC06g28200D                                          150   1e-38   
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   2e-38   Eucalyptus grandis [rose gum]
emb|CDX97115.1|  BnaC09g45100D                                          149   2e-38   
emb|CDX96113.1|  BnaA07g26180D                                          150   2e-38   
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                149   2e-38   Brassica rapa
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   3e-38   Glycine max [soybeans]
dbj|BAJ89945.1|  predicted protein                                      146   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY35825.1|  BnaC09g37570D                                          148   4e-38   Brassica napus [oilseed rape]
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                148   4e-38   Brassica rapa
emb|CDX69892.1|  BnaA10g22410D                                          148   4e-38   
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                147   1e-37   Camelina sativa [gold-of-pleasure]
dbj|BAJ90420.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32951.1|  Beta-D-xylosidase 4                                     147   2e-37   
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    145   7e-37   Hordeum vulgare [barley]
gb|ABR17218.1|  unknown                                                 135   8e-37   Picea sitchensis
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                143   2e-36   
ref|XP_009629820.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     134   3e-36   Nicotiana tomentosiformis
ref|XP_009629821.1|  PREDICTED: beta-D-xylosidase 1-like isoform X2     133   4e-36   Nicotiana tomentosiformis
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                142   1e-35   Erythranthe guttata [common monkey flower]
ref|NP_001054038.1|  Os04g0640700                                       141   1e-35   
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          141   2e-35   Sorghum bicolor [broomcorn]
ref|XP_003615012.1|  Auxin-induced beta-glucosidase                     132   3e-35   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          139   3e-35   Nicotiana sylvestris
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              140   3e-35   Selaginella moellendorffii
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             140   3e-35   Selaginella moellendorffii
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     140   3e-35   
emb|CAJ86028.1|  B0414F07.1                                             135   3e-35   Oryza sativa [red rice]
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            140   5e-35   Cucumis melo [Oriental melon]
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     139   5e-35   Setaria italica
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       137   6e-35   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          139   7e-35   Nicotiana sylvestris
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          139   8e-35   Amborella trichopoda
gb|EYU44008.1|  hypothetical protein MIMGU_mgv1a0207571mg               131   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_002515300.1|  Beta-glucosidase, putative                         138   1e-34   Ricinus communis
ref|XP_003615011.1|  Beta-D-xylosidase                                  129   2e-34   
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                137   5e-34   
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                       130   5e-34   Gossypium arboreum [tree cotton]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    137   5e-34   
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            136   1e-33   Prunus mume [ume]
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like                130   1e-33   
emb|CAE03635.1|  OSJNBb0003B01.27                                       135   2e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CDP18762.1|  unnamed protein product                                132   3e-33   Coffea canephora [robusta coffee]
gb|EYU23815.1|  hypothetical protein MIMGU_mgv1a0042532mg               130   4e-33   Erythranthe guttata [common monkey flower]
ref|XP_003625957.1|  Beta-xylosidase                                    134   4e-33   Medicago truncatula
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                134   4e-33   Brachypodium distachyon [annual false brome]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         134   5e-33   Jatropha curcas
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       134   6e-33   Cucumis sativus [cucumbers]
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    134   6e-33   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          134   6e-33   Medicago truncatula
gb|KJB38536.1|  hypothetical protein B456_006G259500                    132   8e-33   Gossypium raimondii
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             134   8e-33   Prunus persica
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    132   9e-33   Medicago truncatula
gb|AES97966.2|  glycoside hydrolase family 3 protein                    133   9e-33   Medicago truncatula
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          133   1e-32   
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             133   1e-32   Selaginella moellendorffii
ref|XP_003592512.1|  Xylosidase                                         133   1e-32   Medicago truncatula
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             133   1e-32   Selaginella moellendorffii
ref|XP_004170761.1|  PREDICTED: beta-D-xylosidase 1-like                127   2e-32   
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         132   2e-32   Jatropha curcas
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       132   2e-32   Cicer arietinum [garbanzo]
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            132   3e-32   Populus euphratica
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    132   3e-32   Medicago truncatula
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            132   3e-32   Vitis vinifera
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            132   3e-32   Populus euphratica
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             132   3e-32   
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            130   3e-32   Glycine soja [wild soybean]
gb|KJB38535.1|  hypothetical protein B456_006G259500                    132   3e-32   Gossypium raimondii
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     131   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            131   4e-32   Camelina sativa [gold-of-pleasure]
gb|KJB77632.1|  hypothetical protein B456_012G147500                    131   4e-32   Gossypium raimondii
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              131   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            131   5e-32   Eucalyptus grandis [rose gum]
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       131   5e-32   Gossypium arboreum [tree cotton]
emb|CBI19138.3|  unnamed protein product                                132   5e-32   Vitis vinifera
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            131   5e-32   Nicotiana sylvestris
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            131   6e-32   Elaeis guineensis
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       131   6e-32   Solanum lycopersicum
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            131   7e-32   Vitis vinifera
emb|CDY15255.1|  BnaC05g01340D                                          130   7e-32   Brassica napus [oilseed rape]
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       130   7e-32   
gb|ACD93208.1|  beta xylosidase                                         130   8e-32   Camellia sinensis [black tea]
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     130   8e-32   Sesamum indicum [beniseed]
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       130   8e-32   Solanum tuberosum [potatoes]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       130   9e-32   Glycine max [soybeans]
emb|CDY00033.1|  BnaC09g02680D                                          130   9e-32   
gb|AAS17751.2|  beta xylosidase                                         130   9e-32   Fragaria x ananassa
emb|CDP17081.1|  unnamed protein product                                129   1e-31   Coffea canephora [robusta coffee]
emb|CBI22460.3|  unnamed protein product                                131   1e-31   Vitis vinifera
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                130   1e-31   Brassica rapa
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              130   1e-31   Fragaria vesca subsp. vesca
emb|CAN82161.1|  hypothetical protein VITISV_035506                     131   1e-31   Vitis vinifera
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             130   1e-31   
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            130   1e-31   
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            130   1e-31   Brassica rapa
emb|CDX89954.1|  BnaA10g01280D                                          130   1e-31   
gb|KJB16241.1|  hypothetical protein B456_002G219100                    130   1e-31   Gossypium raimondii
gb|KJB72795.1|  hypothetical protein B456_011G198200                    130   1e-31   Gossypium raimondii
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            130   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002527511.1|  Beta-glucosidase, putative                         130   1e-31   Ricinus communis
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            130   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    130   2e-31   Ricinus communis
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7            127   2e-31   
ref|XP_002885319.1|  beta-1,4-xylosidase                                130   2e-31   
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       125   2e-31   Morus notabilis
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            130   2e-31   Glycine max [soybeans]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            130   2e-31   Glycine soja [wild soybean]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            130   2e-31   Nicotiana tomentosiformis
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            130   2e-31   Populus euphratica
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             129   2e-31   Phaseolus vulgaris [French bean]
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  130   2e-31   
gb|KJB59941.1|  hypothetical protein B456_009G282000                    128   2e-31   Gossypium raimondii
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              129   3e-31   Prunus mume [ume]
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          129   3e-31   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              129   3e-31   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                129   3e-31   Phoenix dactylifera
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              129   3e-31   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              129   3e-31   
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            129   3e-31   Camelina sativa [gold-of-pleasure]
dbj|BAF00595.1|  xylosidase                                             125   3e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KJB09457.1|  hypothetical protein B456_001G143600                    129   3e-31   Gossypium raimondii
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             129   3e-31   
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             129   3e-31   Prunus persica
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              129   3e-31   Gossypium arboreum [tree cotton]
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       129   4e-31   Solanum lycopersicum
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                129   4e-31   Solanum tuberosum [potatoes]
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            129   4e-31   Fragaria vesca subsp. vesca
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            129   4e-31   Sesamum indicum [beniseed]
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              129   4e-31   Populus euphratica
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    128   5e-31   Cucumis melo [Oriental melon]
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            128   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            128   5e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              128   6e-31   Gossypium arboreum [tree cotton]
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       128   6e-31   Solanum tuberosum [potatoes]
gb|KJB59940.1|  hypothetical protein B456_009G282000                    128   6e-31   Gossypium raimondii
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            128   6e-31   Populus euphratica
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            128   6e-31   Sesamum indicum [beniseed]
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  128   6e-31   Populus tremula x Populus alba [gray poplar]
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             128   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             128   6e-31   Capsella rubella
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            128   7e-31   Nelumbo nucifera [Indian lotus]
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    128   7e-31   Cucumis melo [Oriental melon]
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             128   7e-31   Phaseolus vulgaris [French bean]
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            128   7e-31   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            128   7e-31   
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                  122   7e-31   Citrus sinensis [apfelsine]
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             128   8e-31   Capsella rubella
ref|XP_002311398.2|  beta-D-xylosidase family protein                   128   8e-31   
emb|CDY49607.1|  BnaA09g03310D                                          128   8e-31   Brassica napus [oilseed rape]
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            128   8e-31   Fragaria vesca subsp. vesca
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             128   9e-31   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            127   9e-31   Glycine soja [wild soybean]
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    128   9e-31   Vitis vinifera
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             128   9e-31   Phaseolus vulgaris [French bean]
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        129   9e-31   
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        129   9e-31   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730          128   9e-31   
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             127   9e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010534139.1|  PREDICTED: probable beta-D-xylosidase 7            119   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        129   9e-31   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                127   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              127   1e-30   
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    127   1e-30   Arabis alpina [alpine rockcress]
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           127   1e-30   Prunus salicina [Japanese plum]
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                127   1e-30   Erythranthe guttata [common monkey flower]
emb|CDY05634.1|  BnaC02g39030D                                          127   1e-30   
emb|CDY33913.1|  BnaA02g30740D                                          127   1e-30   Brassica napus [oilseed rape]
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              127   1e-30   Vitis vinifera
emb|CAN72807.1|  hypothetical protein VITISV_033721                     122   1e-30   Vitis vinifera
ref|XP_010094323.1|  Beta-D-xylosidase 1                                127   1e-30   Morus notabilis
emb|CBI22910.3|  unnamed protein product                                127   1e-30   Vitis vinifera
ref|XP_003591420.1|  Beta xylosidase                                    127   1e-30   Medicago truncatula
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            127   1e-30   
dbj|BAG28345.1|  arabinofuranosidase                                    127   1e-30   
ref|NP_188596.1|  putative beta-D-xylosidase 5                          127   1e-30   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         127   1e-30   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       127   1e-30   
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         127   1e-30   
dbj|BAB02547.1|  beta-1,4-xylosidase                                    127   1e-30   
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             127   2e-30   
gb|KDO87029.1|  hypothetical protein CISIN_1g0041902mg                  118   2e-30   
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       127   2e-30   
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          127   2e-30   
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         127   2e-30   
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    127   2e-30   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          127   2e-30   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                127   2e-30   
ref|NP_563659.1|  probable beta-D-xylosidase 2                          127   2e-30   
ref|XP_003594795.1|  Beta xylosidase                                    127   2e-30   
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            127   2e-30   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    127   2e-30   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            127   2e-30   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    127   2e-30   
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                126   3e-30   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                126   3e-30   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            126   3e-30   
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             126   3e-30   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       126   3e-30   
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            126   3e-30   
ref|XP_002316021.1|  beta-D-xylosidase family protein                   126   3e-30   
ref|NP_196618.1|  putative beta-D-xylosidase 6                          126   3e-30   
gb|KHN43468.1|  Putative beta-D-xylosidase 2                            126   3e-30   
emb|CDY67410.1|  BnaCnng54810D                                          124   4e-30   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       126   4e-30   
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     125   4e-30   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    126   4e-30   
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg                125   4e-30   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            126   4e-30   
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   124   4e-30   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             125   4e-30   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            126   4e-30   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            125   4e-30   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                125   5e-30   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       125   5e-30   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             125   5e-30   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     125   5e-30   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       125   5e-30   
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       125   5e-30   
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    125   6e-30   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            125   6e-30   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                125   6e-30   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                125   6e-30   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             125   7e-30   
gb|AAF17692.1|AC009243_19  F28K19.27                                    125   7e-30   
emb|CDO98788.1|  unnamed protein product                                125   7e-30   
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                125   7e-30   
emb|CDY58860.1|  BnaCnng33860D                                          125   7e-30   
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                125   7e-30   
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     125   7e-30   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             125   7e-30   
gb|AAP83934.1|  auxin-induced beta-glucosidase                          125   8e-30   
gb|EPS70883.1|  hypothetical protein M569_03875                         125   8e-30   
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            125   8e-30   
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                125   8e-30   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            125   8e-30   
ref|XP_002865732.1|  beta-xylosidase 1                                  125   8e-30   
ref|NP_177929.1|  putative beta-D-xylosidase 7                          125   8e-30   
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           125   8e-30   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     125   8e-30   
emb|CDX85405.1|  BnaC07g27160D                                          125   8e-30   
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            125   9e-30   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    125   1e-29   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             125   1e-29   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             125   1e-29   
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            125   1e-29   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                125   1e-29   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            125   1e-29   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             124   1e-29   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             125   1e-29   
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   124   1e-29   
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             124   1e-29   
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       124   1e-29   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              124   1e-29   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               124   1e-29   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          124   1e-29   
dbj|BAF79669.1|  beta-D-xylosidase                                      124   1e-29   
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             124   1e-29   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         124   1e-29   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            125   1e-29   
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        124   1e-29   
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             124   1e-29   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            124   1e-29   
ref|XP_007051080.1|  Beta-xylosidase 2                                  124   1e-29   
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            124   1e-29   
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             124   1e-29   
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                124   1e-29   
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    124   2e-29   
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              124   2e-29   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     124   2e-29   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    124   2e-29   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            124   2e-29   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            124   2e-29   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    124   2e-29   
gb|EPS60429.1|  hypothetical protein M569_14372                         124   2e-29   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       124   2e-29   
ref|XP_009596711.1|  PREDICTED: probable beta-D-xylosidase 7            115   2e-29   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    125   2e-29   
dbj|BAO45878.1|  beta-D-xylosidase                                      124   2e-29   
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            123   3e-29   
gb|KHN12900.1|  Beta-D-xylosidase 1                                     123   3e-29   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            123   3e-29   
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       123   3e-29   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                123   3e-29   
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       124   4e-29   
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    123   4e-29   
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                123   4e-29   
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  123   4e-29   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       123   4e-29   
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            123   5e-29   
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             122   5e-29   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            122   6e-29   
emb|CDP01028.1|  unnamed protein product                                122   6e-29   
gb|KJB49844.1|  hypothetical protein B456_008G140600                    122   6e-29   
ref|XP_001775759.1|  predicted protein                                  122   6e-29   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    122   6e-29   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            122   6e-29   
emb|CDP01027.1|  unnamed protein product                                123   7e-29   
gb|KJB29304.1|  hypothetical protein B456_005G093200                    122   7e-29   
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       122   8e-29   
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...    121   8e-29   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            122   8e-29   
gb|KCW58370.1|  hypothetical protein EUGRSUZ_H010552                    114   8e-29   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       122   8e-29   
gb|EYU25657.1|  hypothetical protein MIMGU_mgv11b023706mg               115   9e-29   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       122   1e-28   
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         122   1e-28   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     122   1e-28   
emb|CDX97026.1|  BnaC09g45990D                                          122   1e-28   
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             122   1e-28   
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              122   1e-28   
ref|NP_001067710.2|  Os11g0291500                                       114   1e-28   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    122   1e-28   
ref|XP_006840294.1|  hypothetical protein AMTR_s00045p00064060          121   1e-28   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   121   1e-28   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       121   2e-28   
gb|KJB44020.1|  hypothetical protein B456_007G230000                    121   2e-28   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    121   2e-28   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                121   2e-28   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         121   2e-28   
ref|XP_006354073.1|  PREDICTED: probable beta-D-xylosidase 7-like       121   2e-28   
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    121   2e-28   
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    121   2e-28   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             121   2e-28   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            121   2e-28   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         121   2e-28   
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                121   2e-28   
emb|CBI25987.3|  unnamed protein product                                121   2e-28   
ref|XP_006369735.1|  glycosyl hydrolase family 3 family protein         121   2e-28   
gb|ABA95273.1|  Beta-D-xylosidase, putative, expressed                  121   3e-28   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            120   3e-28   
emb|CDX87482.1|  BnaA07g33910D                                          120   3e-28   
gb|KJB59094.1|  hypothetical protein B456_009G239100                    120   3e-28   
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            120   3e-28   
ref|NP_001068441.1|  Os11g0673200                                       120   3e-28   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            120   4e-28   
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            120   4e-28   
gb|EAY81823.1|  hypothetical protein OsI_36995                          120   5e-28   
emb|CDX88410.1|  BnaC06g38540D                                          120   5e-28   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            120   5e-28   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             120   6e-28   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   120   6e-28   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   120   6e-28   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       120   6e-28   
ref|XP_004238520.1|  PREDICTED: probable beta-D-xylosidase 7            119   7e-28   
ref|XP_003383638.1|  PREDICTED: beta-D-xylosidase 1-like                119   7e-28   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    119   8e-28   
ref|XP_006449653.1|  hypothetical protein CICLE_v10017977mg             119   8e-28   
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            119   9e-28   
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       119   9e-28   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    119   9e-28   
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                  114   9e-28   
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7            119   1e-27   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             119   1e-27   
emb|CDX69822.1|  BnaA10g21710D                                          119   1e-27   
ref|XP_007008778.1|  Glycosyl hydrolase family protein                  119   1e-27   
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            119   1e-27   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            119   2e-27   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            119   2e-27   
gb|EAY80660.1|  hypothetical protein OsI_35838                          119   2e-27   
gb|KDP42389.1|  hypothetical protein JCGZ_02446                         116   2e-27   
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7            118   2e-27   
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                118   2e-27   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            118   2e-27   
gb|KHG02565.1|  putative beta-D-xylosidase 7                            118   2e-27   
gb|KDP42384.1|  hypothetical protein JCGZ_02441                         115   2e-27   
gb|KJB29307.1|  hypothetical protein B456_005G093300                    118   2e-27   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       118   2e-27   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       118   3e-27   
gb|EAY87550.1|  hypothetical protein OsI_08961                          112   3e-27   
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g             117   3e-27   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  118   3e-27   
gb|KDP45919.1|  hypothetical protein JCGZ_15479                         111   3e-27   
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7            117   4e-27   
gb|KDP43295.1|  hypothetical protein JCGZ_24216                         115   4e-27   
ref|XP_008245938.1|  PREDICTED: probable beta-D-xylosidase 5            117   4e-27   
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7            117   4e-27   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          117   4e-27   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            117   5e-27   
gb|KDP37939.1|  hypothetical protein JCGZ_04582                         117   5e-27   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            117   6e-27   
gb|KCW75948.1|  hypothetical protein EUGRSUZ_D00316                     117   6e-27   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             117   6e-27   
ref|XP_007214466.1|  hypothetical protein PRUPE_ppa023763mg             117   6e-27   
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       117   6e-27   
ref|XP_003576084.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    117   7e-27   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             117   7e-27   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       117   7e-27   
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       117   7e-27   
gb|KCW84990.1|  hypothetical protein EUGRSUZ_B01815                     116   8e-27   
ref|XP_010046160.1|  PREDICTED: probable beta-D-xylosidase 5            117   8e-27   
gb|KJB16242.1|  hypothetical protein B456_002G219200                    116   8e-27   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            116   9e-27   
emb|CBI25718.3|  unnamed protein product                                116   9e-27   



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +QT+PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT LVNTAG+VS
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIPTYEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +ST
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVST  150



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT LVNTAGNVS
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGKVVST  153



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI+ LVNTAG+VS
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGKVVST  153



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  136  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVS  150

Query  493  T  495
            T
Sbjct  151  T  151



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  136  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFP  +LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGKAVS  150

Query  493  T  495
            T
Sbjct  151  T  151



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI FLV+ AG VS
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+SYTGPGV+F+G+VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGKVVST  159



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI FLV+ AG VS
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+SYTGPGV+F+G++PAATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVST  156



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVST  148



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI +LVNTA  VS
Sbjct  24   PVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAKGVS  83

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP Y+WWSEALHG+SY GPG  F+G+VP ATSFPQ +LTAA+FNE+LF  IGKV+ST
Sbjct  84   RLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGKVVST  143



>emb|CAN77623.1| hypothetical protein VITISV_007589 [Vitis vinifera]
Length=167

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EK+ FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKVGFLVNSAASVSR  90

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGKV  T
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKVTLT  149



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVST  151



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P ++Q++PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI FLVN A  VS
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVST  142



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKVIS
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVIS  150



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVST  148



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVST  148



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVVST  148



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGKVVST  150



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVST  151



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVST  151



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  Q++PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVST  148



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+ +L N+A  VSRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSE LHG+SYTGPGV FT +VP ATSFPQ +LT+ASFNE+LF  IGKV+ST
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGKVVST  132



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            ++  V +Q +PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI FLV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             VSRLGIP YEWWSEALHG++YTGPGV+FT +VP ATSFPQ +LTAASFN TLF TIGKV
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKV  142

Query  487  IST  495
            +ST
Sbjct  143  VST  145



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGKVVST  151



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q +PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+FLVN+AG+VSR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVST  145



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S  +PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKITFLV+ AG V+RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP+YEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGKVVST  146



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV  T
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVYYT  149



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV +Q +PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI FLV+ A  VS
Sbjct  62   PVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASGVS  121

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG++YTGPGV+F+ +VP ATSFPQ +LTAASFN +LF TIGKV+ST
Sbjct  122  RLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVVST  181



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVST  148



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVST  148



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVST  148



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  Q++PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI FLVN AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVST  148



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = +1

Query  139  VQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            V  QT+ PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F  +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVST  149



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P ATSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGKVVS  148

Query  493  T  495
            T
Sbjct  149  T  149



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVST  149



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVST  150



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVST  150



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVST  149



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G V SQT+PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A +V
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  493  T  495
            T
Sbjct  149  T  149



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  493  T  495
            T
Sbjct  149  T  149



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +1

Query  133  GPVQSQ-TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  309
            G V+ Q T+P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI FLVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  310  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            VSRLGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGKVV  149

Query  490  ST  495
            ST
Sbjct  150  ST  151



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  130  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  309
             GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI +LV+ A  
Sbjct  20   FGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAKG  79

Query  310  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            VSRLGIP+Y WWSEALHG+S  G G  FTG VPAATSFPQ +LT A+FNE+LF  IGKV+
Sbjct  80   VSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGKVV  139

Query  490  ST  495
            ST
Sbjct  140  ST  141



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+ FLV+ AGNV RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  152



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            ++ P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI FLV+ A 
Sbjct  20   VLPPSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAK  79

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             VSRLGIP YEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK 
Sbjct  80   AVSRLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKA  139

Query  487  IST  495
            +ST
Sbjct  140  VST  142



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A NVSR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG +F+ VVP ATSFP P+LTAASFN +LF  IG+V+ST
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGRVVST  150



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI F+V+ AG+VSR
Sbjct  44   VFGQTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSR  103

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG  F+ +VP ATSFPQ +LTAASFN TLF  IG+V+ST
Sbjct  104  LGIPKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVST  162



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +QT+PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  154  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  333
            +PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI FLVN AG V+RLGIP+
Sbjct  35   SPVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPS  94

Query  334  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  95   YEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVST  148



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  154



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVST  150



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI FLV+ A  VSRL
Sbjct  33   NAQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRL  92

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  150



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+ST
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVST  154



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+ST
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVST  154



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+ST
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVST  151



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q++PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI FLVN+AG+VSRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVST  154



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            TYEWWSEALHG+SY GPG +FTG VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   TYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  146



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV RLGIP Y
Sbjct  39   PVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVDRLGIPNY  98

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  99   KWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+ V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+ST
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVST  151



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   TYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  146



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVST  154



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVST  154



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+ FLVN A  VSR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP+YEWWSEALHG+S+ GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVST  148



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+ FLVN A  VSR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF  IGKV+ST
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVST  145



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  41   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  100

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  101  TYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  155



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK  +LV+ A  VS
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+SYTGPG  F   VP ATSFPQ +LTA +FNE+LF  IGKV+ST
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGKVVST  143



>gb|KCW63061.1| hypothetical protein EUGRSUZ_G006532, partial [Eucalyptus grandis]
Length=147

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF TIGK
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGK  147



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI +LV+ +  V
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP Y+WWSEALHG+SY GPG  F+  +PAAT FPQ +LTA++FN++LF TI KV+S
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLFETIAKVVS  142

Query  493  T  495
            T
Sbjct  143  T  143



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +Q++PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI FLVN+AG+VSR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+ST
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVST  154



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G V  QT+ ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A +V
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP ATSFP P+LTAASFN +LF TIG+ +S
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGRAVS  147

Query  493  T  495
            T
Sbjct  148  T  148



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVST  174



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVST  174



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+ FLVN A  VSR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVST  147



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVST  157



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF TIGKVIST
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGKVIST  151



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVST  166



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  68   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  127

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  128  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVST  184



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  32   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  160



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  160



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  32   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVARL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKA  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  27   NNQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRL  86

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP+Y+WWSEALHG+S  G G  FTG VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  87   GIPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  144



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P+ ++++PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI FLV+ A  VS
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP Y WWSEALHG+S  GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVST  146



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  154  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  333
            +PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI FLVN    VSRLGIP 
Sbjct  29   SPVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPA  88

Query  334  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            YEWWSEALHG+SY GPG +F+G+VP ATSFPQ + + ASFN +L+  IGKV+ST
Sbjct  89   YEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGKVVST  142



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP Y+WWSEALHG+S  G G +F+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S   P++ACD   N  L    FCN     K RV DLVKRLTL EK+ FLVN A  V RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP+YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF  IGKV+ST
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGKVVST  144



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+ V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+ST
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIGSVVST  150



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P  +Q++PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI FL + A  VS
Sbjct  30   PSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRANGVS  89

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP Y WWSEALHG+S  G G NF+G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  90   RLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGKVVST  149



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP Y WWSEALHG+S  G G NF+G +  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGKVVST  149



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+ST
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVST  122



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVST  164



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  139  VQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            V  Q +P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVST  148



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+ V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+S 
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIGSVVSN  150



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVST  164



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V S +   YAC    N   +S PFC++ L V  RVADLV+RLTL EKITFLV+ AGNVSR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  319  LGIPTYEWWSEALHGLSYTGP-GVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIPTY+WWSEALHG+S  G  G  FT +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVST  149



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            ++G V   +  V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AG
Sbjct  29   VVGQV---SQAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAG  85

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
            N+SRLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  86   NISRLGIPKYEWWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKV  145

Query  487  IST  495
            +ST
Sbjct  146  VST  148



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVST  149



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  333
            +P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI +L++ A +V+RLGIP 
Sbjct  39   SPAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPK  98

Query  334  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            YEWWSEALHG+S  GPG  FT VVP ATSFPQ + TAASFN TLF  IGKV+S
Sbjct  99   YEWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVS  151



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V  QT+ V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  GPG +F+ +VP AT+FP P+LTAASFN +LF  IG V+S 
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIGSVVSN  149



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V+ QT   +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSR
Sbjct  25   VRGQT---FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSR  81

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+ST
Sbjct  82   LGIPRYEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVST  140



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  337  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +ST
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVST  146



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  337  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +ST
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVST  146



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            ++P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
             Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGKVVST  150



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +1

Query  160  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  339
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+ FL N AG+V RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  340  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  152



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ  LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A +VSRLGIP YEW
Sbjct  30   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPKYEW  89

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S  GPG  F+ V+P ATSFP P+LTAASFN +LF  IG+V+ST
Sbjct  90   WSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGRVVST  140



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  493  T  495
            T
Sbjct  146  T  146



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVST  150



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  484  VIST  495
            V+ST
Sbjct  147  VVST  150



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI FL ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIPTYEWW+EALHG+S+ GP   F+ +VP+AT FPQ +LTAASFN +LF  IGK +ST
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGKAVST  147



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  493  T  495
            T
Sbjct  146  T  146



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  493  T  495
            T
Sbjct  146  T  146



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
             ++QT PV+ACD   N  L    FCN++     R  DLV RLTL EK+ FLVN    + R
Sbjct  222  AEAQT-PVFACD-ASNATLAGYGFCNRKASASARAKDLVSRLTLAEKVGFLVNKQAALGR  279

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  280  LGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVST  338



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    + RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVST  148



>gb|ABR17218.1| unknown [Picea sitchensis]
Length=151

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
             +A  + CD   + GL S PFCN  L +  R  DLV RLTL EK+  LVN A N+SRLGI
Sbjct  24   HSAGSFPCD--PSTGLNSFPFCNVSLPIADRAKDLVGRLTLQEKVQQLVNGASNISRLGI  81

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
            P YEWWSEALHG+S  GPG  F   VP ATSFPQ +LTAASFN+TL+  IG+V
Sbjct  82   PMYEWWSEALHGVSDVGPGTRFGAPVPGATSFPQVILTAASFNDTLWEAIGRV  134



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+ FL ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            EWW+EALHG+S+ GP   FT +VP+AT FPQ +LTAASFN +LF  IGK +ST
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGKAVST  147



>ref|XP_009629820.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPPFACDPA-NAGTRNLPFCKASLPIHVRVQDLIERLTLQEKIRLLVNNAAPVERLGV  85

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQ  137



>ref|XP_009629821.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=147

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPPFACDPA-NAGTRNLPFCKASLPIHVRVQDLIERLTLQEKIRLLVNNAAPVERLGV  85

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQ  137



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +1

Query  130  IGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI ++++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGK  483
             VSRLGIP Y WWSEALHG+   GPG  F    V AATSFPQ +LTAASFN +LFH IGK
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGK  146

Query  484  VIST  495
             IST
Sbjct  147  AIST  150



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGEVVST  140



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  28   RAQT-PVFACDA-SNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPRL  85

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            GIP YEWWSEALHG+SY GPG  F+ +VPAATSFPQP+LTAASFN TLF  IG+V+S
Sbjct  86   GIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGEVVS  142



>ref|XP_003615012.1| Auxin-induced beta-glucosidase, partial [Medicago truncatula]
Length=190

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L++ I KVI T
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGT  145



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVS  140



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A  + RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +P+Y+WW EALHG++ + PGV F G+ PAATSFP P+  AASFN TLF++IG+ +S+
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGEAVSS  146



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +1

Query  127  IIGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  303
            I+   ++ TA + YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A
Sbjct  23   ILSNARASTAQLRYACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAA  82

Query  304  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
              + RLG+P+Y+WW EALHG++ + PGV F G+ PAATSFP P+ TAASFN TLF++IG+
Sbjct  83   QGIPRLGVPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGE  141

Query  484  VIST  495
             +S+
Sbjct  142  AVSS  145



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   140 bits (354),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVS  143



>emb|CAJ86028.1| B0414F07.1 [Oryza sativa Indica Group]
Length=320

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGE  136



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNTA  + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRLG  90

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG++  G G+   G +PAATSFPQ +LTAASF+E L++ IG+ I T
Sbjct  91   IPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILTAASFDENLWYQIGQAIGT  147



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVS  143



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVS  148



>ref|XP_009804070.1| PREDICTED: beta-D-xylosidase 1 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVS  140



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P   +  P +ACD      + S PFC++ L +  RV+DL++RLTLPEK   LVN A  ++
Sbjct  20   PAIVEPGPSFACDGQ----MGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLG+P YEWWSEALHG+S  GPG  F G VP ATSFPQ +LTAASFN +L+  IG+ +ST
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVST  135



>gb|EYU44008.1| hypothetical protein MIMGU_mgv1a0207571mg, partial [Erythranthe 
guttata]
Length=203

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   N   K++PFC   L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  33   FACDP-SNSVSKNMPFCRVSLHIRDRVGDLIGRLTLQEKIRSLVNNAAPVDRLGIKGYEW  91

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  92   WSEALHGVSNTGPGVKFGGEFPGATSFPQVITTAASFNSSLWEAIGQVVS  141



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+  LVN AG VSRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVS  136



>ref|XP_003615011.1| Beta-D-xylosidase [Medicago truncatula]
Length=155

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA  + RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
            +WW+EALHG+SY G G+   G +PAATSFPQ +LTAASF+  L++ I KV
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILTAASFDPKLWYQISKV  142



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +1

Query  133  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  312
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    +
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  313  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  143

Query  493  T  495
            T
Sbjct  144  T  144



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVS  140



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVS  148



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  29   TQPPYACDSSQ-PSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLGIP  87

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L++ IG+VI T
Sbjct  88   SYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGT  142



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  VADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATS  420
            VADLVKRLTL EKI FLVN+A  VSRLGIP YEWWS+ALHG+SY GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  421  FPQPLLTAASFNETLFHTIGKVIST  495
            FPQ +L AASF  +LF  IGKV+ST
Sbjct  131  FPQVILPAASFYASLFEAIGKVVST  155



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  483
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGE  136



>emb|CDP18762.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
            +  P YAC +       +  F    LDVKTRV DL+K+L+L EKI  LV+ A  VSRL I
Sbjct  15   RITPAYACAS------GNYTFYYTSLDVKTRVDDLIKKLSLQEKIGNLVDGAAGVSRLRI  68

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            P YEWWSE LHG+S TGPGV+FT +VP ATSFPQ +LTAASFN++LF   GKV+ST
Sbjct  69   PIYEWWSEILHGVSNTGPGVHFTSLVPGATSFPQVILTAASFNQSLFEINGKVVST  124



>gb|EYU23815.1| hypothetical protein MIMGU_mgv1a0042532mg, partial [Erythranthe 
guttata]
Length=321

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P ++CD   NP   SLPFCN RL + TR +DLV RLTL EK+  LVNTA  V RL I  Y
Sbjct  31   PPFSCD-ASNPSTSSLPFCNTRLPITTRASDLVSRLTLDEKVQQLVNTAAAVPRLNISAY  89

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  G GV F G V +AT FPQ +LTAASF+  L++ + +V S
Sbjct  90   EWWSEALHGVSRHGRGVRFNGTVTSATMFPQIILTAASFDSHLWYRVAQVRS  141



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+  LVN A  V R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F GV PAATSFPQ + TAASFN +L+  IG+V+S
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGRVVS  136



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+ FLVN    ++RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S 
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSN  147



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+  LVN A +VSRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVS  138



>ref|XP_004150696.1| PREDICTED: probable beta-D-xylosidase 7-like [Cucumis sativus]
 gb|KGN62174.1| Periplasmic beta-glucosidase [Cucumis sativus]
Length=783

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L++ IG+ I T
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGT  147



>ref|XP_004163321.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 7-like 
[Cucumis sativus]
Length=783

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L++ IG+ I T
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGT  147



>ref|XP_003615003.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
 gb|AES97961.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=780

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  KS PFCN  L +  R  D+V RLTL EKI+ LVNTA  + RLGIP+Y
Sbjct  32   PPYSCDT-SNPLTKSFPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPAIPRLGIPSY  90

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WW+EALHG+SY G G+   G + AATSFPQ +L AASF+  L++ I KVI T
Sbjct  91   QWWNEALHGVSYVGKGIRLNGSITAATSFPQIILIAASFDPKLWYRISKVIGT  143



>gb|KJB38536.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=589

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVS  141



>ref|XP_007225247.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
 gb|EMJ26446.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
Length=781

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + RL IP
Sbjct  29   TQPPYACDSSQ-PSTSSYPFCKTTLPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLSIP  87

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L++ IG+VI T
Sbjct  88   SYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGT  142



>gb|KEH28065.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=601

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA  + RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WW+EALHG+SY G G+   G +PAATSFPQ +LTAASF+  L++ I KVI T
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILTAASFDPKLWYQISKVIGT  145



>gb|AES97966.2| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=782

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L++ I KVI T
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGT  145



>ref|XP_003615008.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
Length=798

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L++ I KVI T
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGT  145



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +ST
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVST  138



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
             I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN + 
Sbjct  15   FILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPST  70

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNETL++T+G+V
Sbjct  71   GISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQV  130

Query  487  IST  495
            +S 
Sbjct  131  VSN  133



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +ST
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVST  138



>ref|XP_004170761.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
Length=241

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  169  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  348
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  349  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVS  140



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+  +G+V+ST
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVST  136



>ref|XP_004513829.1| PREDICTED: probable beta-D-xylosidase 7-like [Cicer arietinum]
Length=781

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            +S T P Y+CD + NP  KS  FCN +L +  R  D+V RLTL EK+  LVNTA ++ RL
Sbjct  26   ESPTQPPYSCD-ISNPLTKSYAFCNLKLPIIERAKDIVSRLTLDEKLAQLVNTAPSIPRL  84

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            GIP+Y+WWSEALHG++  G G+   G + AATSFPQ +LTAASF+  L++ I KVI T
Sbjct  85   GIPSYQWWSEALHGVANAGKGIRLNGTIKAATSFPQVILTAASFDSKLWYQISKVIGT  142



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVS  135



>gb|AES97964.2| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=791

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA  + RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +WW+EALHG+SY G G+   G +PAATSFPQ +LTAASF+  L++ I KVI T
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILTAASFDPKLWYQISKVIGT  145



>ref|XP_002285805.1| PREDICTED: probable beta-D-xylosidase 7 [Vitis vinifera]
Length=774

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            I+  V+S  +P ++CD+  NP  KS  FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  17   ILVGVESTQSPPFSCDS-SNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAP  75

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             + RLGIP YEWWSEALHG++  GPG+ F G + +ATSFPQ +LTAASF+  L++ IG+ 
Sbjct  76   AIPRLGIPAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILTAASFDVHLWYRIGRA  135

Query  487  I  489
            I
Sbjct  136  I  136



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVS  135



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  148  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  327
            ++ P +ACD  +N   +SL FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI
Sbjct  31   ESRPPFACDP-RNGLTRSLRFCRVNLPLHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGI  89

Query  328  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
              YEWWSEALHG+S  GPG  F G VP ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  90   QGYEWWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGRVVS  144



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVAS  135



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVS  141



>gb|KCW68842.1| hypothetical protein EUGRSUZ_F02442 [Eucalyptus grandis]
Length=729

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P  S   P ++CD    P   S PFCN  L +  R  DLV RLTL EKI+ LV++A  + 
Sbjct  25   PATSAQPPPFSCDP-SGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIP  83

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSE+LHG+S +GPG+ F G + +ATSFPQ +LTAASF+  L++ IG+ I T
Sbjct  84   RLGIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILTAASFDANLWYRIGQAIGT  143



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVS  139



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             + RLG+P Y+WWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNE L+  +G+V
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNEMLWLEMGRV  135

Query  487  IST  495
            +ST
Sbjct  136  VST  138



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
             + P      P +ACD  +N   ++LPFC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  21   FVSPRTGDARPAFACDP-RNGLTRNLPFCRPSLPIPNRVRDLIGRLTLQEKIRLLVNNAA  79

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  80   PVPRLGIRGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGRV  139

Query  487  IS  492
            +S
Sbjct  140  VS  141



>ref|XP_010064766.1| PREDICTED: probable beta-D-xylosidase 7 [Eucalyptus grandis]
Length=781

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P  S   P ++CD    P   S PFCN  L +  R  DLV RLTL EKI+ LV++A  + 
Sbjct  25   PATSAQPPPFSCDP-SGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIP  83

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGIP YEWWSE+LHG+S +GPG+ F G + +ATSFPQ +LTAASF+  L++ IG+ I T
Sbjct  84   RLGIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILTAASFDANLWYRIGQAIGT  143



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVS  139



>emb|CBI19138.3| unnamed protein product [Vitis vinifera]
Length=1411

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            I+  V+S  +P ++CD+  NP  KS  FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  17   ILVGVESTQSPPFSCDS-SNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAP  75

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             + RLGIP YEWWSEALHG++  GPG+ F G + +ATSFPQ +LTAASF+  L++ IG+ 
Sbjct  76   AIPRLGIPAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILTAASFDVHLWYRIGRA  135

Query  487  I  489
            I
Sbjct  136  I  136


 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            Q  ++P +ACD+  +P  KS  FCN  L +  R +DL+ RLTL EKI+ L+++A ++ RL
Sbjct  691  QLSSSPPFACDS-SDPLTKSYAFCNTTLRISQRASDLISRLTLDEKISQLISSAASIPRL  749

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            GIP YEWWSEALHG+     G+ F G + +ATSFPQ +LTAASF+  L++ IG+ I
Sbjct  750  GIPAYEWWSEALHGIR-DRHGIRFNGTIRSATSFPQVILTAASFDAHLWYRIGQAI  804



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            +  Q  P +ACD  ++   K+ PFC   L +  RV DL+ RLTL EK+  L NTA  VSR
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLIGRLTLQEKVKLLGNTAAAVSR  80

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVISTAASFNASLWEEIGRVVS  138



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P    T P +AC     P   +LPFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PRGGATRPAFACG--GGPA-AALPFCRVALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S
Sbjct  77   RLGIAGYEWWSEALHGVSDVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVS  135



>ref|NP_001266114.1| SlArf/Xyl4 protein precursor [Solanum lycopersicum]
 dbj|BAL44719.1| SlArf/Xyl4 [Solanum lycopersicum]
Length=775

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            ++  VQS T P ++CD+  NP  KSL FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  18   LVSIVQS-TQPPFSCDS-SNPQTKSLKFCQTGLPISVRVLDLVSRLTLDEKISQLVNSAP  75

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             + RLGIP YEWWSE+LHG+   G G+ F G +  ATSFPQ +LTAA+F+E L++ IG+V
Sbjct  76   AIPRLGIPAYEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILTAATFDENLWYRIGQV  135

Query  487  I  489
            I
Sbjct  136  I  136



>ref|XP_002264114.2| PREDICTED: probable beta-D-xylosidase 5 [Vitis vinifera]
Length=794

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+ST
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVST  136



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  16   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  74

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S
Sbjct  75   LGIKGYEWWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGRVVS  132



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   N G+++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  25   FACDPA-NAGIRNLRFCKTSLPIHVRVQDLIARLTLQEKIRLLVNNAAPVQRLGISGYEW  83

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S TG GV F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  84   WSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGRVVS  133



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            I  YEWWSEALHG+S   PGV F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVISTAASFNASLWEHIGRVVS  136



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVS  136



>ref|XP_006354009.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=775

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P ++CD+  NP  KSL FC   L +  RV DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  25   TQPPFSCDS-SNPQTKSLKFCQTGLPISVRVQDLVSRLTLDEKISQLVNSAPAIPRLGIP  83

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             YEWWSE+LHG+   G G+ F G +  ATSFPQ +LTAA+F+E L++ IG+VI
Sbjct  84   AYEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILTAATFDENLWYRIGQVI  136



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVAS  136



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVS  159



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVS  140



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+  LVN A  V+RLGI  Y
Sbjct  96   PAFACD-ARDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  PAATSFPQ + TAA+FN +L+  IG+V+S
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGRVVS  206



>emb|CBI22460.3| unnamed protein product [Vitis vinifera]
Length=896

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  45   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  103

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+ST
Sbjct  104  VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVST  160



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P++ACD   N   ++L FC   L V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNLPVRVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVS  159



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVS  140



>emb|CAN82161.1| hypothetical protein VITISV_035506 [Vitis vinifera]
Length=925

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+ST
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVST  136



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FN TL+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAAAFNATLWEAIGQVVS  135



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            RLGI  YEWWSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVS  145



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVS  137



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVS  137



>gb|KJB16241.1| hypothetical protein B456_002G219100 [Gossypium raimondii]
Length=769

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V S T P ++CD+  +P  K+ PFC   L V  R  DLV RLTL EKI+ LVN+A  + R
Sbjct  17   VASTTTPPFSCDS-SDPTTKNYPFCQSTLPVTQRARDLVSRLTLDEKISQLVNSAPAIPR  75

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            LGIP YEWWSEALHG+S  GPG+ F G + AATSFPQ +L AASF+   ++ IG+ I
Sbjct  76   LGIPAYEWWSEALHGVSNVGPGIKFDGTIKAATSFPQVILAAASFDAYQWYRIGQAI  132



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + +AASFNE+L+  IG+V+S
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITSAASFNESLWEQIGRVVS  139



>ref|XP_010676938.1| PREDICTED: probable beta-D-xylosidase 7 [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P +ACD+  NP  K   FC   L ++ R  DL+ RLTL EK++ LVNTA ++ RLGIP
Sbjct  27   TEPPFACDS-SNPNTKHYTFCRADLPIRKRAKDLIARLTLDEKVSQLVNTAPSIPRLGIP  85

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             YEWWSEALHG++  GPGV+  G + AATSFPQ +LTAASF+  L++ IG+ I
Sbjct  86   AYEWWSEALHGVADAGPGVSLYGTIRAATSFPQVILTAASFDVRLWYRIGQAI  138



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = +1

Query  127  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  306
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  307  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  486
             + RLGIP YEWWSEALHG+S  G GV F G VP ATSFP  +L+AASFNETL+  +G+V
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQV  131

Query  487  IST  495
            +ST
Sbjct  132  VST  134



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V RLGI  YEW
Sbjct  37   FACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVPRLGIKGYEW  95

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  96   WSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVS  145



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  +N   ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  42   FACDP-RNGVTRNLKFCRANLPIHVRVRDLISRLTLQEKIRLLVNNAAAVPRLGIQGYEW  100

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  101  WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGRVVS  150



>ref|XP_008362602.1| PREDICTED: probable beta-D-xylosidase 7 [Malus domestica]
Length=410

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P Y+CD+ + P   S PFC   L +  RV DL+ RLTL EKI+ LVN+A  + RLGIP
Sbjct  33   TQPPYSCDSSQ-PSTSSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIP  91

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            +YEWWSEALHG++  G G+     +  ATSFPQ +LTAASFN+ L++ IG+VI T
Sbjct  92   SYEWWSEALHGVADVGKGIKLYPTIHXATSFPQVILTAASFNDHLWYRIGQVIGT  146



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A  VSRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+ST
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVST  136



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = +1

Query  130  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  309
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  310  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  490  ST  495
            ST
Sbjct  137  ST  138



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVAS  135



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVAS  136



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            +  Q  P +ACD  ++   K+ PFC   L +  RV DLV RLTL EK+  L NTA  V R
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLVGRLTLQEKVKLLGNTAAAVPR  80

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGRVVS  138



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            S+    +ACD  ++   ++ PFC  +L +++RV DL+ R+TL EK+  LVN A  V RLG
Sbjct  21   SEALDAFACDP-EDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            I  YEWWSEALHG+S  GPG  F GV P ATSFPQ + T+ASFN TL+  IG+V+S
Sbjct  80   IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQVVS  135



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVAS  135



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA  +SRLG+P YEW
Sbjct  85   FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTASGISRLGVPAYEW  143

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S  GPG  F   VP ATSFP  +L+AASFN TL+  +G+V+ST
Sbjct  144  WSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQVVST  194



>gb|KJB59941.1| hypothetical protein B456_009G282000 [Gossypium raimondii]
Length=590

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             YEWWSEALHG+S  GPGV F G + AATSFPQ +LTAASF+   ++ IG+ I
Sbjct  80   AYEWWSEALHGVSNVGPGVKFDGTIKAATSFPQVILTAASFDPYQWYRIGQAI  132



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = +1

Query  130  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  309
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  310  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  490  S  492
            S
Sbjct  140  S  140



>ref|XP_006830079.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
 gb|ERM97495.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
Length=801

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            YACD  +      LPFCN  L +  R  DLV RL L EK+  LVN A  V+RLG+P YEW
Sbjct  38   YACDKGE---AAPLPFCNISLPIHDRAQDLVSRLNLTEKVQQLVNKAAGVARLGVPPYEW  94

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S  GP V+F G +P ATSFP  +L+ ASFNETL+  +G+V+ST
Sbjct  95   WSEALHGVSNVGPAVHFNGTIPGATSFPAVILSGASFNETLWFVMGQVVST  145



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  +NP  ++L FC  R  +  RV DL+ RLTL EKI  LVN A +V RLGI  YEW
Sbjct  33   FACDP-RNPITRTLKFCRVRASIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRLGIQGYEW  91

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  92   WSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVS  141



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P  +   P +AC      GL   PFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PGGAAARPAFACGGGPAVGL---PFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S
Sbjct  77   RLGIGGYEWWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVS  135



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVS  141



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVS  141



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVS  139



>dbj|BAF00595.1| xylosidase [Arabidopsis thaliana]
Length=303

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRANVPIHVRVQDLLGRLTLQEKIRNLVNNAAAVPRLGIGGY  91

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  92   EWWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVS  143



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  49   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  107

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  108  IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVS  163



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  ++   ++ PFC  +L +++RV+DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-EDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLGIKGYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVS  135



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = +1

Query  130  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  309
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  310  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  490  S  492
            S
Sbjct  140  S  140



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  145  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  324
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  28   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  86

Query  325  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  87   IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVS  142



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = +1

Query  157  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  336
            P +ACD  KN   ++ PFC   L +  RV DL+ RLTL EK+  L N A  V RLGI  Y
Sbjct  29   PPFACDQ-KNRAFRNFPFCQTNLPIGDRVRDLIGRLTLQEKVKLLGNNAAAVPRLGIKGY  87

Query  337  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  88   EWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEEIGRVVS  139



>ref|XP_006352077.1| PREDICTED: beta-D-xylosidase 1-like [Solanum tuberosum]
Length=773

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            +S+  P +ACD   N G ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RL
Sbjct  19   ESRRQP-FACDPA-NAGTRNLRFCKTSLPIHVRVQDLIGRLTLQEKIRLLVNNAAPVERL  76

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            G+  YEWWSEALHG+S TG GV F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  77   GVSGYEWWSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGRVVS  133



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            QS T+  +AC+   +   K LPFC  +L +  RV DL+ RLTL EK+  LVN+A  V RL
Sbjct  28   QSPTSSSFACNP-NDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRL  86

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            GI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+ +S
Sbjct  87   GIKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEAIGQAVS  143



>ref|XP_011074159.1| PREDICTED: probable beta-D-xylosidase 7 [Sesamum indicum]
Length=792

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  321
            +S  +P ++CD   NP  KSLPFCN +L + +R  DLV RLTL EK+  LVNTA  V RL
Sbjct  38   ESDHSPPFSCDP-SNPSTKSLPFCNTQLPISSRAKDLVSRLTLDEKVQQLVNTADAVPRL  96

Query  322  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             I  YEWWSEALHG+S  G GV F G V AAT FPQ +L AASF+  L++ I + I
Sbjct  97   NISAYEWWSEALHGVSRHGKGVTFNGTVTAATMFPQVILAAASFDSQLWYRIAQAI  152



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDA-KNGLTRSLKFCRVNVPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN++L+  IG+V+S
Sbjct  87   WSEALHGVSNVGPGTKFSGAFPGATSFPQVITTAASFNKSLWEEIGRVVS  136



>ref|XP_008454299.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Cucumis melo]
Length=741

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVS  135



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEAGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVS  145



>ref|XP_010687347.1| PREDICTED: probable beta-D-xylosidase 5 [Beta vulgaris subsp. 
vulgaris]
Length=790

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            YAC+  +   + +L FCN+ L    R  DLV RLTL EK   LVN A  + RLG+P YEW
Sbjct  24   YACNK-REVDINNLSFCNKSLPYHDRAKDLVSRLTLDEKARQLVNAARGIPRLGVPAYEW  82

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            WSEALHG+S TGPGV+F   VP ATSFP  +L+AASFN +L++ +G+V+ST
Sbjct  83   WSEALHGVSNTGPGVHFNATVPGATSFPAVILSAASFNTSLWYMMGQVVST  133



>gb|KHG13360.1| putative beta-D-xylosidase 7 -like protein [Gossypium arboreum]
Length=769

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             YEWWSEALHG+S  GPGV F G + AATSFPQ +LTAASF+   ++ IG+ I
Sbjct  80   AYEWWSEALHGVSNVGPGVRFDGTIKAATSFPQVILTAASFDPYQWYRIGQAI  132



>ref|XP_006349198.1| PREDICTED: probable beta-D-xylosidase 2-like [Solanum tuberosum]
Length=774

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P +ACD  K+   K+ PFC   L +  RV DL+ RLTL EK+  L N A  V RLGI 
Sbjct  27   TRPPFACDQ-KDRATKNFPFCQTNLPIGDRVRDLIGRLTLQEKVKLLGNNAAAVPRLGIK  85

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
             YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S
Sbjct  86   GYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEEIGRVVS  139



>gb|KJB59940.1| hypothetical protein B456_009G282000 [Gossypium raimondii]
Length=769

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             YEWWSEALHG+S  GPGV F G + AATSFPQ +LTAASF+   ++ IG+ I
Sbjct  80   AYEWWSEALHGVSNVGPGVKFDGTIKAATSFPQVILTAASFDPYQWYRIGQAI  132



>ref|XP_011011483.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=773

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  24   TQPPFSCDS-SNPTTKTFPFCKTTLPISQRATDLVSRLTLDEKISQLVNSAQPIPRLGIP  82

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             Y+WWSEALHG++Y GPG+ F G +  ATSFPQ +L+AASF+   ++ I + I
Sbjct  83   GYQWWSEALHGIAYAGPGIRFNGTIKRATSFPQVILSAASFDANQWYRISQAI  135



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = +1

Query  136  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  315
            P  S TA  +ACD   +   K+L FC   L VK RV DL+ RL L EK+  LVN A  V 
Sbjct  35   PAISATAQPFACDPADST-TKTLSFCRTDLSVKDRVKDLMGRLRLQEKVKLLVNNAAGVP  93

Query  316  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  495
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IGK + T
Sbjct  94   RLGIRGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGKTVET  153



>emb|CAJ41429.1| beta (1,4)-xylosidase [Populus tremula x Populus alba]
Length=732

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  K+   + LPFC   L + TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTNRDLPFCQVNLPIHTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGRVVS  135



>ref|XP_002306583.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
 gb|EEE93579.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
Length=773

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  24   TQPPFSCDS-SNPSTKTFPFCKTTLPISQRANDLVSRLTLEEKISQLVNSAQPIPRLGIP  82

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
             Y+WWSEALHG++Y GPG+ F G +  ATSFPQ +L+AASF+   ++ I + I
Sbjct  83   GYQWWSEALHGVAYAGPGIRFNGTIKRATSFPQVILSAASFDANQWYRISQAI  135



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = +1

Query  139  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  318
            V+      +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  22   VRVHCRETFACDT-KDAATATLRFCQMSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPR  80

Query  319  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVS  138



>ref|XP_010269208.1| PREDICTED: probable beta-D-xylosidase 7 [Nelumbo nucifera]
Length=823

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  151  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  330
            T P +ACD+ KNP   S  FCN  L +  RV DLV RLTL EKI+ LVN A  + RLGIP
Sbjct  67   TQPPFACDS-KNPATASYTFCNPSLPIPQRVKDLVSRLTLDEKISQLVNNAPAIPRLGIP  125

Query  331  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  489
            +YEWWSEALHG++  G G+   G++  ATSFPQ +L+AASF+  L++ I K I
Sbjct  126  SYEWWSEALHGVTSAGRGIQLNGIIKGATSFPQVILSAASFDAHLWYRIAKAI  178



>ref|XP_008454298.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Cucumis melo]
Length=768

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVS  135



>ref|XP_007163167.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
 gb|ESW35161.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
Length=775

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  342
            +ACD  KN   K+LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNAVTKNLPFCKVSVAITERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  89

Query  343  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  492
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+ +IG+V+S
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWESIGRVVS  139



Lambda      K        H        a         alpha
   0.317    0.133    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190