BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012L09

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU33869.1|  hypothetical protein MIMGU_mgv1a010099mg                135   8e-35   Erythranthe guttata [common monkey flower]
ref|XP_011086212.1|  PREDICTED: light-induced protein, chloroplas...    130   4e-33   Sesamum indicum [beniseed]
gb|AIX87511.1|  fibrillin                                               128   4e-32   Lycium barbarum [Duke of Argyll's teatree]
emb|CAN69132.1|  hypothetical protein VITISV_012048                     125   3e-31   Vitis vinifera
gb|KDO78379.1|  hypothetical protein CISIN_1g020639mg                   124   3e-31   Citrus sinensis [apfelsine]
gb|KDO78378.1|  hypothetical protein CISIN_1g020639mg                   124   1e-30   Citrus sinensis [apfelsine]
ref|XP_006449818.1|  hypothetical protein CICLE_v10015934mg             124   1e-30   Citrus clementina [clementine]
ref|NP_001234183.1|  plastid lipid associated protein CHRC              124   2e-30   Solanum lycopersicum
ref|XP_006467367.1|  PREDICTED: plastid-lipid-associated protein,...    124   3e-30   
ref|NP_001275061.1|  light-induced protein, chloroplastic               123   3e-30   Solanum tuberosum [potatoes]
gb|AIX87535.1|  fibrillin                                               122   4e-30   Lycium ruthenicum
sp|O99019.1|LIPC_SOLDE  RecName: Full=Light-induced protein, chlo...    122   4e-30   Solanum demissum
ref|XP_008384113.1|  PREDICTED: plastid-lipid-associated protein,...    121   9e-30   
ref|XP_004486195.1|  PREDICTED: plastid-lipid-associated protein,...    121   1e-29   Cicer arietinum [garbanzo]
ref|XP_003546169.1|  PREDICTED: plastid-lipid-associated protein,...    121   1e-29   Glycine max [soybeans]
ref|XP_002524410.1|  Plastid-lipid-associated protein, chloroplas...    121   1e-29   Ricinus communis
gb|AIX02792.1|  fibrillin 1 protein                                     121   2e-29   Capsicum annuum
gb|AIX02791.1|  fibrillin 1 protein                                     121   2e-29   Capsicum annuum
ref|XP_007147677.1|  hypothetical protein PHAVU_006G145100g             120   2e-29   Phaseolus vulgaris [French bean]
emb|CAA50750.1|  fibrillin                                              121   2e-29   Capsicum annuum
ref|XP_004134784.1|  PREDICTED: chromoplast-specific carotenoid-a...    120   2e-29   Cucumis sativus [cucumbers]
gb|KJB57828.1|  hypothetical protein B456_009G182500                    120   3e-29   Gossypium raimondii
ref|XP_008224724.1|  PREDICTED: plastid-lipid-associated protein,...    120   3e-29   Prunus mume [ume]
gb|KDO78380.1|  hypothetical protein CISIN_1g020639mg                   117   4e-29   Citrus sinensis [apfelsine]
gb|KHG02015.1|  Plastid-lipid-associated, chloroplastic                 120   4e-29   Gossypium arboreum [tree cotton]
ref|XP_007211630.1|  hypothetical protein PRUPE_ppa005787mg             120   6e-29   
ref|XP_009788638.1|  PREDICTED: light-induced protein, chloroplas...    119   9e-29   Nicotiana sylvestris
ref|XP_009628206.1|  PREDICTED: light-induced protein, chloroplastic    119   1e-28   Nicotiana tomentosiformis
ref|XP_009795634.1|  PREDICTED: light-induced protein, chloroplastic    119   1e-28   Nicotiana sylvestris
gb|ABK96652.1|  unknown                                                 119   1e-28   Populus trichocarpa x Populus deltoides
ref|XP_007026203.1|  Plastid-lipid associated protein PAP / fibri...    119   2e-28   
gb|ABA43902.1|  fibrillin                                               118   2e-28   Coffea canephora [robusta coffee]
emb|CAA75658.1|  Plastid-lipid-Associated Protein                       114   2e-28   Solanum lycopersicum
emb|CDP04455.1|  unnamed protein product                                118   2e-28   Coffea canephora [robusta coffee]
ref|XP_010252567.1|  PREDICTED: plastid-lipid-associated protein,...    118   2e-28   Nelumbo nucifera [Indian lotus]
gb|KDP20693.1|  hypothetical protein JCGZ_21164                         116   9e-28   Jatropha curcas
ref|XP_006383843.1|  chromoplast-specific carotenoid-associated p...    116   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010422246.1|  PREDICTED: probable plastid-lipid-associated...    115   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_008440050.1|  PREDICTED: chromoplast-specific carotenoid-a...    115   3e-27   Cucumis melo [Oriental melon]
gb|EPS66635.1|  hypothetical protein M569_08140                         113   3e-27   Genlisea aurea
ref|XP_010496158.1|  PREDICTED: probable plastid-lipid-associated...    115   3e-27   Camelina sativa [gold-of-pleasure]
dbj|BAJ98727.1|  predicted protein                                      114   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011047005.1|  PREDICTED: plastid-lipid-associated protein,...    114   7e-27   Populus euphratica
ref|XP_006396722.1|  hypothetical protein EUTSA_v10028808mg             114   8e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010686767.1|  PREDICTED: plastid-lipid-associated protein,...    113   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534708.1|  PREDICTED: plastid-lipid-associated protein,...    113   1e-26   Glycine max [soybeans]
emb|CAA75657.1|  Plastid-lipid-Associated Protein                       112   2e-26   Nicotiana tabacum [American tobacco]
ref|NP_192311.1|  fibrillin                                             111   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003594155.1|  Plastid-lipid-associated protein                   111   6e-26   Medicago truncatula
dbj|BAF95867.1|  putative plastid lipid-associated protein              109   8e-26   Vitis hybrid cultivar
ref|XP_010099142.1|  Plastid-lipid-associated protein                   111   8e-26   Morus notabilis
ref|XP_010433071.1|  PREDICTED: probable plastid-lipid-associated...    110   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006288225.1|  hypothetical protein CARUB_v10001463mg             110   1e-25   Capsella rubella
ref|XP_010434068.1|  PREDICTED: probable plastid-lipid-associated...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010057882.1|  PREDICTED: plastid-lipid-associated protein,...    110   2e-25   Eucalyptus grandis [rose gum]
gb|EYU27736.1|  hypothetical protein MIMGU_mgv1a010083mg                110   2e-25   Erythranthe guttata [common monkey flower]
emb|CDX79139.1|  BnaA01g12060D                                          109   3e-25   
ref|XP_009357505.1|  PREDICTED: plastid-lipid-associated protein,...    109   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_006284145.1|  hypothetical protein CARUB_v10005278mg             108   4e-25   Capsella rubella
gb|AGN30962.1|  chromoplast-specific carotenoid-associated protein      108   4e-25   Narcissus tazetta subsp. chinensis
ref|XP_009114588.1|  PREDICTED: probable plastid-lipid-associated...    108   4e-25   Brassica rapa
sp|Q6K439.1|PAP2_ORYSJ  RecName: Full=Probable plastid-lipid-asso...    108   8e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84129.1|  hypothetical protein OsI_30469                          108   8e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004293330.1|  PREDICTED: plastid-lipid-associated protein,...    108   9e-25   Fragaria vesca subsp. vesca
sp|Q94KU6.1|PAP2_BRACM  RecName: Full=Plastid lipid-associated pr...    108   1e-24   Brassica rapa
gb|KFK30956.1|  hypothetical protein AALP_AA6G049300                    107   1e-24   Arabis alpina [alpine rockcress]
emb|CDX82925.1|  BnaC01g13750D                                          107   1e-24   
emb|CDY16684.1|  BnaA09g20620D                                          107   2e-24   Brassica napus [oilseed rape]
sp|B4F6G1.1|CHRC2_ONCHC  RecName: Full=Chromoplast-specific carot...    107   2e-24   Oncidium hybrid cultivar
gb|EEE69226.1|  hypothetical protein OsJ_28458                          107   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAL67120.1|  AT4g22240/T10I14_70                                     107   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40849.1|  Plastid-lipid-associated protein, chloroplastic         107   2e-24   Glycine soja [wild soybean]
ref|NP_193955.1|  plastid-lipid associated protein PAP / fibrilli...    107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135738.1|  PREDICTED: plastid lipid-associated protein ...    106   3e-24   Brassica rapa
gb|AAK57562.1|  plastid-lipid associated protein PAP2                   106   3e-24   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_009392110.1|  PREDICTED: chromoplast-specific carotenoid-a...    106   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002983947.1|  hypothetical protein SELMODRAFT_156313             106   4e-24   Selaginella moellendorffii
gb|ABK26110.1|  unknown                                                 106   5e-24   Picea sitchensis
gb|ABR17743.1|  unknown                                                 106   5e-24   Picea sitchensis
ref|XP_004956481.1|  PREDICTED: probable plastid-lipid-associated...    105   7e-24   Setaria italica
ref|XP_002872677.1|  plastid lipid-associated protein 1, chloropl...    105   7e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010529464.1|  PREDICTED: probable plastid-lipid-associated...    105   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_002960725.1|  hypothetical protein SELMODRAFT_163532             105   8e-24   Selaginella moellendorffii
ref|XP_009408003.1|  PREDICTED: probable plastid-lipid-associated...    104   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
sp|B2LU34.1|CHRC1_ONCHC  RecName: Full=Chromoplast-specific carot...    105   1e-23   Oncidium hybrid cultivar
ref|XP_006413678.1|  hypothetical protein EUTSA_v10025758mg             104   2e-23   Eutrema salsugineum [saltwater cress]
gb|EYU27735.1|  hypothetical protein MIMGU_mgv1a010083mg                104   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_006849074.1|  hypothetical protein AMTR_s00028p00216930          103   4e-23   Amborella trichopoda
gb|AAO72593.1|  fibrillin-like protein                                  103   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447942.1|  hypothetical protein SORBIDRAFT_06g018550          103   4e-23   Sorghum bicolor [broomcorn]
gb|AAM67287.1|  fibrillin precursor-like protein                        103   4e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84978.1|  unknown                                                 102   8e-23   Medicago truncatula
gb|AFK48303.1|  unknown                                                 102   8e-23   Medicago truncatula
gb|ACJ85346.1|  unknown                                                 102   8e-23   Medicago truncatula
ref|XP_003594154.1|  Plastid-lipid-associated protein                   102   9e-23   Medicago truncatula
ref|XP_006661039.1|  PREDICTED: probable plastid-lipid-associated...    101   1e-22   Oryza brachyantha
ref|XP_002867781.1|  hypothetical protein ARALYDRAFT_914391             102   1e-22   Arabidopsis lyrata subsp. lyrata
gb|KJB34758.1|  hypothetical protein B456_006G082400                    101   3e-22   Gossypium raimondii
ref|XP_010943242.1|  PREDICTED: probable plastid-lipid-associated...    101   3e-22   
ref|XP_003575588.1|  PREDICTED: probable plastid-lipid-associated...    100   3e-22   Brachypodium distachyon [annual false brome]
gb|ACN41157.1|  unknown                                               98.2    3e-22   Picea sitchensis
ref|XP_008780182.1|  PREDICTED: probable plastid-lipid-associated...    100   4e-22   Phoenix dactylifera
ref|XP_008803509.1|  PREDICTED: probable plastid-lipid-associated...    100   4e-22   Phoenix dactylifera
emb|CDX94540.1|  BnaC09g22960D                                        97.4    4e-22   
ref|XP_001766233.1|  predicted protein                                  100   5e-22   
gb|KHG06297.1|  Plastid-lipid-associated, chloroplastic                 100   7e-22   Gossypium arboreum [tree cotton]
ref|XP_010448920.1|  PREDICTED: probable plastid-lipid-associated...  99.8    8e-22   
gb|ACG36654.1|  plastid-lipid-associated protein 2                    99.0    1e-21   Zea mays [maize]
ref|XP_010538742.1|  PREDICTED: plastid lipid-associated protein ...  99.0    2e-21   Tarenaya hassleriana [spider flower]
ref|NP_001150448.1|  LOC100284078                                     98.6    3e-21   Zea mays [maize]
gb|AFW58455.1|  hypothetical protein ZEAMMB73_538731                  97.4    3e-21   
ref|XP_010928413.1|  PREDICTED: probable plastid-lipid-associated...  98.2    3e-21   Elaeis guineensis
gb|AFW58454.1|  plastid-lipid-associated protein 2                    97.4    7e-21   
ref|NP_001150453.1|  LOC100284083                                     97.1    7e-21   
gb|AAD03693.1|  fibrillin                                             96.3    7e-21   Brassica napus [oilseed rape]
ref|XP_003592199.1|  Plastid-lipid-associated protein                 95.1    1e-20   
emb|CDX90850.1|  BnaA03g25300D                                        95.5    3e-20   
emb|CDY21291.1|  BnaC03g29750D                                        93.6    1e-19   Brassica napus [oilseed rape]
ref|XP_009134286.1|  PREDICTED: plastid lipid-associated protein ...  93.6    2e-19   Brassica rapa
gb|AAK57561.1|  plastid-lipid associated protein PAP1                 93.2    2e-19   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010270045.1|  PREDICTED: plastid-lipid-associated protein,...  92.8    3e-19   Nelumbo nucifera [Indian lotus]
tpg|DAA37511.1|  TPA: hypothetical protein ZEAMMB73_707606            90.1    8e-19   
ref|XP_009398685.1|  PREDICTED: probable plastid-lipid-associated...  90.9    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802537.1|  PREDICTED: plastid-lipid-associated protein,...  89.4    1e-18   Phoenix dactylifera
gb|ABR17395.1|  unknown                                               86.7    1e-16   Picea sitchensis
ref|XP_006854055.1|  hypothetical protein AMTR_s00048p00085290        86.3    2e-16   Amborella trichopoda
emb|CBI33829.3|  unnamed protein product                              83.6    3e-16   Vitis vinifera
ref|XP_002505473.1|  predicted protein                                83.2    4e-16   Micromonas commoda
ref|XP_001756848.1|  predicted protein                                82.4    6e-16   
ref|NP_001062631.2|  Os09g0133600                                     82.0    1e-15   
ref|XP_002276479.1|  PREDICTED: plastoglobulin-1, chloroplastic       83.2    1e-15   Vitis vinifera
gb|KIZ02337.1|  hypothetical protein MNEG_5623                        81.6    2e-15   Monoraphidium neglectum
ref|XP_001760672.1|  predicted protein                                77.0    6e-14   
ref|XP_010919972.1|  PREDICTED: probable plastid-lipid-associated...  78.6    6e-14   Elaeis guineensis
ref|XP_010245209.1|  PREDICTED: plastid lipid-associated protein ...  77.8    9e-14   Nelumbo nucifera [Indian lotus]
gb|ABC96720.1|  plastid fibrillin 2                                   76.3    1e-13   Coffea canephora [robusta coffee]
ref|XP_005645631.1|  hypothetical protein COCSUDRAFT_17945            76.6    1e-13   Coccomyxa subellipsoidea C-169
gb|EPS69991.1|  hypothetical protein M569_04771                       76.3    2e-13   Genlisea aurea
ref|XP_004300209.1|  PREDICTED: plastoglobulin-1, chloroplastic       75.5    4e-13   Fragaria vesca subsp. vesca
ref|XP_011082345.1|  PREDICTED: plastoglobulin-1, chloroplastic       75.9    4e-13   Sesamum indicum [beniseed]
gb|ADK79127.1|  astaxanthin vesicles associated protein               75.1    4e-13   Haematococcus lacustris
emb|CDP18539.1|  unnamed protein product                              75.9    5e-13   Coffea canephora [robusta coffee]
ref|XP_011018505.1|  PREDICTED: probable plastid-lipid-associated...  75.1    5e-13   Populus euphratica
ref|XP_006662632.1|  PREDICTED: probable plastid-lipid-associated...  74.7    6e-13   
ref|XP_010096934.1|  putative plastid-lipid-associated protein 3      75.1    7e-13   Morus notabilis
ref|XP_011018504.1|  PREDICTED: plastid lipid-associated protein ...  75.1    9e-13   Populus euphratica
ref|XP_004983554.1|  PREDICTED: probable plastid-lipid-associated...  75.1    9e-13   Setaria italica
ref|XP_004512496.1|  PREDICTED: plastoglobulin-1, chloroplastic-like  74.3    1e-12   Cicer arietinum [garbanzo]
ref|XP_008800090.1|  PREDICTED: probable plastid-lipid-associated...  73.9    1e-12   Phoenix dactylifera
ref|XP_009608239.1|  PREDICTED: plastoglobulin-1, chloroplastic i...  74.3    1e-12   Nicotiana tomentosiformis
ref|XP_009349223.1|  PREDICTED: plastoglobulin-1, chloroplastic-like  73.9    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_010276838.1|  PREDICTED: probable plastid-lipid-associated...  74.7    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009766235.1|  PREDICTED: plastoglobulin-1, chloroplastic       73.9    2e-12   Nicotiana sylvestris
ref|XP_008800089.1|  PREDICTED: probable plastid-lipid-associated...  74.3    2e-12   Phoenix dactylifera
ref|XP_002297709.2|  hypothetical protein POPTR_0001s02040g           73.6    2e-12   
ref|XP_011028127.1|  PREDICTED: plastid lipid-associated protein ...  73.6    3e-12   Populus euphratica
ref|XP_006352897.1|  PREDICTED: plastoglobulin-1, chloroplastic-like  73.6    4e-12   Solanum tuberosum [potatoes]
ref|XP_009403116.1|  PREDICTED: LOW QUALITY PROTEIN: probable pla...  73.6    4e-12   
ref|XP_008448650.1|  PREDICTED: plastoglobulin-1, chloroplastic       73.2    4e-12   Cucumis melo [Oriental melon]
ref|XP_002304354.1|  hypothetical protein POPTR_0003s09460g           73.2    4e-12   
ref|XP_003612834.1|  Plastoglobulin-1                                 72.8    4e-12   Medicago truncatula
ref|XP_004148751.1|  PREDICTED: plastid lipid-associated protein ...  72.8    4e-12   Cucumis sativus [cucumbers]
ref|XP_004245973.1|  PREDICTED: plastoglobulin-1, chloroplastic       72.4    6e-12   Solanum lycopersicum
ref|XP_010053632.1|  PREDICTED: plastoglobulin-1, chloroplastic       72.4    6e-12   Eucalyptus grandis [rose gum]
ref|NP_181092.1|  putative plastid-lipid-associated protein 3         72.8    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619935.1|  PREDICTED: plastoglobulin-1, chloroplastic-like  72.8    7e-12   Nicotiana tomentosiformis
ref|NP_001065482.2|  Os10g0575700                                     72.4    8e-12   
gb|KDP30383.1|  hypothetical protein JCGZ_17112                       72.0    9e-12   Jatropha curcas
sp|Q7XBW5.1|PAP3_ORYSJ  RecName: Full=Probable plastid-lipid-asso...  72.0    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51456.1|  hypothetical protein OsJ_32570                        72.0    1e-11   Oryza sativa Japonica Group [Japonica rice]
sp|Q9ZP40.1|PG1_PEA  RecName: Full=Plastoglobulin-1, chloroplasti...  71.6    1e-11   Pisum sativum [garden pea]
ref|XP_006410707.1|  hypothetical protein EUTSA_v10016800mg           71.6    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003516983.1|  PREDICTED: plastoglobulin-1, chloroplastic-like  71.2    2e-11   Glycine max [soybeans]
ref|XP_010505057.1|  PREDICTED: probable plastid-lipid-associated...  71.2    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010677363.1|  PREDICTED: plastid lipid-associated protein ...  71.6    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005846413.1|  hypothetical protein CHLNCDRAFT_11571            69.3    2e-11   Chlorella variabilis
ref|XP_010509611.1|  PREDICTED: probable plastid-lipid-associated...  70.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002467442.1|  hypothetical protein SORBIDRAFT_01g028150        70.9    2e-11   Sorghum bicolor [broomcorn]
ref|XP_008676981.1|  PREDICTED: fibrillin1 isoform X1                 70.9    2e-11   Zea mays [maize]
gb|AFK33388.1|  unknown                                               70.5    3e-11   Medicago truncatula
gb|ACJ84215.1|  unknown                                               70.5    3e-11   Medicago truncatula
ref|XP_006432746.1|  hypothetical protein CICLE_v10002003mg           69.7    3e-11   
gb|KJB37718.1|  hypothetical protein B456_006G217700                  69.3    3e-11   Gossypium raimondii
ref|XP_010518909.1|  PREDICTED: plastid lipid-associated protein ...  70.1    4e-11   Tarenaya hassleriana [spider flower]
ref|XP_010235051.1|  PREDICTED: probable plastid-lipid-associated...  70.1    4e-11   Brachypodium distachyon [annual false brome]
gb|EYU19056.1|  hypothetical protein MIMGU_mgv1a014970mg              67.8    4e-11   Erythranthe guttata [common monkey flower]
ref|XP_002881399.1|  hypothetical protein ARALYDRAFT_902655           70.1    5e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_007040681.1|  Plastid-lipid associated protein PAP / fibri...  68.6    5e-11   
ref|XP_002518975.1|  Plastid lipid-associated protein 3, chloropl...  69.7    5e-11   Ricinus communis
ref|XP_006294405.1|  hypothetical protein CARUB_v10023422mg           70.1    5e-11   Capsella rubella
ref|XP_006432747.1|  hypothetical protein CICLE_v10002003mg           70.1    6e-11   Citrus clementina [clementine]
gb|KHG16773.1|  Plastid lipid-associated 3, chloroplastic             69.7    6e-11   Gossypium arboreum [tree cotton]
ref|XP_007040682.1|  Plastid-lipid associated protein PAP / fibri...  69.3    6e-11   
ref|NP_001149315.1|  fibrillin1                                       69.7    6e-11   Zea mays [maize]
gb|KJB37719.1|  hypothetical protein B456_006G217700                  69.7    6e-11   Gossypium raimondii
gb|ACG41445.1|  plastid-lipid associated protein 3                    69.7    6e-11   Zea mays [maize]
gb|KJB37720.1|  hypothetical protein B456_006G217700                  69.7    6e-11   Gossypium raimondii
ref|XP_009373486.1|  PREDICTED: plastoglobulin-1, chloroplastic       69.3    6e-11   Pyrus x bretschneideri [bai li]
ref|XP_008373508.1|  PREDICTED: plastoglobulin-1, chloroplastic       69.3    8e-11   Malus domestica [apple tree]
ref|XP_007040679.1|  Plastid-lipid associated protein PAP / fibri...  69.3    9e-11   
gb|KFK36419.1|  hypothetical protein AALP_AA4G121600                  69.3    9e-11   Arabis alpina [alpine rockcress]
ref|XP_010516724.1|  PREDICTED: probable plastid-lipid-associated...  68.9    1e-10   Camelina sativa [gold-of-pleasure]
gb|AAK68845.1|  putative fibrillin                                    68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009608213.1|  PREDICTED: plastoglobulin-1, chloroplastic i...  68.6    2e-10   Nicotiana tomentosiformis
gb|EMS55390.1|  putative plastid-lipid-associated protein 3, chlo...  68.2    2e-10   Triticum urartu
ref|XP_007158263.1|  hypothetical protein PHAVU_002G137800g           67.0    2e-10   Phaseolus vulgaris [French bean]
dbj|BAJ85307.1|  predicted protein                                    68.6    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98223.1|  predicted protein                                    68.2    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008238187.1|  PREDICTED: plastoglobulin-1, chloroplastic       67.8    2e-10   Prunus mume [ume]
gb|EMT01216.1|  Putative plastid-lipid-associated protein 3, chlo...  67.8    2e-10   
ref|XP_007209304.1|  hypothetical protein PRUPE_ppa007851mg           67.8    3e-10   Prunus persica
ref|XP_007158264.1|  hypothetical protein PHAVU_002G137800g           67.4    4e-10   Phaseolus vulgaris [French bean]
emb|CDY31692.1|  BnaA05g08550D                                        66.6    7e-10   Brassica napus [oilseed rape]
emb|CDX84202.1|  BnaC04g09640D                                        66.6    7e-10   
ref|XP_009143664.1|  PREDICTED: plastid lipid-associated protein ...  66.6    7e-10   Brassica rapa
sp|Q94KU5.1|PAP3_BRACM  RecName: Full=Plastid lipid-associated pr...  66.6    8e-10   Brassica rapa
gb|AAK57563.1|  plastid-lipid associated protein PAP3                 66.2    8e-10   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_006368003.1|  PREDICTED: probable plastid-lipid-associated...  66.2    1e-09   Solanum tuberosum [potatoes]
ref|XP_009790013.1|  PREDICTED: plastid lipid-associated protein ...  63.2    4e-09   Nicotiana sylvestris
ref|XP_010279319.1|  PREDICTED: plastid-lipid-associated protein,...  61.6    6e-09   Nelumbo nucifera [Indian lotus]
ref|XP_004244405.1|  PREDICTED: plastoglobulin-1, chloroplastic       62.8    2e-08   Solanum lycopersicum
ref|XP_002945995.1|  hypothetical protein VOLCADRAFT_46047            57.8    3e-07   Volvox carteri f. nagariensis
ref|XP_001698965.1|  plastid lipid associated protein                 58.2    6e-07   Chlamydomonas reinhardtii
ref|XP_002945997.1|  hypothetical protein VOLCADRAFT_46017            57.0    6e-07   Volvox carteri f. nagariensis
ref|XP_001698968.1|  plastid lipid associated protein                 57.4    8e-07   Chlamydomonas reinhardtii
ref|XP_003059745.1|  predicted protein                                56.6    9e-07   Micromonas pusilla CCMP1545
ref|WP_012307392.1|  MULTISPECIES: fibrillin                          55.8    1e-06   Synechococcus
ref|WP_009768204.1|  fibrillin                                        55.5    1e-06   Oscillatoriales cyanobacterium JSC-12
ref|WP_011613884.1|  fibrillin                                        55.1    1e-06   Trichodesmium erythraeum
ref|WP_008188169.1|  fibrillin                                        55.1    2e-06   Moorea producens
ref|XP_008349368.1|  PREDICTED: plastid-lipid-associated protein,...  55.5    2e-06   
ref|WP_017287997.1|  hypothetical protein                             54.7    2e-06   Leptolyngbya boryana
gb|AAD38023.1|AF148219_1  fibrillin                                   53.9    4e-06   Nostoc sp. PCC 8009
ref|WP_006194699.1|  fibrillin                                        53.9    4e-06   Nodularia spumigena
ref|XP_009795803.1|  PREDICTED: probable plastid-lipid-associated...  54.3    4e-06   Nicotiana sylvestris
ref|WP_017653873.1|  fibrillin                                        53.9    4e-06   Fortiea contorta
ref|XP_006367874.1|  PREDICTED: probable plastid-lipid-associated...  53.1    4e-06   Solanum tuberosum [potatoes]
ref|XP_009795804.1|  PREDICTED: probable plastid-lipid-associated...  54.3    4e-06   Nicotiana sylvestris
ref|WP_024546401.1|  fibrillin                                        53.9    4e-06   Synechococcus
ref|WP_015142149.1|  PAP fibrillin                                    53.5    6e-06   Pleurocapsa minor
ref|XP_009589334.1|  PREDICTED: probable plastid-lipid-associated...  53.9    6e-06   Nicotiana tomentosiformis
ref|XP_009795802.1|  PREDICTED: probable plastid-lipid-associated...  54.3    6e-06   Nicotiana sylvestris
ref|WP_041226434.1|  fibrillin                                        53.5    7e-06   Crinalium epipsammum
gb|AFZ12211.1|  PAP fibrillin family protein                          53.1    7e-06   Crinalium epipsammum PCC 9333
ref|XP_009589333.1|  PREDICTED: probable plastid-lipid-associated...  54.3    9e-06   Nicotiana tomentosiformis
ref|WP_008050691.1|  fibrillin                                        52.4    2e-05   Arthrospira
ref|WP_006625760.1|  MULTISPECIES: fibrillin                          52.4    2e-05   Arthrospira
ref|WP_017717779.1|  fibrillin                                        52.0    2e-05   Oscillatoria sp. PCC 10802
ref|WP_015128015.1|  PAP fibrillin family protein                     51.6    3e-05   Calothrix sp. PCC 7507
ref|WP_013323346.1|  fibrillin                                        51.6    3e-05   Cyanothece sp. PCC 7822
ref|WP_015171061.1|  fibrillin                                        51.6    3e-05   Geitlerinema sp. PCC 7407
ref|WP_006617519.1|  fibrillin                                        51.6    3e-05   Arthrospira platensis
gb|KIJ80924.1|  fibrillin                                             51.6    4e-05   Scytonema tolypothrichoides VB-61278
ref|WP_017310080.1|  fibrillin                                        51.6    4e-05   Fischerella sp. PCC 9339
ref|WP_044450060.1|  fibrillin                                        51.6    4e-05   Mastigocladus laminosus
ref|WP_015140456.1|  PAP fibrillin                                    51.2    4e-05   Nostoc sp. PCC 7524
ref|WP_012410287.1|  fibrillin                                        51.2    5e-05   Nostoc punctiforme
ref|WP_007353810.1|  MULTISPECIES: fibrillin                          51.2    5e-05   Kamptonema
ref|WP_036002351.1|  fibrillin                                        51.2    5e-05   [Leptolyngbya] sp. JSC-1
ref|WP_039716372.1|  fibrillin                                        51.2    5e-05   
ref|WP_023074381.1|  fibrillin                                        50.8    5e-05   Leptolyngbya sp. Heron Island J
ref|WP_015210228.1|  PAP_fibrillin                                    50.8    6e-05   Cylindrospermum stagnale
ref|WP_015146841.1|  PAP fibrillin                                    50.8    6e-05   Oscillatoria acuminata
ref|WP_015156100.1|  PAP fibrillin family protein                     50.8    6e-05   Cyanobacteria [blue-green bacteria]
ref|WP_006527167.1|  fibrillin                                        50.8    6e-05   Gloeocapsa sp. PCC 73106
ref|WP_011318109.1|  fibrillin                                        50.8    6e-05   Trichormus variabilis
ref|WP_012597880.1|  fibrillin                                        50.8    7e-05   Cyanothece sp. PCC 7424
ref|WP_010998456.1|  fibrillin                                        50.4    7e-05   Nostocaceae
ref|WP_041036447.1|  fibrillin                                        50.4    8e-05   Tolypothrix campylonemoides
ref|WP_015192734.1|  PAP fibrillin family protein                     50.4    9e-05   Stanieria cyanosphaera
ref|WP_036534133.1|  fibrillin                                        50.4    9e-05   Neosynechococcus sphagnicola
ref|WP_015186507.1|  PAP fibrillin family protein                     50.4    9e-05   Gloeocapsa sp. PCC 7428
ref|WP_019506432.1|  fibrillin                                        50.4    9e-05   Pleurocapsa sp. PCC 7319
ref|WP_026720334.1|  fibrillin                                        50.4    9e-05   Fischerella sp. PCC 9431
ref|WP_036021731.1|  fibrillin                                        50.4    9e-05   
gb|EKV03940.1|  PAP_fibrillin                                         50.4    1e-04   Leptolyngbya sp. PCC 7375
gb|KIE13446.1|  fibrillin                                             50.1    1e-04   Tolypothrix bouteillei VB521301
ref|WP_015175821.1|  PAP fibrillin family protein                     50.1    1e-04   Oscillatoria nigro-viridis
ref|WP_006509831.1|  PAP_fibrillin                                    50.1    1e-04   Xenococcus sp. PCC 7305
ref|WP_017315378.1|  fibrillin                                        49.7    1e-04   
ref|WP_017305990.1|  hypothetical protein                             49.7    2e-04   
ref|WP_012595043.1|  fibrillin                                        49.7    2e-04   
ref|WP_015783811.1|  fibrillin                                        49.7    2e-04   
ref|WP_035991998.1|  fibrillin                                        49.3    2e-04   
ref|WP_006102803.1|  fibrillin                                        49.3    2e-04   
ref|WP_016862318.1|  fibrillin                                        49.3    2e-04   
ref|WP_015111813.1|  PAP fibrillin family protein                     49.3    3e-04   
ref|WP_015226493.1|  fibrillin                                        49.3    3e-04   
gb|EAW35713.1|  fibrillin                                             49.3    3e-04   
gb|ABD39693.1|  fibrillin 5                                           49.3    3e-04   
ref|WP_017658618.1|  fibrillin                                        48.5    4e-04   
ref|WP_039742995.1|  fibrillin                                        48.5    4e-04   
ref|WP_017745894.1|  fibrillin                                        48.5    4e-04   
ref|WP_039896592.1|  fibrillin                                        48.5    4e-04   
emb|CDP12788.1|  unnamed protein product                              49.3    5e-04   
ref|WP_015158219.1|  PAP_fibrillin                                    48.5    5e-04   
ref|WP_015180510.1|  PAP fibrillin                                    48.5    5e-04   
ref|WP_006631292.1|  fibrillin                                        48.5    5e-04   
ref|WP_026733113.1|  fibrillin                                        48.5    5e-04   
ref|WP_008311462.1|  fibrillin                                        48.5    5e-04   
ref|WP_016867324.1|  fibrillin                                        48.1    5e-04   
ref|WP_015231060.1|  PAP fibrillin                                    48.5    5e-04   
ref|WP_007306077.1|  fibrillin                                        48.1    5e-04   
ref|WP_007311273.1|  fibrillin                                        48.1    5e-04   
emb|CCQ62956.1|  fibrillin                                            48.1    6e-04   
ref|WP_009545266.1|  MULTISPECIES: fibrillin                          48.1    6e-04   
ref|XP_010312461.1|  PREDICTED: probable plastid-lipid-associated...  48.1    6e-04   
gb|ACB52918.1|  fibrillin                                             48.1    7e-04   
ref|WP_040932316.1|  fibrillin                                        48.1    7e-04   
ref|XP_006351024.1|  PREDICTED: probable plastid-lipid-associated...  48.5    7e-04   
ref|WP_040936721.1|  fibrillin                                        48.1    7e-04   
ref|XP_006351023.1|  PREDICTED: probable plastid-lipid-associated...  48.5    8e-04   
ref|XP_004249867.1|  PREDICTED: probable plastid-lipid-associated...  48.5    8e-04   
ref|WP_008274287.1|  fibrillin                                        47.8    9e-04   
ref|WP_015081106.1|  PAP fibrillin family protein                     47.8    0.001   



>gb|EYU33869.1| hypothetical protein MIMGU_mgv1a010099mg [Erythranthe guttata]
Length=322

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 83/116 (72%), Gaps = 10/116 (9%)
 Frame = +2

Query  191  FPNRGLANP---NRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQ  361
            FP    AN     R F VR VSDDEWG +  EP SA  A +          +E DVLKKQ
Sbjct  48   FPALSTANSAKVKRDFSVRLVSDDEWGPDS-EPSSAGVAVLEEKP------SEIDVLKKQ  100

Query  362  LVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LVDSFYGTNRGLSASSETRAEVVELITQLEAK PTPAPTEAL LLN KW+LAYT+F
Sbjct  101  LVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALPLLNGKWILAYTTF  156



>ref|XP_011086212.1| PREDICTED: light-induced protein, chloroplastic-like [Sesamum 
indicum]
Length=312

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +2

Query  194  PNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDS  373
            P R  A   +KF V AVS+DEWG +  EP     A +          +E D+LKKQLVDS
Sbjct  42   PLRKSAKLKQKFTVGAVSEDEWGPDN-EPAPPGVAVIDEKP------SEIDILKKQLVDS  94

Query  374  FYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            FYGTNRGL ASS+TRAE+VELITQLEAK PTPAPTEALTLLN KW+LAYT+F
Sbjct  95   FYGTNRGLGASSDTRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTTF  146



>gb|AIX87511.1| fibrillin [Lycium barbarum]
Length=321

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 86/128 (67%), Gaps = 3/128 (2%)
 Frame = +2

Query  155  TIFASKVAALRSFPNRGLANPNRKFVVRAV---SDDEWGEEKKEPLSaapagvavvexep  325
            + F SK    +    +   NP  +F V+A     DDEWG E ++   +  A       +P
Sbjct  29   STFPSKTEVHKPISIKQSTNPKPRFTVQATKYDQDDEWGPEVEQIKPSGVAVAEEEPPKP  88

Query  326  aaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXK  505
               +E D+LKK+L D+FYGTNRGLSASSETRAE+VELITQLE+K PTPAPTEALTLLN +
Sbjct  89   KEPSEIDLLKKELTDAFYGTNRGLSASSETRAEIVELITQLESKNPTPAPTEALTLLNGR  148

Query  506  WVLAYTSF  529
            W+LAYTSF
Sbjct  149  WILAYTSF  156



>emb|CAN69132.1| hypothetical protein VITISV_012048 [Vitis vinifera]
Length=281

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +2

Query  203  GLANPNRKFV-VRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G  N  R  V VR   DDEWG EK EP         V E +   +T    LKK LVDSFY
Sbjct  10   GEVNRGRPVVLVRTALDDEWGPEKXEPEGEGSTVAVVEEEKSKEITS---LKKALVDSFY  66

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            GT+RGL A+SETRAE+VELITQLEAK PTPAPTEALTLLN KW+LAYTSF
Sbjct  67   GTDRGLKATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTSF  116



>gb|KDO78379.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=248

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  230  VVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            + RA  DDEWG EK++      A     E  P  +TE D LKK LVDSFYGT+RGL+A+S
Sbjct  61   LTRAADDDEWGPEKEK--EEGGALAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNATS  118

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK PTPAPTEALTLLN KW+L YTSF
Sbjct  119  ETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSF  158



>gb|KDO78378.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=323

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  230  VVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            + RA  DDEWG EK++      A     E  P  +TE D LKK LVDSFYGT+RGL+A+S
Sbjct  61   LTRAADDDEWGPEKEK--EEGGALAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNATS  118

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK PTPAPTEALTLLN KW+L YTSF
Sbjct  119  ETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSF  158



>ref|XP_006449818.1| hypothetical protein CICLE_v10015934mg [Citrus clementina]
 sp|Q9ZWQ8.1|PAP_CITUN RecName: Full=Plastid-lipid-associated protein, chloroplastic; 
AltName: Full=CitPAP; Flags: Precursor [Citrus unshiu]
 dbj|BAA34702.1| homolog to plastid-lipid-associated protein [Citrus unshiu]
 gb|ESR63058.1| hypothetical protein CICLE_v10015934mg [Citrus clementina]
Length=323

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  230  VVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            + RA  DDEWG EK++      A     E  P  +TE D LKK LVDSFYGT+RGL+A+S
Sbjct  61   LTRAADDDEWGPEKEK--EGGGALAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNATS  118

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK PTPAPTEALTLLN KW+L YTSF
Sbjct  119  ETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSF  158



>ref|NP_001234183.1| plastid lipid associated protein CHRC [Solanum lycopersicum]
 gb|ABC42191.1| plastid lipid associated protein CHRC [Solanum lycopersicum]
Length=326

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagva  307
             + ++ST F SK    R+   +    P  KF  +A +   +DEWG E  E +S     V 
Sbjct  30   TLPISSTNFPSKTELHRAISVKEFTYPKPKFTAQATNYDKEDEWGPEV-EKISPGGVAVV  88

Query  308  vvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEAL  487
              E      +E ++LKKQL DSFYGTNRGLSASSETRAE+VELITQLE+K P PAPTEAL
Sbjct  89   DEEPPKEP-SEIELLKKQLADSFYGTNRGLSASSETRAEIVELITQLESKNPNPAPTEAL  147

Query  488  TLLNXKWVLAYTSF  529
            TLLN KW+LAYTSF
Sbjct  148  TLLNGKWILAYTSF  161



>ref|XP_006467367.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Citrus sinensis]
Length=392

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = +2

Query  167  SKVAALRSFPN-RGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTET  343
            S+  A +SF + +G        + RA  DDEWG EK++      A     E  P  +TE 
Sbjct  108  SRSLAKKSFLSIQGFTRARPLVLTRAADDDEWGPEKEK--EEGGALAVAEEESPKEVTEI  165

Query  344  DVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYT  523
            D LKK LVDSFYGT+RGL+A+SETRAE+VELITQLEAK PTPAPTEALTLLN KW+L YT
Sbjct  166  DNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYT  225

Query  524  SF  529
            SF
Sbjct  226  SF  227



>ref|NP_001275061.1| light-induced protein, chloroplastic [Solanum tuberosum]
 sp|P80471.2|LIPC_SOLTU RecName: Full=Light-induced protein, chloroplastic; AltName: 
Full=Drought-induced stress protein CDSP-34; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA75558.1| chloroplast drought-induced stress protein, 34 kD) [Solanum tuberosum]
Length=326

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagva  307
             + ++ST F SK    RS   +   NP  KF  +A +   +DEWG E ++          
Sbjct  30   TLPISSTNFPSKTELHRSISVKEFTNPKPKFTAQATNYDKEDEWGPEVEQ--IRPGGVAV  87

Query  308  vvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEAL  487
            V E  P   +E ++LKKQL DS YGTNRGLSASSETRAE+VELITQLE+K P PAPTEAL
Sbjct  88   VEEEPPKEPSEIELLKKQLADSLYGTNRGLSASSETRAEIVELITQLESKNPNPAPTEAL  147

Query  488  TLLNXKWVLAYTSF  529
            TLLN KW+LAYTSF
Sbjct  148  TLLNGKWILAYTSF  161



>gb|AIX87535.1| fibrillin [Lycium ruthenicum]
Length=321

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = +2

Query  155  TIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagvavvexep  325
            + F SK    +    +   NP  +F  +  +   +DEWG E ++   +  A       +P
Sbjct  29   STFPSKTELHKPISIKQSTNPKPRFTAQGTNYDKEDEWGPEPEQIKPSGVAVAEEEPPKP  88

Query  326  aaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXK  505
               +E D+LKK+L D+FYGTNRGLSASSETRAE+VELITQLE+K PTPAPTEALTLLN +
Sbjct  89   KESSEIDLLKKKLTDAFYGTNRGLSASSETRAEIVELITQLESKNPTPAPTEALTLLNGR  148

Query  506  WVLAYTSF  529
            W+LAYTSF
Sbjct  149  WILAYTSF  156



>sp|O99019.1|LIPC_SOLDE RecName: Full=Light-induced protein, chloroplastic; AltName: 
Full=C40.4; Flags: Precursor [Solanum demissum]
 emb|CAA10372.1| fibrillin [Solanum demissum]
Length=326

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagva  307
             + ++ST F SK    RS   +   NP  KF  +A +   +DEWG E ++          
Sbjct  30   TLPISSTNFLSKTEQHRSISVKEFTNPKPKFTAQATNYDKEDEWGPEVEQ--IRPGGVAV  87

Query  308  vvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEAL  487
            V E  P   +E ++LKKQL DS YGTNRGLSASSETRAE+VELITQLE+K P PAPTEAL
Sbjct  88   VEEEPPKEPSEIELLKKQLADSLYGTNRGLSASSETRAEIVELITQLESKNPNPAPTEAL  147

Query  488  TLLNXKWVLAYTSF  529
            TLLN KW+LAYTSF
Sbjct  148  TLLNGKWILAYTSF  161



>ref|XP_008384113.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
 ref|XP_008358758.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
Length=320

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +2

Query  233  VRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSE  412
            +R+ +DDEWG E++       A     +       E   LKK LVDSFYGTNRGLSA+SE
Sbjct  57   IRSANDDEWGNEREVESGGDVAVAVEEKPAEPEPAEISQLKKALVDSFYGTNRGLSATSE  116

Query  413  TRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            TRAE+VELITQLEAK PTPAPTEAL LLN KW+LAYTSF
Sbjct  117  TRAEIVELITQLEAKNPTPAPTEALPLLNGKWILAYTSF  155



>ref|XP_004486195.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Cicer arietinum]
 ref|XP_004517240.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Cicer arietinum]
Length=320

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = +2

Query  209  ANPNRKFV-VRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYG  382
            A+ +R+ V V AV SDDEWG ++  P +     V     E    TETD LKK LVDSFYG
Sbjct  48   ADVSRRVVYVHAVTSDDEWGPDRDVPYAGVAVAVEEKPVE----TETDKLKKALVDSFYG  103

Query  383  TNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            T+RGL ASSETRAE+VELI+QLEAK PTPAPT+ALTLLN KW+L YTSF
Sbjct  104  TDRGLKASSETRAEIVELISQLEAKNPTPAPTDALTLLNGKWILVYTSF  152



>ref|XP_003546169.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Glycine max]
 gb|KHN32987.1| Plastid-lipid-associated protein, chloroplastic [Glycine soja]
Length=306

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = +2

Query  233  VRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            VRAV SDDEWG EK+E      A            TET+ LKK LVDSFYGT+RGL A+S
Sbjct  45   VRAVTSDDEWGPEKEEAYGGGVAVEEKPTKSE---TETEKLKKALVDSFYGTDRGLKATS  101

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK P P PT+ALTLLN KW+LAYTSF
Sbjct  102  ETRAEIVELITQLEAKNPNPVPTDALTLLNGKWILAYTSF  141



>ref|XP_002524410.1| Plastid-lipid-associated protein, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF38021.1| Plastid-lipid-associated protein, chloroplast precursor, putative 
[Ricinus communis]
Length=321

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +2

Query  227  FVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSA  403
            F +RAV ++DEWG + ++   A     +  + +P  +TE D LKKQLVDSFYGT+RGL A
Sbjct  52   FSIRAVDAEDEWGPDYEDSAVAVAEEESEEKLKPTEVTEIDSLKKQLVDSFYGTDRGLKA  111

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +SETRAE+VELITQLE+K PT APTEALTLLN KW+LAYTSF
Sbjct  112  TSETRAEIVELITQLESKNPTAAPTEALTLLNGKWILAYTSF  153



>gb|AIX02792.1| fibrillin 1 protein [Capsicum annuum]
 gb|AIX02793.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagva  307
             + + S  F SK    RS   +   NP  KF  +A +   +DEWG E ++          
Sbjct  26   SLPLTSPNFPSKTELHRSISIKEFTNPKPKFTAQATNYDKEDEWGPELEQ--INPGGVAV  83

Query  308  vvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEAL  487
            V E  P   +E + LKKQL DSFYGTNRGLSASSETRAE+VELITQLE+K PTPAPTEAL
Sbjct  84   VEEEPPKEPSEMEKLKKQLTDSFYGTNRGLSASSETRAEIVELITQLESKNPTPAPTEAL  143

Query  488  TLLNXKWVLAYTSF  529
            +LLN KW+LAYTSF
Sbjct  144  SLLNGKWILAYTSF  157



>gb|AIX02791.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagva  307
             + + S  F SK    RS   +   NP  KF  +A +   +DEWG E ++          
Sbjct  26   SLPLTSPNFPSKTELHRSISIKEFTNPKPKFTAQATNYDKEDEWGPELEQ--INPGGVAV  83

Query  308  vvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEAL  487
            V E  P   +E + LKKQL DSFYGTNRGLSASSETRAE+VELITQLE+K PTPAPTEAL
Sbjct  84   VEEEPPKEPSEMEKLKKQLTDSFYGTNRGLSASSETRAEIVELITQLESKNPTPAPTEAL  143

Query  488  TLLNXKWVLAYTSF  529
            +LLN KW+LAYTSF
Sbjct  144  SLLNGKWILAYTSF  157



>ref|XP_007147677.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris]
 gb|ESW19671.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris]
Length=310

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 74/100 (74%), Gaps = 6/100 (6%)
 Frame = +2

Query  233  VRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            VRAV SDDEWG EK+E      A    V        ET+ LKK LV SFYGTNRGL A+S
Sbjct  51   VRAVTSDDEWGTEKEEVYGGGVAVEEKVAEP-----ETERLKKALVGSFYGTNRGLKATS  105

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK PTPAPT+ALTLLN KW+LAYTSF
Sbjct  106  ETRAEIVELITQLEAKNPTPAPTDALTLLNGKWILAYTSF  145



>emb|CAA50750.1| fibrillin [Capsicum annuum]
 emb|CAA65784.1| plastoglobules associated protein [Capsicum annuum]
 emb|CAA66160.1| plastoglobules associated protein [Capsicum annuum]
 emb|CAA10373.1| plastid-lipid-associated protein [Capsicum annuum]
 gb|AIX02794.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagva  307
             + + S  F SK    RS   +   NP  KF  +A +   +DEWG E ++          
Sbjct  26   SLPLTSPNFPSKTELHRSISIKEFTNPKPKFTAQATNYDKEDEWGPELEQ--INPGGVAV  83

Query  308  vvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEAL  487
            V E  P   +E + LKKQL DSFYGTNRGLSASSETRAE+VELITQLE+K PTPAPTEAL
Sbjct  84   VEEEPPKEPSEMEKLKKQLTDSFYGTNRGLSASSETRAEIVELITQLESKNPTPAPTEAL  143

Query  488  TLLNXKWVLAYTSF  529
            +LLN KW+LAYTSF
Sbjct  144  SLLNGKWILAYTSF  157



>ref|XP_004134784.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast-like [Cucumis sativus]
 ref|XP_004169325.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast-like [Cucumis sativus]
 sp|Q96398.1|CHRC_CUCSA RecName: Full=Chromoplast-specific carotenoid-associated protein, 
chromoplast; Flags: Precursor [Cucumis sativus]
 emb|CAA64846.1| chromoplast-specific carotenoid-associated protein, CHRC [Cucumis 
sativus]
 gb|AAD05165.1| chromoplast-specific carotenoid-associated protein CHRC [Cucumis 
sativus]
 gb|KGN49072.1| hypothetical protein Csa_6G512870 [Cucumis sativus]
Length=322

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 5/145 (3%)
 Frame = +2

Query  110  TILIHPETLCISVNSTIF--ASKVAALRSFPNRGLANPNRKFVVRAV-SDDEWGEEKKEP  280
            T+ ++P    ++   ++F  AS  A  R+   + L +    F VRAV +DDEWGE+K E 
Sbjct  14   TLALNPPQPQLTSKPSVFPIASIGATARAAAGKSLISVRPAFKVRAVLNDDEWGEDKDEK  73

Query  281  LSaapagvavvexepaaLTETDV--LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEA  454
                 +     + E   L  +++  LKK LVDSFYGT+RGL  S +TRAE+VELITQLE+
Sbjct  74   YGDDSSVAVAEKEEEKPLEPSEIYKLKKALVDSFYGTDRGLRVSRDTRAEIVELITQLES  133

Query  455  KXPTPAPTEALTLLNXKWVLAYTSF  529
            K PTPAPTEALTLLN KW+LAYT+F
Sbjct  134  KNPTPAPTEALTLLNGKWILAYTTF  158



>gb|KJB57828.1| hypothetical protein B456_009G182500 [Gossypium raimondii]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 92/157 (59%), Gaps = 9/157 (6%)
 Frame = +2

Query  86   QTRRYDLSTILIHPET-------LCISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV  244
            Q   +   T LI P+          + +NST           F  +    P   F VRA 
Sbjct  6    QLNNFPCKTFLITPQNSNFTSKLPVLPLNSTKPTQNSIKKSQFLTQKSVQPRPVFQVRAS  65

Query  245  -SDDEWGEEKKEPLS-aapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETR  418
             +DDEWG +K+EP+   +P      E +P    E + LKK LVDSFYGT+RGL ASSETR
Sbjct  66   DADDEWGPDKEEPVVIESPGVAVAEEKKPDDAGEIESLKKALVDSFYGTDRGLKASSETR  125

Query  419  AEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            AE+VELITQLEAK PTPAPTEAL LLN KW+L YTSF
Sbjct  126  AEIVELITQLEAKNPTPAPTEALPLLNGKWILKYTSF  162



>ref|XP_008224724.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Prunus mume]
Length=324

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  125  PETLCISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagv  304
            P +L  + NS + A+K      F             +R V +DEWG EK+    +A A  
Sbjct  28   PFSLLFAPNSIVLAAKFNNQLKFSTHEFVGTRPATRLRVVDEDEWGPEKE--TESAVAVA  85

Query  305  avvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEA  484
               +       ET  LKK LVDSFYGT+RGLSA+SETRAE+VELITQLEA+ PTPAPTEA
Sbjct  86   EDDKPAEPEPAETSRLKKALVDSFYGTDRGLSATSETRAEIVELITQLEAQNPTPAPTEA  145

Query  485  LTLLNXKWVLAYTSF  529
            L LLN KW+LAYTSF
Sbjct  146  LPLLNGKWILAYTSF  160



>gb|KDO78380.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
 gb|KDO78381.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=181

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  230  VVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            + RA  DDEWG EK++      A     E  P  +TE D LKK LVDSFYGT+RGL+A+S
Sbjct  61   LTRAADDDEWGPEKEK--EEGGALAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNATS  118

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK PTPAPTEALTLLN KW+L +  F
Sbjct  119  ETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVHIFF  158



>gb|KHG02015.1| Plastid-lipid-associated, chloroplastic [Gossypium arboreum]
Length=326

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 92/157 (59%), Gaps = 9/157 (6%)
 Frame = +2

Query  86   QTRRYDLSTILIHPETL-------CISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV  244
            Q   +   T LI P+          + +NST           F  +    P   F +RA 
Sbjct  6    QLNNFPCKTFLITPQNSNFTSKLPVLPLNSTKPTQNSIKKSQFLTQKSVQPRPVFQIRAS  65

Query  245  -SDDEWGEEKKEPLS-aapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETR  418
             +DDEWG +K+EP+   +P      E +P    E + LKK LVDSFYGT+RGL ASSETR
Sbjct  66   DADDEWGPDKEEPVVIESPGVAVAEEKKPDDAGEIESLKKALVDSFYGTDRGLKASSETR  125

Query  419  AEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            AE+VELITQLEAK PTPAPTEAL LLN KW+L YTSF
Sbjct  126  AEIVELITQLEAKNPTPAPTEALPLLNGKWILKYTSF  162



>ref|XP_007211630.1| hypothetical protein PRUPE_ppa005787mg [Prunus persica]
 gb|EMJ12829.1| hypothetical protein PRUPE_ppa005787mg [Prunus persica]
Length=444

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  125  PETLCISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagv  304
            P +L  + NS + A+K      F             +R V +DEWG EK+    +A A  
Sbjct  147  PFSLLFAPNSNVLAAKFNNQLKFSTHEFVGTRPATRLRVVDEDEWGPEKE--TESAVAVA  204

Query  305  avvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEA  484
               +       ET  LKK LVDSFYGT+RGLSA+SETRAE+VELITQLEA+ PTPAPTEA
Sbjct  205  EDDKPAEPESAETSRLKKALVDSFYGTDRGLSATSETRAEIVELITQLEAQNPTPAPTEA  264

Query  485  LTLLNXKWVLAYTSF  529
            L LLN KW+LAYTSF
Sbjct  265  LPLLNGKWILAYTSF  279



>ref|XP_009788638.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=321

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = +2

Query  212  NPNRKFVVRAVS---DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYG  382
            NP  KF  +A +   DDEWG E ++   +        E  P   +E ++LKKQLVDSFYG
Sbjct  48   NPKPKFTAQAKNYDKDDEWGPEVEQIKPSGGGVAVAEEEPPKEPSEIELLKKQLVDSFYG  107

Query  383  TNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            TNRGLSASSETRAE+VELIT+LE+  PTPAPTEAL LLN KW+LAYTSF
Sbjct  108  TNRGLSASSETRAEIVELITKLESMNPTPAPTEALPLLNGKWILAYTSF  156



>ref|XP_009628206.1| PREDICTED: light-induced protein, chloroplastic [Nicotiana tomentosiformis]
Length=322

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 96/145 (66%), Gaps = 11/145 (8%)
 Frame = +2

Query  128  ETLCISVNSTIFASKVAAL----RSFPN---RGLANPNRKFVVRAVS---DDEWGEEKKE  277
            +TL I+   +   SK++ L     +FP+   +   NP  KF  +A +   +DEWG E ++
Sbjct  13   KTLQITSQYSKSTSKISTLPLTSTNFPSISVKEFTNPKPKFTAQAKNYDKEDEWGPEVEQ  72

Query  278  -PLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEA  454
               S     VA  E      +E ++LKKQLVDSFYGTNRGLSASSETRAE+VELIT+LE+
Sbjct  73   IKPSGGGVSVAEEEPPKEEPSEIELLKKQLVDSFYGTNRGLSASSETRAEIVELITKLES  132

Query  455  KXPTPAPTEALTLLNXKWVLAYTSF  529
            K PTPAPTEAL LLN KW+LAYTSF
Sbjct  133  KNPTPAPTEALPLLNGKWILAYTSF  157



>ref|XP_009795634.1| PREDICTED: light-induced protein, chloroplastic [Nicotiana sylvestris]
Length=321

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = +2

Query  188  SFPN---RGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagvavvexepaaLTETDV  349
            +FP+   +   NP  KF  +A +   DDEWG E ++   +        E  P   +E ++
Sbjct  37   NFPSISVKEFTNPKPKFTAQAKNYDKDDEWGPEVEQIKPSGGGVAVAEEEPPKEPSEIEL  96

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LKKQLVDSFYGTNRGLSASSETRAE+VELIT+LE+  PTPAPTEAL LLN KW+LAYTSF
Sbjct  97   LKKQLVDSFYGTNRGLSASSETRAEIVELITKLESMNPTPAPTEALPLLNGKWILAYTSF  156



>gb|ABK96652.1| unknown [Populus trichocarpa x Populus deltoides]
Length=329

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 85/129 (66%), Gaps = 7/129 (5%)
 Frame = +2

Query  143  SVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexe  322
            + N++I   ++   R  P    A     F+V+AV +DE   E + P     A     E E
Sbjct  43   TTNNSILKQRILVTREQP----AKKRNLFLVKAVDEDEGSPENEGP---PVALAEKGEEE  95

Query  323  paaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNX  502
               LTE D LK QLVD+FYGT+RGL+A+SETRAEVVELITQLEA+ P PAPTEALTLLN 
Sbjct  96   LKELTEVDRLKGQLVDTFYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNG  155

Query  503  KWVLAYTSF  529
            KW+LAYTSF
Sbjct  156  KWILAYTSF  164



>ref|XP_007026203.1| Plastid-lipid associated protein PAP / fibrillin family protein 
[Theobroma cacao]
 gb|EOY28825.1| Plastid-lipid associated protein PAP / fibrillin family protein 
[Theobroma cacao]
Length=427

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 6/103 (6%)
 Frame = +2

Query  227  FVVRAVSDDEWGEEK------KEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTN  388
            F VRAV DDE+G +K      ++P++ +PA     E +P  ++E D LKK LVDSFYGTN
Sbjct  138  FQVRAVYDDEYGPDKAEEEEEEQPVTESPAVAVAEEEKPKEVSEVDSLKKALVDSFYGTN  197

Query  389  RGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            RGL A+SETRAE+VELITQLEAK PTPAPTEALTLLN KW+LA
Sbjct  198  RGLKATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILA  240



>gb|ABA43902.1| fibrillin [Coffea canephora]
Length=320

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +2

Query  227  FVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSAS  406
            FVV   + D++G E++     A       E  P    E D+LKK+LVDSFYGT+RGL+AS
Sbjct  60   FVVLVAAGDDYGPEEE-----AAGVAVAEEPPPKEPREIDILKKRLVDSFYGTDRGLNAS  114

Query  407  SETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            SETRAEVVELITQLEAK PTPAPTEALTLLN KW+LAYTSFI
Sbjct  115  SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFI  156



>emb|CAA75658.1| Plastid-lipid-Associated Protein [Solanum lycopersicum]
Length=146

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            +DEWG E  E LS     V   E      +E ++LKKQL DSFYGTNRGLSASSETRAE+
Sbjct  7    EDEWGPEV-EKLSPGGVAVVDEEPPKEP-SEIELLKKQLADSFYGTNRGLSASSETRAEI  64

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            VELITQLE+K P PAPTEALTLLN KW+LAYTSF
Sbjct  65   VELITQLESKNPNPAPTEALTLLNGKWILAYTSF  98



>emb|CDP04455.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +2

Query  227  FVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSAS  406
            FVV   + D++G E++     A       E  P    E D+LKK+LVDSFYGT+RGL+AS
Sbjct  60   FVVLVATGDDYGPEEE-----AAGVAVAEEPPPKEPREIDILKKRLVDSFYGTDRGLNAS  114

Query  407  SETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            SETRAEVVELITQLEAK PTPAPTEALTLLN KW+LAYTSFI
Sbjct  115  SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFI  156



>ref|XP_010252567.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=332

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 101/162 (62%), Gaps = 8/162 (5%)
 Frame = +2

Query  68   FHSIPLQTRRYDLSTILIHPETLCISVNSTIFASKVAALRS-FPNRGLANPNRKFV-VRA  241
            F+ +P Q      S  L+        +NS    SK  + RS F  RG ++  R  + VR 
Sbjct  7    FNLLPCQNPSLTRSQRLLGSNNSVSPLNSIGVISKNLSERSVFSLRGRSHRVRPVLRVRE  66

Query  242  VSDDEWG---EEKKEPLSaapagvavvexepaaLTETDV--LKKQLVDSFYGTNRGLSAS  406
            V DDEWG   EE+++P+    A    V  +    +++++  LKK L+DS YGT+RGL AS
Sbjct  67   V-DDEWGPDKEEEEKPVGEGVAAATAVADKSEDPSDSEIYNLKKALIDSLYGTDRGLRAS  125

Query  407  SETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            SETRAE+VELITQLEAK PT APTEALTLLN KW+LAYTSF+
Sbjct  126  SETRAEIVELITQLEAKNPTAAPTEALTLLNGKWILAYTSFV  167



>gb|KDP20693.1| hypothetical protein JCGZ_21164 [Jatropha curcas]
Length=311

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 90/151 (60%), Gaps = 36/151 (24%)
 Frame = +2

Query  128  ETLCISVNSTIFASKVAALRSFPNRGLANPNRK-------FVVRAVSDD----------E  256
            +TL  +  ++ F S+ + L  FP+  LAN   K       F+VRAV DD           
Sbjct  15   KTLSKTPPNSQFNSRPSVL-PFPSIKLANSISKSTLGRPAFLVRAVDDDGESASEAVAVA  73

Query  257  WGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVEL  436
              E  KEP                  +E D LKKQLVDSFYGT+RGL+ASSETRAE+VEL
Sbjct  74   EVEAPKEP------------------SEVDALKKQLVDSFYGTDRGLTASSETRAEIVEL  115

Query  437  ITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ITQLEAK PT APTEALTLLN KW+LAYTSF
Sbjct  116  ITQLEAKNPTAAPTEALTLLNGKWILAYTSF  146



>ref|XP_006383843.1| chromoplast-specific carotenoid-associated protein CHRC [Populus 
trichocarpa]
 gb|ERP61640.1| chromoplast-specific carotenoid-associated protein CHRC [Populus 
trichocarpa]
Length=329

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +2

Query  143  SVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexe  322
            + N++I   ++   R  P +        F+V+AV +DE   E + P     A     E E
Sbjct  43   TTNNSILKPRILVTREQPTKK----RNLFLVKAVDEDEGSPENEGP---PVALAEKGEEE  95

Query  323  paaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNX  502
               L E D LK QLVD+FYGT+RGL+A+SETRAEVVELITQLEA+ P PAPTEALTLLN 
Sbjct  96   LKELAEVDRLKGQLVDTFYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNG  155

Query  503  KWVLAYTSF  529
            KW+LAYTSF
Sbjct  156  KWILAYTSF  164



>ref|XP_010422246.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=320

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 5/123 (4%)
 Frame = +2

Query  179  ALRSFPNR---GLANPNRKFVVRAVS-DDEWGEEKKEP-LSaapagvavvexepaaLTET  343
            ++ SF  R   G++   R F VRA   DDEWG+E  E  ++++       +    ++ ET
Sbjct  34   SVHSFNRRSELGISVHRRGFKVRATDFDDEWGQEGVERVMASSSVAEKEADEAIESVEET  93

Query  344  DVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYT  523
            + LK+ L DS YGT+RGLSASS+TRAE+ ELITQ+E+K PTPAPT+AL LLN KW+LAYT
Sbjct  94   EKLKRSLADSLYGTDRGLSASSDTRAEISELITQIESKNPTPAPTDALFLLNGKWILAYT  153

Query  524  SFI  532
            SF+
Sbjct  154  SFV  156



>ref|XP_008440050.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast [Cucumis melo]
Length=323

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +2

Query  227  FVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDV--LKKQLVDSFYGTNRGL  397
            F VRAV +DDEWGEEK+E      A     E E   +  +++  LKK LVDSFYGT+RGL
Sbjct  55   FKVRAVLNDDEWGEEKEEKYGDGSAVAVAEEEEEKPMEPSEIYKLKKALVDSFYGTDRGL  114

Query  398  SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
              S +TRAE+VELITQLE+K PTPAPTEALTLLN KW+L YTSF
Sbjct  115  RVSRDTRAEIVELITQLESKNPTPAPTEALTLLNGKWILQYTSF  158



>gb|EPS66635.1| hypothetical protein M569_08140, partial [Genlisea aurea]
Length=228

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  LTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWV  511
            ++E D LKKQL+DSFYGTNRGLSASSETRAE+VELI+Q+EAK PTPAPT+AL LLN KW+
Sbjct  2    VSEIDALKKQLLDSFYGTNRGLSASSETRAEIVELISQIEAKNPTPAPTDALPLLNGKWI  61

Query  512  LAYTSF  529
            LAYT+F
Sbjct  62   LAYTTF  67



>ref|XP_010496158.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=321

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = +2

Query  179  ALRSFPNR---GLANPNRKFVVRAVS-DDEWGEEKKEP-LSaapagvavvexepaaLTET  343
            ++ SF  R   G++   R F VRA   DDEWG+E  E  ++++       +    ++ ET
Sbjct  35   SVHSFNRRSELGISVHRRGFKVRATDFDDEWGQEGVERVMASSSVAEKEADEAIESVEET  94

Query  344  DVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYT  523
            + LK+ L DS YGT+RGL ASS+TRAE+ ELITQLE+K PTPAPT+AL LLN KW+LAYT
Sbjct  95   EKLKRSLADSLYGTDRGLCASSDTRAEISELITQLESKNPTPAPTDALFLLNGKWILAYT  154

Query  524  SFI  532
            SF+
Sbjct  155  SFV  157



>dbj|BAJ98727.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87659.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97495.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 74/120 (62%), Gaps = 8/120 (7%)
 Frame = +2

Query  179  ALRSFPNRGLANPNRKFVVRAV---SDDEWGEEKKEPLSaapagvavvexepaaLTETDV  349
            A R FP+  L    R    RAV   +DDEWG   KEP     A             E   
Sbjct  34   AARRFPS--LRAARRVVTARAVPVDADDEWG---KEPAEGGTAVAEAPSEAAETAGELAA  88

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK++L  + YGT RGL ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  89   LKQKLKAALYGTERGLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  148



>ref|XP_011047005.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Populus 
euphratica]
Length=329

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 83/129 (64%), Gaps = 7/129 (5%)
 Frame = +2

Query  143  SVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexe  322
            + N++I   ++   R  P +         +V+AV +DE   E + P     A     E E
Sbjct  43   TTNNSILKPRILVTREQPTKK----RNLLLVKAVDEDEGSPEDEGP---PVALAEKGEEE  95

Query  323  paaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNX  502
               L E D LK QLVD+FYGT+RGL+A+SETRAEVVELITQLEA+ P PAPTEALTLLN 
Sbjct  96   LKELAEVDRLKGQLVDTFYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNG  155

Query  503  KWVLAYTSF  529
            KW+LAYTSF
Sbjct  156  KWILAYTSF  164



>ref|XP_006396722.1| hypothetical protein EUTSA_v10028808mg [Eutrema salsugineum]
 gb|ESQ38175.1| hypothetical protein EUTSA_v10028808mg [Eutrema salsugineum]
Length=318

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +2

Query  203  GLANPNRKFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A     F VRA   DDEWG +  E  S         E    ++ ET+ LK+ LVDS Y
Sbjct  44   GIAVHRPDFKVRATDVDDEWGTDAAERGSNVSVAEKSAEEAIESVEETERLKRLLVDSLY  103

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            GT+RGLSASSETRAE+ E ITQLE+K P PAP EAL LLN KW+LAYTSF+
Sbjct  104  GTDRGLSASSETRAEISEFITQLESKNPNPAPNEALFLLNGKWILAYTSFV  154



>ref|XP_010686767.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=310

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  233  VRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            V+A S DDEWG+EK     +A   VA  E       E + LKKQLV+SFYGT+RGL ASS
Sbjct  48   VKASSLDDEWGQEKSTSYGSAAVAVAEEESTVEM-EEMNKLKKQLVNSFYGTDRGLKASS  106

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VE ITQLEAK PTPAPT+AL+LLN KW+LAYTSF
Sbjct  107  ETRAEIVEFITQLEAKNPTPAPTDALSLLNGKWILAYTSF  146



>ref|XP_003534708.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Glycine max]
Length=312

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 75/100 (75%), Gaps = 5/100 (5%)
 Frame = +2

Query  233  VRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            VRAV SDDEWG EK+E       G  V   E    TET+ LKK LVDSFYGT+ GL A+S
Sbjct  52   VRAVTSDDEWGPEKEE----EAYGGGVAVEEKPTETETEKLKKALVDSFYGTDLGLKATS  107

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK P PAPT+ALTLLN KW+LAYTSF
Sbjct  108  ETRAEIVELITQLEAKNPNPAPTDALTLLNGKWILAYTSF  147



>emb|CAA75657.1| Plastid-lipid-Associated Protein [Nicotiana tabacum]
Length=270

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +2

Query  248  DDEWGEEKKE-PLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAE  424
            +DEWG E ++   S     VA  E      +E ++LKKQLVDSFYGTNRGLSASSETRAE
Sbjct  11   EDEWGPEVEQIKPSGGGVSVAEEEPPKEEPSEIELLKKQLVDSFYGTNRGLSASSETRAE  70

Query  425  VVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +VELIT+LE+K PTPAPTEAL LLN KW+LAYTSF
Sbjct  71   IVELITKLESKNPTPAPTEALPLLNGKWILAYTSF  105



>ref|NP_192311.1| fibrillin [Arabidopsis thaliana]
 sp|O81439.1|PAP1_ARATH RecName: Full=Probable plastid-lipid-associated protein 1, chloroplastic; 
Short=AtPap1; AltName: Full=Fibrillin-1a; AltName: 
Full=Plastoglobulin 35; Short=AtPGL35; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28198.1| contains similarity to fibrillins [Arabidopsis thaliana]
 emb|CAB77870.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM53324.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM62561.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAN15467.1| putative fibrillin [Arabidopsis thaliana]
 gb|AEE82363.1| fibrillin [Arabidopsis thaliana]
Length=318

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = +2

Query  227  FVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSA  403
            F +RA   DDEWG++  E + A+ + V+V +    ++ ET+ LK+ L DS YGT+RGLS 
Sbjct  52   FKIRATDIDDEWGQDGVERVFASSSTVSVADKAIESVEETERLKRSLADSLYGTDRGLSV  111

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            SS+TRAE+ ELITQLE+K PTPAP EAL LLN KW+LAYTSF+
Sbjct  112  SSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFV  154



>ref|XP_003594155.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|ABD32657.1| PAP fibrillin [Medicago truncatula]
 gb|AES64406.1| plastid lipid-associated protein [Medicago truncatula]
Length=317

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 88/147 (60%), Gaps = 13/147 (9%)
 Frame = +2

Query  116  LIHPETLCI-SVNSTIFASKVAALRSFPNRGLANP-------NRKFVVRAVS-DDEWGEE  268
            L+H  TL + S+NST   S       F N+ +  P        R   V+A   DDEWG E
Sbjct  10   LLHTNTLPVTSLNSTPSISPSTITVGFLNKHVRKPIVLADGLRRVVYVQANRIDDEWGPE  69

Query  269  KKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQL  448
                ++ A         +     ET+ LKK LV SFYGT+RGL A+SETRAE+VELITQL
Sbjct  70   PSAGVAVAEVQATEKVSDG----ETEKLKKALVGSFYGTDRGLKATSETRAEIVELITQL  125

Query  449  EAKXPTPAPTEALTLLNXKWVLAYTSF  529
            EAK PTPA T+AL+LLN KW+LAYTSF
Sbjct  126  EAKNPTPASTDALSLLNGKWILAYTSF  152



>dbj|BAF95867.1| putative plastid lipid-associated protein [Vitis hybrid cultivar]
Length=238

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E   LKK LVDSFYGT+RGL A+SETRAE+VELITQLEAK PTPAPTEALTLLN KW+LA
Sbjct  10   EITSLKKALVDSFYGTDRGLKATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILA  69

Query  518  YTSF  529
            YTSF
Sbjct  70   YTSF  73



>ref|XP_010099142.1| Plastid-lipid-associated protein [Morus notabilis]
 gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis]
Length=324

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = +2

Query  233  VRAVSDDEWGEEKKEPL-----SaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGL  397
            VR  +DDEWG    EP+     SA        E +P    E   LKK LV+SFYGT+RGL
Sbjct  59   VRVANDDEWG---PEPVTSGEDSAVAVAEEKEEEKPVEAAEIARLKKALVESFYGTDRGL  115

Query  398  SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
             ASSETRAE+VELITQLEA+ PTPAPTEAL+LLN KW+LAYTSF
Sbjct  116  KASSETRAEIVELITQLEAQNPTPAPTEALSLLNGKWILAYTSF  159



>ref|XP_010433071.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=320

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  227  FVVRAVS-DDEWGEEKKEP-LSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLS  400
            F VRA   DD+WG++  E  ++++       +    ++ ET+ LK+ L DS YGT+RGLS
Sbjct  53   FKVRATDFDDKWGQDGVERVMASSSVAEKEADEAIESVEETEKLKRSLADSLYGTDRGLS  112

Query  401  ASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            ASS+TRAE+ ELITQLE+K PTPAPT+AL LLN KW+LAYTSF+
Sbjct  113  ASSDTRAEISELITQLESKNPTPAPTDALFLLNGKWILAYTSFV  156



>ref|XP_006288225.1| hypothetical protein CARUB_v10001463mg [Capsella rubella]
 gb|EOA21123.1| hypothetical protein CARUB_v10001463mg [Capsella rubella]
Length=322

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = +2

Query  203  GLANPNRKFVVRAVS-DDEWGEEKKEPL----SaapagvavvexepaaLTETDVLKKQLV  367
            G++     F VRA   DDEWG++  E +    S         +    ++ ET+ LK+ LV
Sbjct  44   GISVHRPDFKVRATDIDDEWGQDGVERVIASSSPVSVAEKEADDAIESVEETERLKRSLV  103

Query  368  DSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            DS YGT+RGL+ASS+TRAE+ ELITQLE+K PTPAP EAL LLN KW+LAYTSF+
Sbjct  104  DSLYGTDRGLNASSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFV  158



>ref|XP_010434068.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
Length=319

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = +2

Query  203  GLANPNRKFVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A     F VRA  ++DEWG E  E  SAA +           + ET+ LK+ L DSFY
Sbjct  48   GIAVSRGDFRVRATDAEDEWGTEAGERGSAALSVADEAIEA---VEETERLKRSLADSFY  104

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            G +RGL+ SSETRAE+ +LITQLE+K PTPAPTEAL LLN KW+LAYTSF+
Sbjct  105  GIDRGLNTSSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFV  155



>ref|XP_010057882.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Eucalyptus 
grandis]
 gb|KCW75228.1| hypothetical protein EUGRSUZ_E03981 [Eucalyptus grandis]
Length=336

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
             LKK+LVDSFYGT+RGL A+SETRAE+VELITQLEAK PTPAPTEALTLLN KW+LAYTS
Sbjct  111  ALKKELVDSFYGTDRGLRATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTS  170

Query  527  F  529
            F
Sbjct  171  F  171



>gb|EYU27736.1| hypothetical protein MIMGU_mgv1a010083mg [Erythranthe guttata]
Length=319

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  332  LTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWV  511
            LTE DVLKKQL+DS YGT RGL ASSETRAE++ELITQLE K PTPAPTEALTLLN KW+
Sbjct  88   LTEIDVLKKQLLDSLYGTTRGLFASSETRAEILELITQLECKNPTPAPTEALTLLNGKWI  147

Query  512  LAYTSFI  532
            L YTS +
Sbjct  148  LVYTSHV  154



>emb|CDX79139.1| BnaA01g12060D [Brassica napus]
Length=319

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 94/156 (60%), Gaps = 8/156 (5%)
 Frame = +2

Query  68   FHSIPLQTRRYDLSTILIHPETLCISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV-  244
            F+  P QTR    +    + + L    +S +  S +    SFP    A     F VR + 
Sbjct  7    FNQFPCQTRVQSSA----NSKPLSKPPSSLVPMSALTRRPSFPPGEFAVSRSDFRVRVID  62

Query  245  SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAE  424
            ++DE   E  E      + + + E    ++ ET+VLK+ LVDS YGT+RGLSASSETRAE
Sbjct  63   AEDELDPETSE---GGGSALLMAEEAIESVEETEVLKRSLVDSLYGTDRGLSASSETRAE  119

Query  425  VVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            + +LITQLE+K PTPAPT+AL LLN KW+LAYTSF+
Sbjct  120  IGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFV  155



>ref|XP_009357505.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Pyrus x bretschneideri]
Length=315

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E   LKK LVDSFYGT+RGLSA+SETRAE+VELITQLEAK PTPAPTEAL LLN KW+LA
Sbjct  88   EISRLKKALVDSFYGTDRGLSATSETRAEIVELITQLEAKNPTPAPTEALPLLNGKWILA  147

Query  518  YTSF  529
            YTSF
Sbjct  148  YTSF  151



>ref|XP_006284145.1| hypothetical protein CARUB_v10005278mg [Capsella rubella]
 gb|EOA17043.1| hypothetical protein CARUB_v10005278mg [Capsella rubella]
Length=317

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +2

Query  191  FPNRGLANPNRKFVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLV  367
            F   G+A     F VRA  +DDEWG E +    A  + ++V +    ++ ET+ LK+ L 
Sbjct  43   FSTGGIAVSRSDFRVRATDADDEWGTEPE----ARGSALSVADEAIESVEETERLKRSLA  98

Query  368  DSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            DS YG +RGL+ASSETRAE+ +LITQLE+K PTPAPT+AL LLN KW+LAYTSF+
Sbjct  99   DSLYGIDRGLNASSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFV  153



>gb|AGN30962.1| chromoplast-specific carotenoid-associated protein [Narcissus 
tazetta var. chinensis]
Length=316

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 91/144 (63%), Gaps = 19/144 (13%)
 Frame = +2

Query  137  CISVNSTIFASKVAALRSFPNRGLANP------------NRKFVVRAVSDD-EWGEEKKE  277
             + V+ST+ + +  +L + PN   ++P             + F+ RA +DD EWG+E+ +
Sbjct  14   TLPVHSTVKSHRNPSLPT-PNLNFSSPLPKTLTLTIKTQQKSFLARATTDDDEWGKERGD  72

Query  278  PLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAK  457
                  +G   V  E     E + LKK+L +  YGT+RGL ASSETRAE+VELITQLEAK
Sbjct  73   -----ESGGLAVAEEEQGGGEIEELKKRLKELLYGTDRGLKASSETRAEIVELITQLEAK  127

Query  458  XPTPAPTEALTLLNXKWVLAYTSF  529
             PTPAPTEALTLLN KW+LAYTSF
Sbjct  128  NPTPAPTEALTLLNGKWILAYTSF  151



>ref|XP_009114588.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Brassica rapa]
Length=318

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = +2

Query  224  KFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLS  400
            +F VRA   +DEWG +  E  S         E    ++ ET+ LK+ L DS YGT+RGLS
Sbjct  51   EFKVRATDVNDEWGPDASERGSNVSVAEKEAEEAIESVEETERLKRSLADSLYGTDRGLS  110

Query  401  ASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            ASSETRAE+ ELITQLE+K P PAP EAL LL+ KW+LAYTSF+
Sbjct  111  ASSETRAEISELITQLESKNPNPAPNEALFLLSGKWILAYTSFV  154



>sp|Q6K439.1|PAP2_ORYSJ RecName: Full=Probable plastid-lipid-associated protein 2, chloroplastic; 
AltName: Full=Fibrillin-like protein 2; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAD22310.1| putative chloroplast drought-induced stress protein, 34 kD [Oryza 
sativa Japonica Group]
 dbj|BAG94105.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = +2

Query  221  RKFVVRAVS---DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNR  391
            R+   RAV+   +DEWG+E       A A VA    +    +E   LK +L ++ YGT R
Sbjct  49   RRLTARAVAGDAEDEWGKEPAADQGGAAAAVAEAPADVPVTSEVAELKAKLKEALYGTER  108

Query  392  GLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            GL ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  109  GLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  154



>gb|EEC84129.1| hypothetical protein OsI_30469 [Oryza sativa Indica Group]
Length=319

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = +2

Query  221  RKFVVRAVS---DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNR  391
            R+   RAV+   +DEWG+E       A A VA    +    +E   LK +L ++ YGT R
Sbjct  49   RRLTARAVAGDAEDEWGKEPAADQGGAAAAVAEAPADVPVTSEVAELKAKLKEALYGTER  108

Query  392  GLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            GL ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  109  GLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  154



>ref|XP_004293330.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=322

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 88/153 (58%), Gaps = 6/153 (4%)
 Frame = +2

Query  86   QTRRYDLSTILIHPETLCISVNSTIFASKVAALRSFPNRGLANPNRKFVVRAVS-----D  250
            Q   +   T+ + P    ++   +I A    +L +     L+NP      R  +     D
Sbjct  6    QLNHFPCKTLSLTPPQPRLTSKPSILAPNSISLATH-KLKLSNPESPPAARPATRVRALD  64

Query  251  DEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVV  430
            D+   E  E  S   AG   V  +P    E   LKK LVDSFYGT+RGLSA+SETRAE+V
Sbjct  65   DDSAPENSEESSDVAAGAVAVAEKPDEPEEISKLKKALVDSFYGTDRGLSATSETRAEIV  124

Query  431  ELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ELITQLEA+ PTPAPT+AL LLN KW+LAYTSF
Sbjct  125  ELITQLEAQNPTPAPTDALPLLNGKWILAYTSF  157



>sp|Q94KU6.1|PAP2_BRACM RecName: Full=Plastid lipid-associated protein 2, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57565.1|AF290567_1 plastid-lipid associated protein PAP2 [Brassica rapa subsp. oleifera]
Length=319

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 4/116 (3%)
 Frame = +2

Query  188  SFPNRGLANPNRKFVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQL  364
            SFP    A     F VR + ++DE   E  E      + + + E    ++ ET+VLK+ L
Sbjct  43   SFPPGEFAVSRSDFRVRVIDAEDELDPETSE---GGGSALLMAEEAIESVEETEVLKRSL  99

Query  365  VDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            VDS YGT+RGLSASSETRAE+ +LITQLE+K PTPAPT+AL LLN KW+LAYTSF+
Sbjct  100  VDSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFV  155



>gb|KFK30956.1| hypothetical protein AALP_AA6G049300 [Arabis alpina]
Length=320

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = +2

Query  203  GLANPNRKFVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLT---ETDVLKKQLVD  370
            G+A     F VRA+ +DDEWG +  E      +     +    A+    ET+ LK+ LVD
Sbjct  43   GIAVHRPDFRVRAIDADDEWGSDAVESRGGGGSVSVAEKAAEEAIGSVEETERLKRLLVD  102

Query  371  SFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            S YGT+RGL+ASSETR E+ ELITQLE+  PTPAP EAL LLN KW+LAYTSF+
Sbjct  103  SLYGTDRGLTASSETRGEIGELITQLESMNPTPAPNEALFLLNGKWILAYTSFV  156



>emb|CDX82925.1| BnaC01g13750D [Brassica napus]
Length=317

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 76/103 (74%), Gaps = 5/103 (5%)
 Frame = +2

Query  227  FVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSA  403
            F VR + ++DE+  E+ E  SA       +E     + ET+VLK+ LVDS YGT+RGLSA
Sbjct  55   FRVRVIDAEDEFDSERSEGGSALLMAEEAIES----VEETEVLKRSLVDSLYGTDRGLSA  110

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            SSETRAE+ +LITQLE+K PTPAPT+AL LLN KW+LAYTSF+
Sbjct  111  SSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFV  153



>emb|CDY16684.1| BnaA09g20620D [Brassica napus]
Length=318

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +2

Query  227  FVVRAVSD--DEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLS  400
            F VR VSD  DEWG +  E  S         E    ++ ET+ LK+ L DS YGT+RGLS
Sbjct  52   FKVR-VSDVNDEWGPDSSERGSNVSVAEKEAEEAIESVEETERLKRSLADSLYGTDRGLS  110

Query  401  ASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            ASSETRAE+ ELITQLE+K P PAP EAL LL+ KW+LAYTSF+
Sbjct  111  ASSETRAEISELITQLESKNPNPAPNEALFLLSGKWILAYTSFV  154



>sp|B4F6G1.1|CHRC2_ONCHC RecName: Full=Chromoplast-specific carotenoid-associated protein 
C2, chromoplast; Short=OgCHRC2; AltName: Full=Chromoplast 
specific carotenoid associated protein C2; AltName: Full=Fibrillin-like 
protein 2; Flags: Precursor [Oncidium hybrid cultivar]
 gb|AAY24688.1| fibrillin-like protein [Oncidium hybrid cultivar]
Length=319

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = +2

Query  185  RSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQL  364
            R+FP+         F V+A+++DEW  EKK       +     + +  A      LKK+L
Sbjct  49   RTFPS---------FRVQAIAEDEWESEKKTLKGVVGSVALAEDEKTGADLVVSDLKKKL  99

Query  365  VDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            +D  +GT+RGL A+SETRAEV ELITQLEAK P PAPTEAL+LLN KW+LAYTSF+
Sbjct  100  IDQLFGTDRGLKATSETRAEVNELITQLEAKNPNPAPTEALSLLNGKWILAYTSFV  155



>gb|EEE69226.1| hypothetical protein OsJ_28458 [Oryza sativa Japonica Group]
Length=319

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  185  RSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSaapagvavvexepaaLTETDVLK  355
            R  P RG  +       RAV+   +DEWG+E       A A VA    +    +E   LK
Sbjct  39   RGSPTRGPRHGG--LTARAVAGDAEDEWGKEPAADQGGAAAAVAEAPADVPVTSEVAELK  96

Query  356  KQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
             +L ++ YGT RGL ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  97   AKLKEALYGTERGLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  154



>gb|AAL67120.1| AT4g22240/T10I14_70 [Arabidopsis thaliana]
Length=310

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = +2

Query  203  GLA-NPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A +P R F VRA    E G             +   E     + ET+ LK+ LVDS Y
Sbjct  47   GIAVSPRRVFKVRATDTGEIGS-----------ALLAAEEAIEDVEETERLKRSLVDSLY  95

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            GT+RGLSASSETRAE+ +LITQLE+K PTPAPTEAL LLN KW+LAYTSF+
Sbjct  96   GTDRGLSASSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFV  146



>gb|KHN40849.1| Plastid-lipid-associated protein, chloroplastic [Glycine soja]
Length=314

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +2

Query  233  VRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            VRAV SDDEWG EK+E   A   GVAV E      TET+ LKK LVDSFYGT+ GL A+S
Sbjct  52   VRAVTSDDEWGPEKEE--EAYGGGVAVEEKPTETETETEKLKKALVDSFYGTDLGLKATS  109

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ETRAE+VELITQLEAK P PAPT+ALTLLN KW+LAYTSF
Sbjct  110  ETRAEIVELITQLEAKNPNPAPTDALTLLNGKWILAYTSF  149



>ref|NP_193955.1| plastid-lipid associated protein PAP / fibrillin family protein 
[Arabidopsis thaliana]
 sp|O49629.1|PAP2_ARATH RecName: Full=Probable plastid-lipid-associated protein 2, chloroplastic; 
Short=AtPap2; AltName: Full=Fibrillin-1b; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA16774.1| fibrillin precursor-like protein [Arabidopsis thaliana]
 emb|CAB79179.1| fibrillin precursor-like protein [Arabidopsis thaliana]
 gb|AAW28556.1| At4g22240 [Arabidopsis thaliana]
 gb|AAW38981.1| At4g22240 [Arabidopsis thaliana]
 gb|AEE84581.1| plastid-lipid associated protein PAP / fibrillin family protein 
[Arabidopsis thaliana]
Length=310

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = +2

Query  203  GLA-NPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A +P R F VRA    E G             +   E     + ET+ LK+ LVDS Y
Sbjct  47   GIAVSPRRVFKVRATDTGEIGS-----------ALLAAEEAIEDVEETERLKRSLVDSLY  95

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            GT+RGLSASSETRAE+ +LITQLE+K PTPAPTEAL LLN KW+LAYTSF+
Sbjct  96   GTDRGLSASSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFV  146



>ref|XP_009135738.1| PREDICTED: plastid lipid-associated protein 2, chloroplastic 
[Brassica rapa]
Length=319

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            ET+VLK+ LVDS YGT+RGLSASSETRAE+ +LITQLE+K PTPAPT+AL LLN KW+LA
Sbjct  91   ETEVLKRSLVDSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILA  150

Query  518  YTSFI  532
            YTSF+
Sbjct  151  YTSFV  155



>gb|AAK57562.1| plastid-lipid associated protein PAP2 [Brassica rapa subsp. oleifera]
Length=319

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            ET+VLK+ LVDS YGT+RGLSASSETRAE+ +LITQLE+K PTPAPT+AL LLN KW+LA
Sbjct  91   ETEVLKRSLVDSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILA  150

Query  518  YTSFI  532
            YTSF+
Sbjct  151  YTSFV  155



>ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-associated protein 
C1, chromoplast-like [Musa acuminata subsp. malaccensis]
Length=320

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +2

Query  242  VSDDEWGEEKK-EPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETR  418
            V DDEWG+E   EP S        VE     L+E   LK++L+D   GT+RGL ASSETR
Sbjct  63   VDDDEWGKEGNGEPESGVAVVEPPVEE----LSEAGELKRKLMDLLSGTDRGLKASSETR  118

Query  419  AEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            AE+VELITQLEAK PTPAPT+AL LLN KW+LAYTSF
Sbjct  119  AEIVELITQLEAKNPTPAPTDALPLLNGKWILAYTSF  155



>ref|XP_002983947.1| hypothetical protein SELMODRAFT_156313 [Selaginella moellendorffii]
 gb|EFJ14959.1| hypothetical protein SELMODRAFT_156313 [Selaginella moellendorffii]
Length=326

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = +2

Query  245  SDDEWGE---EKKEPLSaapagvavvexepaaL-TETDVLKKQLVDSFYGTNRGLSASSE  412
             +DEWGE   EKK   S A  GV     +      +T+ LKK L+DS YGT RGL ASSE
Sbjct  61   GNDEWGEGAAEKKGAASKAGNGVGTAVADEKEKDGDTEGLKKALLDSLYGTERGLKASSE  120

Query  413  TRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            TRAEV ELITQLEAK PTPAPTEAL +LN KW+LAYTSF
Sbjct  121  TRAEVNELITQLEAKNPTPAPTEALAVLNGKWILAYTSF  159



>gb|ABK26110.1| unknown [Picea sitchensis]
 gb|ABR17902.1| unknown [Picea sitchensis]
Length=331

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK+ LVDSFYGT+RGL ASSETRAE+VELITQLEAK PTPAPTEAL LLN KW+L
Sbjct  101  SEMKDLKRALVDSFYGTDRGLRASSETRAEIVELITQLEAKNPTPAPTEALNLLNGKWIL  160

Query  515  AYTSF  529
             YTSF
Sbjct  161  VYTSF  165



>gb|ABR17743.1| unknown [Picea sitchensis]
 gb|ADE77567.1| unknown [Picea sitchensis]
Length=331

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK+ LVDSFYGT+RGL ASSETRAE+VELITQLEAK PTPAPTEAL LLN KW+L
Sbjct  101  SEMKDLKRALVDSFYGTDRGLRASSETRAEIVELITQLEAKNPTPAPTEALNLLNGKWIL  160

Query  515  AYTSF  529
             YTSF
Sbjct  161  VYTSF  165



>ref|XP_004956481.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic-like 
[Setaria italica]
Length=318

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +2

Query  245  SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAE  424
            S+DEWG E +    +A  G AV E      +E   LK QL ++ YGT RGL ASSETRAE
Sbjct  61   SEDEWGPEPEG--GSAVTGTAVAEASDPEASEVAELKAQLKEALYGTERGLRASSETRAE  118

Query  425  VVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            VVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  119  VVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  153



>ref|XP_002872677.1| plastid lipid-associated protein 1, chloroplast precursor [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48936.1| plastid lipid-associated protein 1, chloroplast precursor [Arabidopsis 
lyrata subsp. lyrata]
Length=322

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +2

Query  227  FVVRAVS-DDEWGEEKKE----PLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNR  391
            F +RA   +DEWG+E  E      S       V +    +  ET+ LK+ L DS YGT+R
Sbjct  52   FKIRATDINDEWGQEGVERVLSSSSPVSVAEKVADGAIESAEETERLKRSLADSLYGTDR  111

Query  392  GLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            GLSASS+TRAE+ ELITQLE+K PTPAP EAL LLN KW+LAYTSF+
Sbjct  112  GLSASSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFV  158



>ref|XP_010529464.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Tarenaya hassleriana]
Length=323

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +2

Query  203  GLANPNRKFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A     F VR+   +DEWG E  E  S        +E    A+ ET+ LK+ L +S Y
Sbjct  47   GIAVSRPDFRVRSSEVEDEWGSEPSENRSPVSVVEREIEEAIEAVEETERLKRALAESLY  106

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            GT+RGL ASSETRAE+ ELITQLEAK PTPAPT+AL LLN KW+LAYTSF+
Sbjct  107  GTDRGLRASSETRAEIGELITQLEAKNPTPAPTDALFLLNGKWILAYTSFV  157



>ref|XP_002960725.1| hypothetical protein SELMODRAFT_163532 [Selaginella moellendorffii]
 gb|EFJ38264.1| hypothetical protein SELMODRAFT_163532 [Selaginella moellendorffii]
Length=324

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = +2

Query  245  SDDEWGEEKKEPLSaapagvavvexepaaLTETDV--LKKQLVDSFYGTNRGLSASSETR  418
             +DEWGE   E  ++                + D   LKK L+DS YGT RGL ASSETR
Sbjct  61   GNDEWGEGAAEKKASKAGNGVGTAVSDEKEKDGDTEGLKKALLDSLYGTERGLKASSETR  120

Query  419  AEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            AEV ELITQLEAK PTPAPTEAL +LN KW+LAYTSF
Sbjct  121  AEVNELITQLEAKNPTPAPTEALAVLNGKWILAYTSF  157



>ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=305

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 71/102 (70%), Gaps = 12/102 (12%)
 Frame = +2

Query  227  FVVRA-VSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSA  403
            F  RA V DDE GEE    ++  PA           ++E   LKK+L+D  YGT+RGL A
Sbjct  52   FRTRAMVDDDELGEEGGVAVAQPPA-----------VSEAGELKKKLIDLLYGTDRGLKA  100

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            SSETRAE++E+ITQLEAK PTPAPT+AL LLN KW+LAYTSF
Sbjct  101  SSETRAEILEVITQLEAKNPTPAPTDALALLNGKWILAYTSF  142



>sp|B2LU34.1|CHRC1_ONCHC RecName: Full=Chromoplast-specific carotenoid-associated protein 
C1, chromoplast; Short=OgCHRC1; AltName: Full=Fibrillin-like 
protein 1; AltName: Full=Plastid lipid-associated protein 
CHRC1; Flags: Precursor [Oncidium hybrid cultivar]
 gb|ACC59805.1| chromoplast specific carotenoid associated protein [Oncidium 
hybrid cultivar]
Length=319

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +2

Query  227  FVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSAS  406
            F V+A+++DEW  EKK       +     +    A      LKK+L+D  +GT+RGL A+
Sbjct  54   FRVQAIAEDEWESEKKALKGVVGSVALAEDETTGADLVVSDLKKKLIDQLFGTDRGLKAT  113

Query  407  SETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            SETRAEV ELITQLEAK P PAPTEAL+LLN +W+LAYTSF
Sbjct  114  SETRAEVNELITQLEAKNPNPAPTEALSLLNGRWILAYTSF  154



>ref|XP_006413678.1| hypothetical protein EUTSA_v10025758mg [Eutrema salsugineum]
 dbj|BAJ33603.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55131.1| hypothetical protein EUTSA_v10025758mg [Eutrema salsugineum]
Length=317

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (71%), Gaps = 5/103 (5%)
 Frame = +2

Query  227  FVVRAV-SDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSA  403
            F VR   ++DEWG E  E  SA       +E       ET+VLK+ L DS YGT+RGLSA
Sbjct  55   FRVRVTDAEDEWGPETGERGSALSVAEEAIEAV----EETEVLKRTLADSLYGTDRGLSA  110

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            SSETRAE+ +LITQLE+K PTPAPTEAL LLN KW+LAYTSF+
Sbjct  111  SSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFV  153



>gb|EYU27735.1| hypothetical protein MIMGU_mgv1a010083mg [Erythranthe guttata]
Length=323

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +2

Query  332  LTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWV  511
            LTE DVLKKQL+DS YGT RGL ASSETRAE++ELITQLE K PTPAPTEALTLLN KW+
Sbjct  88   LTEIDVLKKQLLDSLYGTTRGLFASSETRAEILELITQLECKNPTPAPTEALTLLNGKWI  147

Query  512  L----AYTSFI  532
            L    +YTS +
Sbjct  148  LVENCSYTSHV  158



>ref|XP_006849074.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda]
 gb|ERN10655.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda]
Length=322

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            TE   LKK+LV++FYGT RGL ASSETRAE+VELITQLEA  PTPAPTEAL LLN KW+L
Sbjct  91   TEVQKLKKELVEAFYGTERGLKASSETRAEIVELITQLEALNPTPAPTEALPLLNGKWIL  150

Query  515  AYTSF  529
            AYT+F
Sbjct  151  AYTTF  155



>gb|AAO72593.1| fibrillin-like protein [Oryza sativa Japonica Group]
Length=319

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 72/106 (68%), Gaps = 3/106 (3%)
 Frame = +2

Query  221  RKFVVRAVS---DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNR  391
            R+   RAV+   +DE G+E       A A VA    +    +E   LK +L ++ YGT R
Sbjct  49   RRLTARAVAGDAEDEXGKEPAADQGGAAAAVAEAPADVPVTSEVAELKAKLKEALYGTER  108

Query  392  GLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            GL ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  109  GLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  154



>ref|XP_002447942.1| hypothetical protein SORBIDRAFT_06g018550 [Sorghum bicolor]
 gb|EES12270.1| hypothetical protein SORBIDRAFT_06g018550 [Sorghum bicolor]
Length=330

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            DDEWG E +   +   A       E     E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  72   DDEWGPEPEGGSAVTGATAVAEAPEAPEAREVAELKAQLKDALYGTERGLRASSESRAKV  131

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +ELITQLE + PTPAPTEALTLLN KW+LAYTSF
Sbjct  132  LELITQLETRNPTPAPTEALTLLNGKWILAYTSF  165



>gb|AAM67287.1| fibrillin precursor-like protein [Arabidopsis thaliana]
Length=310

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = +2

Query  203  GLA-NPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A +P R F VRA    E G             +   E     + ET+ LK+ LVDS Y
Sbjct  47   GIAVSPRRVFKVRATDTGEIGS-----------ALLAAEEAIEDVEETERLKRSLVDSLY  95

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            GT+RGLSASSETRAE+ +LITQLE+K PTPAPTEAL LLN KW+LA TSF+
Sbjct  96   GTDRGLSASSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILACTSFV  146



>gb|ACJ84978.1| unknown [Medicago truncatula]
Length=316

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 20/150 (13%)
 Frame = +2

Query  116  LIHPETLCI-SVNST--IFASKVA-ALRSFPNRG---LANPNRKFV-VRAVS----DDEW  259
            L+H  TL + S+NST  I  S +   L+S   R    +A+  R+ V VRA +    DDEW
Sbjct  10   LLHINTLPVTSLNSTPSITPSTITFGLQSKNARKSILVADGLRRVVYVRATANDDDDDEW  69

Query  260  GEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELI  439
            G E    ++ A   V          +ET+ LKK LV SFYGT RGL A+SETRAE+ ELI
Sbjct  70   GSEPSADVAVAEVIVPE--------SETEKLKKDLVGSFYGTARGLKAASETRAEIFELI  121

Query  440  TQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +QLEAK PTPA T+AL+LL+ KW+LAYTS+
Sbjct  122  SQLEAKNPTPASTDALSLLDGKWILAYTSY  151



>gb|AFK48303.1| unknown [Medicago truncatula]
Length=316

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 20/150 (13%)
 Frame = +2

Query  116  LIHPETLCI-SVNST--IFASKVA-ALRSFPNRG---LANPNRKFV-VRAVS----DDEW  259
            L+H  TL + S+NST  I  S +   L+S   R    +A+  R+ V VRA +    DDEW
Sbjct  10   LLHINTLPVTSLNSTPSITPSTITFGLQSKNARKSILVADGLRRVVYVRATANDDDDDEW  69

Query  260  GEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELI  439
            G E    ++ A   V          +ET+ LKK LV SFYGT RGL A+SETRAE+ ELI
Sbjct  70   GSEPSADVAVAEVIVPE--------SETEKLKKDLVGSFYGTARGLKAASETRAEIFELI  121

Query  440  TQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +QLEAK PTPA T+AL+LL+ KW+LAYTS+
Sbjct  122  SQLEAKNPTPASTDALSLLDGKWILAYTSY  151



>gb|ACJ85346.1| unknown [Medicago truncatula]
Length=315

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 94/149 (63%), Gaps = 19/149 (13%)
 Frame = +2

Query  116  LIHPETLCI-SVNST--IFASKVA-ALRSFPNRG---LANPNRKFV-VRAVS---DDEWG  262
            L+H  TL + S+NST  I  S +   L+S   R    +A+  R+ V VRA +   DDEWG
Sbjct  10   LLHINTLPVTSLNSTPSITPSTITFGLQSKNARKSILVADGLRRVVYVRATANDDDDEWG  69

Query  263  EEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELIT  442
             E    ++ A   V          +ET+ LKK LV SFYGT RGL A+SETRAE+ ELI+
Sbjct  70   SEPSADVAVAEVIVPE--------SETEKLKKDLVGSFYGTARGLKAASETRAEIFELIS  121

Query  443  QLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            QLEAK PTPA T+AL+LL+ KW+LAYTS+
Sbjct  122  QLEAKNPTPASTDALSLLDGKWILAYTSY  150



>ref|XP_003594154.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|ABD32658.1| PAP fibrillin [Medicago truncatula]
 gb|AES64405.1| plastid lipid-associated protein [Medicago truncatula]
Length=316

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 20/150 (13%)
 Frame = +2

Query  116  LIHPETLCI-SVNST--IFASKVA-ALRSFPNRG---LANPNRKFV-VRAVS----DDEW  259
            L+H  TL + S+NST  I  S +   L+S   R    +A+  R+ V VRA +    DDEW
Sbjct  10   LLHINTLPVTSLNSTPSITPSTITFGLQSKNARKSILVADGLRRVVYVRATANDDDDDEW  69

Query  260  GEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELI  439
            G E    ++ A   V          +ET+ LKK LV SFYGT RGL A+SETRAE+ ELI
Sbjct  70   GSEPSADVAVAEVIVPE--------SETEKLKKDLVGSFYGTARGLKAASETRAEIFELI  121

Query  440  TQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +QLEAK PTPA T+AL+LL+ KW+LAYTS+
Sbjct  122  SQLEAKNPTPASTDALSLLDGKWILAYTSY  151



>ref|XP_006661039.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=239

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E   LK +L D+ YGT RGL ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LA
Sbjct  11   EVAELKAKLKDALYGTERGLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILA  70

Query  518  YTSF  529
            YTSF
Sbjct  71   YTSF  74



>ref|XP_002867781.1| hypothetical protein ARALYDRAFT_914391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44040.1| hypothetical protein ARALYDRAFT_914391 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  TDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAY  520
            T+ LK+ L DS YGT+RGLSASSETRAE+ +LITQLE+K PTPAPTEAL LLN KW+LAY
Sbjct  83   TERLKRSLADSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAY  142

Query  521  TSFI  532
            TSF+
Sbjct  143  TSFV  146



>gb|KJB34758.1| hypothetical protein B456_006G082400 [Gossypium raimondii]
Length=338

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E + LKK LVDSFYGT+RG  ASSETRAE+VELIT LEAK PTPAPT++L LLN KW+LA
Sbjct  109  EIESLKKALVDSFYGTDRGWKASSETRAEIVELITLLEAKNPTPAPTDSLPLLNGKWILA  168

Query  518  YTSF  529
            YTSF
Sbjct  169  YTSF  172



>ref|XP_010943242.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Elaeis guineensis]
Length=351

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK++L+D   GT+RGL ASSETRAE+VELITQLEAK PTPAPTEALTLLN KW+L
Sbjct  122  SEVAELKRKLMDLLRGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWIL  181

Query  515  AYTSF  529
            AYTSF
Sbjct  182  AYTSF  186



>ref|XP_003575588.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Brachypodium distachyon]
Length=324

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            DDEWG E  E  S+A A            +E   LK++L  + YGT RGL ASSETRAEV
Sbjct  69   DDEWGNEPGERGSSAAAVAEDAPPAA---SELAALKEKLRAALYGTERGLRASSETRAEV  125

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            VE+++QLEA+ PTPAPTEAL LLN KW+LAYTSF
Sbjct  126  VEILSQLEARNPTPAPTEALPLLNGKWILAYTSF  159



>gb|ACN41157.1| unknown [Picea sitchensis]
Length=161

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK+ LVDSFYGT+RGL ASSETRAE+VELITQLEAK PTPAPTEAL LLN KW+L
Sbjct  101  SEMKDLKRALVDSFYGTDRGLRASSETRAEIVELITQLEAKNPTPAPTEALNLLNGKWIL  160



>ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic, 
partial [Phoenix dactylifera]
Length=281

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK++L++  YGT+RGL+ASSETRAE++ELITQLE+K PTPAPTEALTLLN KW+L
Sbjct  102  SEIGELKRKLMELLYGTDRGLNASSETRAEILELITQLESKNPTPAPTEALTLLNGKWIL  161

Query  515  AYTSF  529
            AYTSF
Sbjct  162  AYTSF  166



>ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Phoenix dactylifera]
Length=256

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK++L+D   GT+RGL ASSETRAE+VELITQLEAK PTPAPTEALTLLN KW+L
Sbjct  31   SEVGELKRKLMDLLRGTDRGLEASSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWIL  90

Query  515  AYTSF  529
             YTSF
Sbjct  91   TYTSF  95



>emb|CDX94540.1| BnaC09g22960D [Brassica napus]
Length=149

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +2

Query  224  KFVVRAVSD--DEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGL  397
            +F VR VSD  DEWG +  E  S         E    ++ ET+ LK+ L DS YGT+RGL
Sbjct  51   EFKVR-VSDVNDEWGPDSSERGSNVSVAEKEAEEAIESVEETERLKRSLADSLYGTDRGL  109

Query  398  SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            SASSETRAE+ ELITQLE+K P PAP EAL LL+ KW+LA
Sbjct  110  SASSETRAEISELITQLESKNPNPAPNEALFLLSGKWILA  149



>ref|XP_001766233.1| predicted protein [Physcomitrella patens]
 gb|EDQ68865.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+QL+D+ YGT RGL ASS+TRAEV+ELITQLEAK PT APT ALTLLN KWVLAYTSF
Sbjct  95   LKQQLIDTLYGTERGLRASSDTRAEVIELITQLEAKNPTEAPTAALTLLNGKWVLAYTSF  154



>gb|KHG06297.1| Plastid-lipid-associated, chloroplastic [Gossypium arboreum]
Length=336

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LKK LVDSFYGT+RG  ASSETRAE+VELIT LEAK PTPAPT++L LLN KW+LAYTSF
Sbjct  111  LKKALVDSFYGTDRGWKASSETRAEIVELITLLEAKNPTPAPTDSLPLLNGKWILAYTSF  170



>ref|XP_010448920.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
 ref|XP_010448921.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
Length=310

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            ET+ LK+ L DSFYG +RGL+ SSETRAE+ +LITQLE+K PTPAPT+AL LLN KW+LA
Sbjct  82   ETERLKRSLADSFYGIDRGLNTSSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILA  141

Query  518  YTSFI  532
            YTSF+
Sbjct  142  YTSFV  146



>gb|ACG36654.1| plastid-lipid-associated protein 2 [Zea mays]
Length=262

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            +DEWG E +       A       E     E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  64   EDEWGPEPE----GGSAVTGAAVAEAPEAREVAELKAQLKDALYGTERGLRASSESRAKV  119

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +ELITQLE + PTPAPTEALTLLN KW+LAYTSF
Sbjct  120  LELITQLETRNPTPAPTEALTLLNGKWILAYTSF  153



>ref|XP_010538742.1| PREDICTED: plastid lipid-associated protein 2, chloroplastic 
[Tarenaya hassleriana]
Length=323

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = +2

Query  227  FVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSA  403
            F VRA    DE  +E  E  S+     +        + E + LK+ LVDS  GT+RGLSA
Sbjct  55   FRVRASEVKDERDDEPAEEGSSVSVAESAAAKTVEVVDEIEQLKRALVDSLNGTDRGLSA  114

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            SS+ RAE+ +LITQLEAK PTPAPT+AL LLN KW+LAYTSF
Sbjct  115  SSDKRAEIGDLITQLEAKNPTPAPTDALFLLNGKWILAYTSF  156



>ref|NP_001150448.1| LOC100284078 [Zea mays]
 gb|ACF84791.1| unknown [Zea mays]
 gb|ACG39141.1| plastid-lipid-associated protein 2 [Zea mays]
 tpg|DAA37512.1| TPA: plastid-lipid-associated protein 2 [Zea mays]
Length=318

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            +DEWG E +       A       E     E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  64   EDEWGPEPE----GGSAVTGAAVAEAPEAREVAELKAQLKDALYGTERGLRASSESRAKV  119

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +ELITQLE + PTPAPTEALTLLN KW+LAYTSF
Sbjct  120  LELITQLETRNPTPAPTEALTLLNGKWILAYTSF  153



>gb|AFW58455.1| hypothetical protein ZEAMMB73_538731 [Zea mays]
Length=230

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E   LK QL D+ YGT RGL ASSE+RA+V+ELITQLE + PTPAPTEALTLLN KW+LA
Sbjct  86   EVAELKAQLKDALYGTERGLRASSESRAKVLELITQLETRNPTPAPTEALTLLNGKWILA  145

Query  518  YTSF  529
            YTSF
Sbjct  146  YTSF  149



>ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Elaeis guineensis]
Length=328

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK++L+D  YGT+RGL ASSETRAE+VE+I QLE + PTPAPTEALTLLN KW+LAYTSF
Sbjct  104  LKRKLMDLLYGTDRGLQASSETRAEIVEVINQLEVRNPTPAPTEALTLLNGKWILAYTSF  163



>gb|AFW58454.1| plastid-lipid-associated protein 2 [Zea mays]
Length=314

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E   LK QL D+ YGT RGL ASSE+RA+V+ELITQLE + PTPAPTEALTLLN KW+LA
Sbjct  86   EVAELKAQLKDALYGTERGLRASSESRAKVLELITQLETRNPTPAPTEALTLLNGKWILA  145

Query  518  YTSF  529
            YTSF
Sbjct  146  YTSF  149



>ref|NP_001150453.1| LOC100284083 [Zea mays]
 gb|ACG39157.1| plastid-lipid-associated protein 2 [Zea mays]
Length=314

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E   LK QL D+ YGT RGL ASSE+RA+V+ELITQLE + PTPAPTEALTLLN KW+LA
Sbjct  86   EVAELKAQLKDALYGTERGLRASSESRAKVLELITQLETRNPTPAPTEALTLLNGKWILA  145

Query  518  YTSF  529
            YTSF
Sbjct  146  YTSF  149



>gb|AAD03693.1| fibrillin [Brassica napus]
Length=237

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            ET+ LK+ L  S YGT+RGLSASSETRAE+ ELITQLE+K P PAP EAL LLN KW+L 
Sbjct  9    ETERLKRVLAGSLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILV  68

Query  518  YTSFI  532
            YTSF+
Sbjct  69   YTSFV  73



>ref|XP_003592199.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|AES62450.1| plastid fibrillin [Medicago truncatula]
Length=198

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 8/101 (8%)
 Frame = +2

Query  227  FVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSAS  406
            +V    +DDEWG E    ++ A   V           ET+ LKK LV  FYGT+ G  A+
Sbjct  3    YVQENANDDEWGSEPSADVAVAEVIVTD--------IETEKLKKDLVGLFYGTDHGSKAA  54

Query  407  SETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            SETRAE+ ELI+QLEAK PTPA T+AL+LL+ KW+LAYTS+
Sbjct  55   SETRAEIFELISQLEAKFPTPASTDALSLLDGKWILAYTSY  95



>emb|CDX90850.1| BnaA03g25300D [Brassica napus]
Length=316

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = +2

Query  197  NRGLANPNRKFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDV-LKKQLVD  370
            +R LA     F VRA   +DEWG + K       +    V  E     E    LK+ L  
Sbjct  39   SRRLAVHRHDFKVRASDVNDEWGPDSKGRGGLNSSVAEKVAEEAIESAEETERLKRVLAG  98

Query  371  SFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            S YGT+RGLSASSETRAE+ ELITQLE+K P PAP EAL LLN KW+L YTSF+
Sbjct  99   SLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFV  152



>emb|CDY21291.1| BnaC03g29750D [Brassica napus]
Length=316

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = +2

Query  197  NRGLANPNRKFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTETDV-LKKQLVD  370
            NR +A     F +RA   +DEWG +         +    V  E     E    LK+ L  
Sbjct  39   NRRIAVHRHDFKIRASDVNDEWGPDSMGRGRLNSSVAEKVAEEAIESAEETERLKRVLAG  98

Query  371  SFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            S YGT+RGLSASSETRAE+ ELITQLE+K P PAP EAL LLN KW+L YTSF+
Sbjct  99   SLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFV  152



>ref|XP_009134286.1| PREDICTED: plastid lipid-associated protein 1, chloroplastic 
[Brassica rapa]
 sp|Q94FZ9.1|PAP1_BRACM RecName: Full=Plastid lipid-associated protein 1, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57564.1| plastid-lipid associated protein PAP1 [Brassica rapa subsp. oleifera]
Length=327

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +2

Query  197  NRGLANPNRKFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTE-----------  340
            NR +A     F VRA   +DEWG + K                 +++ E           
Sbjct  39   NRRIAVHRHDFKVRASDVNDEWGPDSKGRGGDVDDEWGPEIGLNSSVAEKVAEEAIESAE  98

Query  341  -TDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
             T+ LK+ L  S YGT+RGLSASSETRAE+ ELITQLE+K P PAP EAL LLN KW+L 
Sbjct  99   ETERLKRVLAGSLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILV  158

Query  518  YTSFI  532
            YTSF+
Sbjct  159  YTSFV  163



>gb|AAK57561.1| plastid-lipid associated protein PAP1 [Brassica rapa subsp. oleifera]
Length=327

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +2

Query  197  NRGLANPNRKFVVRAVS-DDEWGEEKKEPLSaapagvavvexepaaLTE-----------  340
            NR +A     F VRA   +DEWG + K                 +++ E           
Sbjct  39   NRRIAVHRHDFKVRASDVNDEWGPDSKGRGGDVDDEWGPEIGLNSSVAEKVAEEAIESAE  98

Query  341  -TDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
             T+ LK+ L  S YGT+RGLSASSETRAE+ ELITQLE+K P PAP EAL LLN KW+L 
Sbjct  99   ETERLKRVLAGSLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILV  158

Query  518  YTSFI  532
            YTSF+
Sbjct  159  YTSFV  163



>ref|XP_010270045.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=349

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            ++ D+LKK L DSF GT+RGL ASSE RAE+ E+I+QLEA  PTPAPTEA TLLN KW++
Sbjct  100  SDIDMLKKLLFDSFIGTDRGLRASSEARAEIDEVISQLEALNPTPAPTEAFTLLNGKWIV  159

Query  515  AYTSF  529
            AYTS 
Sbjct  160  AYTSL  164



>tpg|DAA37511.1| TPA: hypothetical protein ZEAMMB73_707606 [Zea mays]
Length=200

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            +DEWG E +       A       E     E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  64   EDEWGPEPE----GGSAVTGAAVAEAPEAREVAELKAQLKDALYGTERGLRASSESRAKV  119

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            +ELITQLE + PTPAPTEALTLLN KW+LA
Sbjct  120  LELITQLETRNPTPAPTEALTLLNGKWILA  149



>ref|XP_009398685.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=312

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LKK+L+D   GT+ GL  SSETRAE+VELI Q+EAK PTPAPT+ALTLL+ KW+L
Sbjct  87   SEVSDLKKKLMDLVSGTDWGLKTSSETRAEIVELIGQIEAKNPTPAPTDALTLLDGKWIL  146

Query  515  AYTSF  529
            AYTSF
Sbjct  147  AYTSF  151



>ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Phoenix dactylifera]
Length=190

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            +E   LK++L+D  YGT+RGL+ASSETRAE++ELITQLE+K PTPAP EALTLLN KW L
Sbjct  41   SEIGELKRKLMDLLYGTDRGLNASSETRAEILELITQLESKNPTPAPIEALTLLNGKWNL  100

Query  515  AYTS  526
            A ++
Sbjct  101  AKST  104



>gb|ABR17395.1| unknown [Picea sitchensis]
Length=436

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD FYGT  GL ASS+TRAE+ ELI+QLEA+ PTP PTEA +LL  KWVL YTSF
Sbjct  212  LKQCLVDCFYGTEYGLRASSQTRAEIGELISQLEAQNPTPVPTEAPSLLQGKWVLVYTSF  271



>ref|XP_006854055.1| hypothetical protein AMTR_s00048p00085290 [Amborella trichopoda]
 gb|ERN15522.1| hypothetical protein AMTR_s00048p00085290 [Amborella trichopoda]
Length=479

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E + LK+ LVDSFYGT  GL A+SETRAE+VEL+ QLEA  PT APTE+L+LL+  WVL 
Sbjct  252  EIEGLKRCLVDSFYGTELGLRATSETRAEIVELVNQLEALNPTSAPTESLSLLDGNWVLR  311

Query  518  YTSF  529
            YT+F
Sbjct  312  YTAF  315



>emb|CBI33829.3| unnamed protein product [Vitis vinifera]
Length=273

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            +DEWG +     +   +G  +     A + E   LK+ LVD+ YGTN G  A++E RAEV
Sbjct  15   EDEWGGDGDAKDAYIKSGNGIATAAAAEVDEVGDLKRCLVDTVYGTNFGFEATAEVRAEV  74

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            VEL+ QLEA  PTPAPTEA  LL+  WVL YT+
Sbjct  75   VELVNQLEAVNPTPAPTEAAELLDGNWVLLYTA  107



>ref|XP_002505473.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO66731.1| predicted protein, partial [Micromonas sp. RCC299]
Length=251

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  DVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYT  523
            D +K +L+DSFYGTNRGLSASS+TRAEV ELI++LEA  PTP+P+  L  L+ KW L YT
Sbjct  12   DAVKSRLLDSFYGTNRGLSASSKTRAEVNELISRLEAMNPTPSPSYELAALSGKWRLVYT  71

Query  524  S  526
            S
Sbjct  72   S  72



>ref|XP_001756848.1| predicted protein [Physcomitrella patens]
 gb|EDQ78445.1| predicted protein, partial [Physcomitrella patens]
Length=242

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+QL+D   G  RG+ ASS+TR EV ELI+Q E+K PTPAPT++L+LLN KW+L YTS+
Sbjct  14   LKQQLIDFLDGKGRGIRASSDTRDEVTELISQFESKNPTPAPTDSLSLLNGKWILLYTSY  73



>ref|NP_001062631.2| Os09g0133600, partial [Oryza sativa Japonica Group]
 dbj|BAF24545.2| Os09g0133600, partial [Oryza sativa Japonica Group]
Length=241

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  395  LSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            L ASSETRAEVVELITQLEA+ PTPAPTEALTLLN KW+LAYTSF
Sbjct  32   LRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSF  76



>ref|XP_002276479.1| PREDICTED: plastoglobulin-1, chloroplastic [Vitis vinifera]
Length=382

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +2

Query  248  DDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAEV  427
            +DEWG +     +   +G  +     A + E   LK+ LVD+ YGTN G  A++E RAEV
Sbjct  124  EDEWGGDGDAKDAYIKSGNGIATAAAAEVDEVGDLKRCLVDTVYGTNFGFEATAEVRAEV  183

Query  428  VELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            VEL+ QLEA  PTPAPTEA  LL+  WVL YT+
Sbjct  184  VELVNQLEAVNPTPAPTEAAELLDGNWVLLYTA  216



>gb|KIZ02337.1| hypothetical protein MNEG_5623 [Monoraphidium neglectum]
Length=266

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK  L+DS +GT RGL+A SE RAE+ ELITQLEAK PTP+PTE L+ LN +W L YTS
Sbjct  15   LKAALLDSLFGTERGLAARSEVRAEINELITQLEAKNPTPSPTEILSALNGEWKLVYTS  73



>ref|XP_001760672.1| predicted protein [Physcomitrella patens]
 gb|EDQ74411.1| predicted protein, partial [Physcomitrella patens]
Length=251

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LKK L ++ YGTN G++A+ ET A + ++ITQLEA  PTPAPTE L  +N KW++AYTS
Sbjct  1    LKKSLANAVYGTNWGMNATRETHAAIADIITQLEAVNPTPAPTENLETINGKWIMAYTS  59



>ref|XP_010919972.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Elaeis guineensis]
Length=402

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 4/96 (4%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRA  421
            + +DEWG+E+         G       P    +   LK+ LVDS YGT+ GL AS+E RA
Sbjct  145  MDEDEWGKER----GPEGMGYISGNGTPVPPDKRGDLKRCLVDSLYGTDFGLRASAEVRA  200

Query  422  EVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            E+VEL+ QLE + PTPAPT++  LL+  W+L YT+F
Sbjct  201  EIVELVNQLETENPTPAPTKSPELLDGNWILLYTAF  236



>ref|XP_010245209.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Nelumbo nucifera]
Length=376

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  AS+E RAEV+EL+ QLE+  PTPAP EA +LL+  W+L YT+F
Sbjct  153  LKRSLVDTVYGTDFGFQASAEVRAEVLELVNQLESSNPTPAPLEATSLLDGNWILLYTAF  212



>gb|ABC96720.1| plastid fibrillin 2 [Coffea canephora]
Length=229

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  ASSE RAE +ELI QLEA  P PAPTE+  LL+  WVL +T+F
Sbjct  6    LKRALVDTVYGTDFGFRASSELRAEAIELIAQLEAANPNPAPTESPKLLDGNWVLLFTAF  65



>ref|XP_005645631.1| hypothetical protein COCSUDRAFT_17945 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21087.1| hypothetical protein COCSUDRAFT_17945 [Coccomyxa subellipsoidea 
C-169]
Length=296

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            +++ QL+DS +GT RGLSASSE RAE+ ELITQLEAK P P+ TEA  +L+ +W L YTS
Sbjct  10   LIQAQLLDSLFGTERGLSASSEVRAEINELITQLEAKNPNPSLTEAEKVLDGQWKLVYTS  69



>gb|EPS69991.1| hypothetical protein M569_04771 [Genlisea aurea]
Length=325

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E RAE +EL++QLEA  PTPAPTEA  LL+  W+L +T+F
Sbjct  114  LKRALVDTVYGSDLGFRASAEIRAEALELVSQLEAVNPTPAPTEAAALLDGNWILVFTAF  173



>ref|XP_004300209.1| PREDICTED: plastoglobulin-1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=352

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 60/102 (59%), Gaps = 10/102 (10%)
 Frame = +2

Query  242  VSDDEWG--EEKKE-----PLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLS  400
            V++DEWG  +E  E     P  A       VE   + LTE   LK+ LVD+ YGT  G  
Sbjct  89   VNEDEWGGGDEYVEIGNGTPAKAEAESAVEVEEVDSKLTE---LKRCLVDTLYGTELGFR  145

Query  401  ASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            A SE RAEVVEL+ QLEA  PTPAPTE   LL+  WVL YT+
Sbjct  146  AGSEVRAEVVELVNQLEAANPTPAPTENPGLLDGNWVLLYTA  187



>ref|XP_011082345.1| PREDICTED: plastoglobulin-1, chloroplastic [Sesamum indicum]
Length=359

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E RAE  EL++QLEA  PTPAPTE   LL+  WVL YT+F
Sbjct  136  LKRALVDTVYGSDLGFRASAEVRAEAFELVSQLEAANPTPAPTENPELLDGNWVLVYTAF  195



>gb|ADK79127.1| astaxanthin vesicles associated protein [Haematococcus pluvialis]
Length=306

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+DS YGT RGL+A SE RAE+ ELI QLEAK PTP PTE L  L+ +W L YTS
Sbjct  83   KAALLDSLYGTERGLTARSEIRAEINELIGQLEAKNPTPNPTEVLEKLDGEWRLMYTS  140



>emb|CDP18539.1| unnamed protein product [Coffea canephora]
Length=370

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  ASSE RAE +ELI QLEA  P PAPTE+  LL+  WVL +T+F
Sbjct  147  LKRALVDTVYGTDFGFRASSELRAEAIELIAQLEAANPNPAPTESPELLDGNWVLLFTAF  206



>ref|XP_011018505.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X2 [Populus euphratica]
Length=311

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDV----LKKQLVDSFYGTNRGLSASS  409
            ++DDEWGE+    +++     A      A + E D     LK+ LVD+ YGT  G  A+ 
Sbjct  109  INDDEWGEQF---VASGNGTAAAPSTSSAVVVEKDRRIEDLKRCLVDTVYGTEFGFRATP  165

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            E RAEV+EL+ QLEA  PT AP +A  +L+ KWVL YT+F
Sbjct  166  EIRAEVLELVNQLEAVNPTSAPVDATGVLDGKWVLVYTAF  205



>ref|XP_006662632.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Oryza brachyantha]
Length=330

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E R EV+EL+TQLEA  PTPAP +A  LL+  W+L YT++
Sbjct  105  LKRCLVDTVYGSDLGFRASAEVRGEVLELVTQLEAANPTPAPVQATDLLDGNWILIYTAY  164



>ref|XP_010096934.1| putative plastid-lipid-associated protein 3 [Morus notabilis]
 gb|EXB66511.1| putative plastid-lipid-associated protein 3 [Morus notabilis]
Length=368

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA  PTPAPT+AL LL   WVL YT F
Sbjct  145  LKRCLVDSIYGTELGFRARLEERAEILELVNQLEALNPTPAPTQALELLGGNWVLLYTGF  204



>ref|XP_011018504.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=369

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDV----LKKQLVDSFYGTNRGLSASS  409
            ++DDEWGE+    +++     A      A + E D     LK+ LVD+ YGT  G  A+ 
Sbjct  109  INDDEWGEQF---VASGNGTAAAPSTSSAVVVEKDRRIEDLKRCLVDTVYGTEFGFRATP  165

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            E RAEV+EL+ QLEA  PT AP +A  +L+ KWVL YT+F
Sbjct  166  EIRAEVLELVNQLEAVNPTSAPVDATGVLDGKWVLVYTAF  205



>ref|XP_004983554.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Setaria italica]
Length=385

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG+  G  AS+E R EVVEL+TQLEA  PTPAP EA  LL+  W+L YT++
Sbjct  160  LKRCLVDTVYGSELGFRASTEVRGEVVELVTQLEAVNPTPAPVEAPDLLDGNWILIYTAY  219



>ref|XP_004512496.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Cicer arietinum]
Length=354

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G  A SE RAEV EL+TQLEA  PTPAP + L LL+  WVL YT+
Sbjct  131  LKRALVDTVYGTELGFRAGSEVRAEVTELVTQLEAVNPTPAPVDELDLLSGNWVLLYTA  189



>ref|XP_008800090.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=336

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRA  421
            + +DEWG   KEP S     ++       +    D LK+ LVD+ YGT+ GL AS+E RA
Sbjct  145  MDEDEWG---KEPGSGGMGYISGNGSPVPSDKLGD-LKRCLVDTLYGTDFGLRASAEVRA  200

Query  422  EVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            E++EL+ QLEA+ PT APT +  LL+  W+L YT+F
Sbjct  201  EILELVNQLEAENPTRAPTTSPELLDGNWILLYTAF  236



>ref|XP_009608239.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=341

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+  VD+ YGT+ G  ASSE RAE +EL++QLEA  PTPAPTE   LL+  W+L +T+F
Sbjct  119  LKRCFVDTVYGTDFGFRASSEVRAEALELVSQLEAANPTPAPTECPELLDGNWILVFTAF  178



>ref|XP_009349223.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Pyrus x bretschneideri]
Length=353

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +2

Query  245  SDDEWGEEKKEPLSaapagvavvexepaaLTETDV--LKKQLVDSFYGTNRGLSASSETR  418
            ++DEWG    E +       A  E       +T +  LK+ LVD+ YGT  G  A SE R
Sbjct  93   NEDEWGGGGDEVVEVGNGSAAKAEIAIEEKVDTKLTELKRGLVDAVYGTEFGFRAGSEVR  152

Query  419  AEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            AEV+E ++QLEA  P PAPTE L +L+  WVL YT+
Sbjct  153  AEVMEFVSQLEAANPNPAPTENLGILDGNWVLLYTA  188



>ref|XP_010276838.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Nelumbo nucifera]
Length=446

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LV++ YGT+ G  AS E R EV+EL+ QLEA  PTPAP EA +LL+  WVL YT+F
Sbjct  223  LKRCLVETVYGTDFGFQASGEVREEVLELVNQLEASNPTPAPVEATSLLDGNWVLLYTAF  282



>ref|XP_009766235.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
 ref|XP_009766236.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
 ref|XP_009766237.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
Length=342

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+  VD+ YGT+ G  ASSE RAE +EL++QLEA  PTPAPTE   LL+  W+L +T+F
Sbjct  120  LKRCFVDTVYGTDFGFRASSEIRAEALELVSQLEAANPTPAPTECPELLDGNWILVFTAF  179



>ref|XP_008800089.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=402

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRA  421
            + +DEWG   KEP S     ++       +    D LK+ LVD+ YGT+ GL AS+E RA
Sbjct  145  MDEDEWG---KEPGSGGMGYISGNGSPVPSDKLGD-LKRCLVDTLYGTDFGLRASAEVRA  200

Query  422  EVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            E++EL+ QLEA+ PT APT +  LL+  W+L YT+F
Sbjct  201  EILELVNQLEAENPTRAPTTSPELLDGNWILLYTAF  236



>ref|XP_002297709.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa]
 gb|EEE82514.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa]
Length=349

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 61/123 (50%), Gaps = 26/123 (21%)
 Frame = +2

Query  161  FASKVAALRSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSaapagvavvexepaaLTE  340
            +  K      +P    ++P R       +DDEWGE+ K+                     
Sbjct  89   WGEKAEPEPEYPKDADSDPTR-------NDDEWGEQFKD-------------------GR  122

Query  341  TDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAY  520
             + LK+ LVD+ YGT  G  A+ E RAEV+EL+ QLEA  PT AP +   +L+ KWVL Y
Sbjct  123  IEDLKRCLVDTVYGTEFGFRATPEIRAEVLELVNQLEAVNPTSAPVDTTGVLDGKWVLVY  182

Query  521  TSF  529
            T+F
Sbjct  183  TAF  185



>ref|XP_011028127.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Populus euphratica]
Length=373

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  AS E RAE +EL+ QLE   PTPAP +A  +L+ KWVL YT+F
Sbjct  150  LKRSLVDTVYGTDFGFRASPEIRAEALELVNQLEVVNPTPAPVDATGVLDGKWVLVYTAF  209



>ref|XP_006352897.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum]
Length=411

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  ASSE RAE +E ++QLEA  PTPAPTE+  LL+  W+L +T+F
Sbjct  189  LKRCLVDTVYGTDFGFRASSEIRAEALEFVSQLEAANPTPAPTESPELLDGNWLLVFTAF  248



>ref|XP_009403116.1| PREDICTED: LOW QUALITY PROTEIN: probable plastid-lipid-associated 
protein 3, chloroplastic [Musa acuminata subsp. malaccensis]
Length=422

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVDS YGT  G  AS E RA+++EL+ QLEA  PTPAPTEA  LL+  W+L YT+
Sbjct  198  LKRCLVDSLYGTELGFRASVEDRADILELVNQLEAANPTPAPTEAPELLDGNWILLYTA  256



>ref|XP_008448650.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
 ref|XP_008448651.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
 ref|XP_008448652.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
Length=367

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +2

Query  248  DDEWG-EEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAE  424
            DDEWG +E     S           +   L E   LK+ LVD+ YGT  G  A  E RAE
Sbjct  112  DDEWGGDEGNGKPSVVEEKSEEYADDRDKLLE---LKRCLVDTVYGTEFGFRAGLEERAE  168

Query  425  VVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ++E++ QLEA  PTPAP EA  LL+  W+L YT+F
Sbjct  169  ILEIVNQLEAANPTPAPVEASGLLDGNWILLYTAF  203



>ref|XP_002304354.1| hypothetical protein POPTR_0003s09460g [Populus trichocarpa]
 gb|EEE79333.1| hypothetical protein POPTR_0003s09460g [Populus trichocarpa]
Length=373

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  AS E RAE +EL+ QLE   PTPAP +A  +L+ KWVL YT+F
Sbjct  150  LKRGLVDTVYGTDFGFRASPEIRAEALELVNQLEVVNPTPAPVDATGVLDGKWVLVYTAF  209



>ref|XP_003612834.1| Plastoglobulin-1 [Medicago truncatula]
 gb|AES95792.1| plastid fibrillin [Medicago truncatula]
Length=355

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E + LK+ LVD+ YGT  G  A SE RAEV E + QLEA  PTPAP E   LLN  WVL 
Sbjct  129  ELEGLKRALVDTVYGTELGFRAGSEVRAEVSEFVAQLEAANPTPAPVEEPELLNGNWVLL  188

Query  518  YTS  526
            YT+
Sbjct  189  YTA  191



>ref|XP_004148751.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004165579.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55727.1| hypothetical protein Csa_3G008840 [Cucumis sativus]
Length=363

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 52/95 (55%), Gaps = 4/95 (4%)
 Frame = +2

Query  248  DDEWG-EEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRAE  424
            DDEWG +E     S               L E   LK+ LVD+ YGT  G  A  E RAE
Sbjct  108  DDEWGGDEGNGKPSVVEEKSEEYVDNRDKLLE---LKRCLVDTVYGTEFGFRAGLEERAE  164

Query  425  VVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            ++E++ QLEA  PTPAP EA  LL+  W+L YT+F
Sbjct  165  ILEIVNQLEAANPTPAPVEASGLLDGNWILVYTAF  199



>ref|XP_004245973.1| PREDICTED: plastoglobulin-1, chloroplastic [Solanum lycopersicum]
Length=344

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT+ G  ASSE RAE +E + QLEA  P+PAPTE+  LL+  W+L +T+F
Sbjct  122  LKRCLVDTVYGTDFGFRASSEIRAEALEFVCQLEAANPSPAPTESPELLDGNWILVFTAF  181



>ref|XP_010053632.1| PREDICTED: plastoglobulin-1, chloroplastic [Eucalyptus grandis]
 gb|KCW77976.1| hypothetical protein EUGRSUZ_D02221 [Eucalyptus grandis]
Length=360

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT+ G  +  E RAEV+EL+ QLEA  PTPAP +A  LL+  WVL YT+
Sbjct  138  LKRALVDTVYGTDFGFRSGQEVRAEVLELVNQLEAANPTPAPVDAAGLLDGNWVLVYTA  196



>ref|NP_181092.1| putative plastid-lipid-associated protein 3 [Arabidopsis thaliana]
 sp|O82291.1|PAP3_ARATH RecName: Full=Probable plastid-lipid-associated protein 3, chloroplastic; 
Short=AtPap3; AltName: Full=Fibrillin-2; AltName: 
Full=Plastoglobulin 40; Short=AtPGL40; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC36172.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM65369.1| putative fibrillin [Arabidopsis thaliana]
 gb|AEC09113.1| putative plastid-lipid-associated protein 3 [Arabidopsis thaliana]
Length=376

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L DS YGT  G  A SE RAEV+EL+ QLEA  PTPAP E   LL+  WVL YT+F
Sbjct  153  LKRCLADSVYGTELGFKAGSEVRAEVLELVNQLEALNPTPAPLENPELLDGNWVLLYTAF  212



>ref|XP_009619935.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Nicotiana tomentosiformis]
Length=427

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L+D+ YGT  GL ASSE RAE +EL++QLEA  PTP+P E+  LL+  W+L +T+F
Sbjct  204  LKRCLMDTVYGTEFGLRASSEMRAEALELVSQLEAANPTPSPVESPELLDGNWILVFTAF  263



>ref|NP_001065482.2| Os10g0575700 [Oryza sativa Japonica Group]
 dbj|BAF27319.2| Os10g0575700 [Oryza sativa Japonica Group]
Length=409

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  ASSE R EV+EL+TQLEA  PTP P +A  LL   W+L YT++
Sbjct  149  LKRCLVDTVYGSDLGFRASSEVRGEVLELVTQLEATNPTPEPVQATHLLAGNWILIYTAY  208



>gb|KDP30383.1| hypothetical protein JCGZ_17112 [Jatropha curcas]
Length=382

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDV----LKKQLVDSFYGTNRGLSASS  409
            V DDEW EE       A AG          + E D     LK+ LVD+ YGTN G  AS 
Sbjct  125  VRDDEWEEE------YAAAGNGSTSQSTGVVVEKDDNVGDLKRILVDTVYGTNFGFQASP  178

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            E RAEV+EL+ QLEA  PT  P +A  +L+  WVL YT+F
Sbjct  179  EIRAEVLELVNQLEAMNPTQTPVDAAEVLDGNWVLLYTAF  218



>sp|Q7XBW5.1|PAP3_ORYSJ RecName: Full=Probable plastid-lipid-associated protein 3, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL67595.1|AC018929_17 putative plastid-lipid associated protein [Oryza sativa Japonica 
Group]
 gb|AAP55143.1| plastid-lipid associated protein 3, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=374

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  ASSE R EV+EL+TQLEA  PTP P +A  LL   W+L YT++
Sbjct  149  LKRCLVDTVYGSDLGFRASSEVRGEVLELVTQLEATNPTPEPVQATHLLAGNWILIYTAY  208



>gb|EEE51456.1| hypothetical protein OsJ_32570 [Oryza sativa Japonica Group]
Length=374

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  ASSE R EV+EL+TQLEA  PTP P +A  LL   W+L YT++
Sbjct  149  LKRCLVDTVYGSDLGFRASSEVRGEVLELVTQLEATNPTPEPVQATHLLAGNWILIYTAY  208



>sp|Q9ZP40.1|PG1_PEA RecName: Full=Plastoglobulin-1, chloroplastic; Flags: Precursor 
[Pisum sativum]
 gb|AAD02288.1| plastoglobule associated protein PG1 precursor [Pisum sativum]
Length=358

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G  A SE RAEV E + QLEA  PTPAP E   LLN  WVL YT+
Sbjct  135  LKRSLVDTVYGTELGFRARSEVRAEVSEFVAQLEAANPTPAPVEEPDLLNGNWVLLYTA  193



>ref|XP_006410707.1| hypothetical protein EUTSA_v10016800mg [Eutrema salsugineum]
 gb|ESQ52160.1| hypothetical protein EUTSA_v10016800mg [Eutrema salsugineum]
Length=380

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A+SE RAEV+EL+ QLEA  PTPAP E   LL+  WVL YT+F
Sbjct  157  LKRCLADTVYGTELGFRANSEVRAEVLELVNQLEALNPTPAPVENPELLDGNWVLLYTAF  216



>ref|XP_003516983.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Glycine max]
Length=370

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  DVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYT  523
            + LK+ LVD+ YGT  G+ A SE RAEV EL++QLEA  PT AP E   LLN  WVL YT
Sbjct  145  EALKRALVDTLYGTELGIRAGSEVRAEVSELVSQLEAANPTLAPVEEPALLNGNWVLLYT  204

Query  524  S  526
            +
Sbjct  205  A  205



>ref|XP_010505057.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=378

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA  PTPAP E   LL+  WVL YT+F
Sbjct  155  LKRCLADTVYGTELGFRAGSEVRAEVLELVNQLEALNPTPAPLENPELLDGNWVLLYTAF  214



>ref|XP_010677363.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=411

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L+DS YG++ G  AS+E RAEV EL++QLEA  P+P PTE   LL+  W+L YT+F
Sbjct  188  LKRCLLDSVYGSDLGFRASAEVRAEVSELVSQLEAVNPSPKPTEVSGLLDGNWILVYTAF  247



>ref|XP_005846413.1| hypothetical protein CHLNCDRAFT_11571, partial [Chlorella variabilis]
 gb|EFN54311.1| hypothetical protein CHLNCDRAFT_11571, partial [Chlorella variabilis]
Length=228

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 6/65 (9%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQ------LEAKXPTPAPTEALTLLNXKWV  511
            LK  L+DSF+GT+RGL+ASS++RAE+ ELIT+      LEA  PTP P EA   L   W 
Sbjct  8    LKMALLDSFWGTDRGLAASSDSRAEINELITKAGRCRSLEALNPTPEPNEARQALGGTWR  67

Query  512  LAYTS  526
            LAYTS
Sbjct  68   LAYTS  72



>ref|XP_010509611.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=375

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA  PTPAP E   LL+  WVL YT+F
Sbjct  152  LKRCLADTVYGTELGFRAGSEVRAEVLELVNQLEALNPTPAPLENPELLDGNWVLLYTAF  211



>ref|XP_002467442.1| hypothetical protein SORBIDRAFT_01g028150 [Sorghum bicolor]
 gb|EER94440.1| hypothetical protein SORBIDRAFT_01g028150 [Sorghum bicolor]
Length=381

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA  PT AP E   LL+  W+L YT++
Sbjct  156  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAANPTTAPVETSDLLDGNWILIYTAY  215



>ref|XP_008676981.1| PREDICTED: fibrillin1 isoform X1 [Zea mays]
 tpg|DAA46452.1| TPA: plastid-lipid associated protein 3 isoform 1 [Zea mays]
 tpg|DAA46453.1| TPA: plastid-lipid associated protein 3 isoform 2 [Zea mays]
Length=382

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA  PT AP E+  LL+  W+L YT++
Sbjct  157  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAVNPTTAPVESPDLLDGNWILIYTAY  216



>gb|AFK33388.1| unknown [Medicago truncatula]
Length=355

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 50/101 (50%), Gaps = 7/101 (7%)
 Frame = +2

Query  245  SDDEWGEEKKEPLSaapagvavvexepaaL-------TETDVLKKQLVDSFYGTNRGLSA  403
            ++DEWGE  K    +            +          E + LK+ LVD+ YGT  G  A
Sbjct  91   NEDEWGEGAKNDAGSYSDAGNGTPAFASEAPVEEGGNDELEGLKRALVDTVYGTELGFRA  150

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
             SE RAEV E + QLEA  PTPAP     LLN  WVL YT+
Sbjct  151  GSEVRAEVSEFVAQLEAANPTPAPVGEPELLNGNWVLLYTA  191



>gb|ACJ84215.1| unknown [Medicago truncatula]
Length=355

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  338  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLA  517
            E + LK+ LVD+ YGT  G  A SE RAEV E + QLEA  PTPAP     LLN  WVL 
Sbjct  129  ELEGLKRALVDTVYGTELGFRAGSEVRAEVSEFVAQLEAANPTPAPVGEPELLNGNWVLL  188

Query  518  YTS  526
            YT+
Sbjct  189  YTA  191



>ref|XP_006432746.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45986.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
Length=298

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT  G  A S+ RAEV+EL+ QLEA  PTP P  A  +L+  WVL YT+F
Sbjct  157  LKRCLVDTVYGTELGFRAGSDVRAEVLELVNQLEALNPTPNPVNAAGVLDGNWVLVYTAF  216



>gb|KJB37718.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=274

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA  PT AP EA  LL+  W+L YT+F
Sbjct  153  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  212



>ref|XP_010518909.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Tarenaya hassleriana]
Length=371

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE R EV+EL+ QLEA  PTP P EA  LL+  WVL YT+F
Sbjct  148  LKRILADTVYGTELGFRAESEVRGEVLELLNQLEALNPTPTPVEASDLLDGNWVLLYTAF  207



>ref|XP_010235051.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Brachypodium distachyon]
Length=351

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 4/110 (4%)
 Frame = +2

Query  203  GLANPNRKFVVRA-VSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A P +     A  +DDEWG E            A    +     E   LK+ LVD+ Y
Sbjct  80   GVAEPEQPSGADAPTNDDEWGGEPTPTPPTPVPATAAEGEDKDEGRED--LKRCLVDTVY  137

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
             +  GL ASSE R EVVEL+ QLEA  PTPAP +A   L+  W+L YT++
Sbjct  138  DSGLGLKASSEVRGEVVELVAQLEAANPTPAPVQAPD-LDGNWILLYTAY  186



>gb|EYU19056.1| hypothetical protein MIMGU_mgv1a014970mg [Erythranthe guttata]
Length=172

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 9/95 (9%)
 Frame = +2

Query  248  DDEWGEEK------KEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASS  409
            DDEWG+ +        P+          + +   L E   LK+ LVD+ YG++ G  AS+
Sbjct  80   DDEWGQSEVVEFINGTPVPDPVVKEEEEKEDDGKLWE---LKRALVDTVYGSDFGFRASA  136

Query  410  ETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            E RAE +EL++QLEA  PTPAPTE+  LL+  W L
Sbjct  137  EVRAETLELVSQLEAANPTPAPTESPQLLDGNWFL  171



>ref|XP_002881399.1| hypothetical protein ARALYDRAFT_902655 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57658.1| hypothetical protein ARALYDRAFT_902655 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A S+ RAEV+EL+ QLEA  PTPAP E   LL+  WVL YT+F
Sbjct  152  LKRCLADTVYGTELGFRAGSDVRAEVLELVNQLEALNPTPAPIENPELLDGNWVLLYTAF  211



>ref|XP_007040681.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 3 [Theobroma cacao]
 gb|EOY25182.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 3 [Theobroma cacao]
Length=274

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G     E RAEV+EL+ QLEA  PTPAP EA  LL+  WVL YT+
Sbjct  144  LKRCLVDTVYGTELGFRTGPEVRAEVLELVNQLEAVNPTPAPVEATQLLDGYWVLLYTA  202



>ref|XP_002518975.1| Plastid lipid-associated protein 3, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43508.1| Plastid lipid-associated protein 3, chloroplast precursor, putative 
[Ricinus communis]
Length=367

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT  G  AS E R EV+EL+ QLEA  PTPAP ++  +L+  W+L YT+F
Sbjct  145  LKRCLVDTVYGTKFGFQASPEIRGEVLELVNQLEALNPTPAPVDSSQILDGTWILLYTAF  204



>ref|XP_006294405.1| hypothetical protein CARUB_v10023422mg [Capsella rubella]
 gb|EOA27303.1| hypothetical protein CARUB_v10023422mg [Capsella rubella]
Length=381

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAE++EL+ QLEA  PTPAP E   LL+  WVL YT+F
Sbjct  158  LKRCLADTVYGTELGFRAGSEVRAELLELVNQLEALNPTPAPIENPELLDGNWVLLYTAF  217



>ref|XP_006432747.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006432748.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006432749.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006471524.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006471525.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR45987.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45988.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45989.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|KDO50349.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
 gb|KDO50350.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
 gb|KDO50351.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
Length=380

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YGT  G  A S+ RAEV+EL+ QLEA  PTP P  A  +L+  WVL YT+F
Sbjct  157  LKRCLVDTVYGTELGFRAGSDVRAEVLELVNQLEALNPTPNPVNAAGVLDGNWVLVYTAF  216



>gb|KHG16773.1| Plastid lipid-associated 3, chloroplastic [Gossypium arboreum]
Length=367

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA  PT AP EA  LL+  W+L YT+F
Sbjct  144  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  203



>ref|XP_007040682.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
 ref|XP_007040683.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
 gb|EOY25183.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
 gb|EOY25184.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
Length=337

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G     E RAEV+EL+ QLEA  PTPAP EA  LL+  WVL YT+
Sbjct  144  LKRCLVDTVYGTELGFRTGPEVRAEVLELVNQLEAVNPTPAPVEATQLLDGYWVLLYTA  202



>ref|NP_001149315.1| fibrillin1 [Zea mays]
 gb|ACG34995.1| plastid-lipid associated protein 3 [Zea mays]
Length=382

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA  PT AP ++  LL+  W+L YT++
Sbjct  157  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAVNPTTAPVDSPDLLDGNWILIYTAY  216



>gb|KJB37719.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=375

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA  PT AP EA  LL+  W+L YT+F
Sbjct  153  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  212



>gb|ACG41445.1| plastid-lipid associated protein 3 [Zea mays]
Length=382

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA  PT AP ++  LL+  W+L YT++
Sbjct  157  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAVNPTTAPVDSPDLLDGNWILIYTAY  216



>gb|KJB37720.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=368

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA  PT AP EA  LL+  W+L YT+F
Sbjct  146  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  205



>ref|XP_009373486.1| PREDICTED: plastoglobulin-1, chloroplastic [Pyrus x bretschneideri]
Length=355

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G  A SE RAE +E ++QLEA  P PAPTE   LL+  WVL YT+
Sbjct  132  LKRGLVDTVYGTEFGFRAGSEVRAEALEFVSQLEAANPNPAPTENPGLLDGNWVLLYTA  190



>ref|XP_008373508.1| PREDICTED: plastoglobulin-1, chloroplastic [Malus domestica]
Length=355

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G  A SE RAE +E ++QLEA  P PAPTE   LL+  WVL YT+
Sbjct  132  LKRGLVDTVYGTEFGFRAGSEVRAEALEFVSQLEAANPNPAPTENPGLLDGNWVLLYTA  190



>ref|XP_007040679.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007040680.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 gb|EOY25180.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 gb|EOY25181.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
Length=367

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G     E RAEV+EL+ QLEA  PTPAP EA  LL+  WVL YT+
Sbjct  144  LKRCLVDTVYGTELGFRTGPEVRAEVLELVNQLEAVNPTPAPVEATQLLDGYWVLLYTA  202



>gb|KFK36419.1| hypothetical protein AALP_AA4G121600 [Arabis alpina]
Length=376

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  TDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAY  520
            T  LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA  PT AP E   LL+  WVL Y
Sbjct  143  TSELKRCLADTVYGTELGFRAGSEVRAEVLELVNQLEALNPTQAPVENPELLDGNWVLMY  202

Query  521  TSF  529
            T+F
Sbjct  203  TAF  205



>ref|XP_010516724.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=378

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA  PTPAP E   LL+  W L YT+F
Sbjct  155  LKRCLADTVYGTELGFRAGSEVRAEVLELVNQLEALNPTPAPLENPELLDGNWFLLYTAF  214



>gb|AAK68845.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM10011.1| putative fibrillin [Arabidopsis thaliana]
Length=376

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L DS YGT  G  A SE RAEV+EL+ QLEA  PTPAP E   LL+  WVL  T+F
Sbjct  153  LKRCLADSVYGTELGFKAGSEVRAEVLELVNQLEALNPTPAPLENPELLDGNWVLLCTAF  212



>ref|XP_009608213.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608224.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608233.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=354

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            LK+  VD+ YGT+ G  ASSE RAE +EL++QLEA  PTPAPTE   LL+  W+L
Sbjct  119  LKRCFVDTVYGTDFGFRASSEVRAEALELVSQLEAANPTPAPTECPELLDGNWIL  173



>gb|EMS55390.1| putative plastid-lipid-associated protein 3, chloroplastic [Triticum 
urartu]
Length=325

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +2

Query  203  GLANPNRKFVVR-AVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A P +        +DDEWG    EP    P        +     E   LK+ LVD+ Y
Sbjct  57   GVAEPEQPSGADTPTNDDEWG---GEPTPTPPKAKEAPVTKEDEGREE--LKRCLVDTVY  111

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            G+  GL ASSE R EVVEL+ QLEA  PT AP +A   L+  W+L YT++
Sbjct  112  GSGLGLKASSEVRGEVVELVAQLEAANPTSAPVQAPE-LDGNWILLYTAY  160



>ref|XP_007158263.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
 gb|ESW30257.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
Length=265

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G+ A SE RAEV EL+TQLEA  P  AP E   +L+  WVL YT+
Sbjct  143  LKRALVDTLYGTELGIQAGSEVRAEVSELVTQLEAVNPNLAPVEEPAILDGNWVLLYTA  201



>dbj|BAJ85307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 7/102 (7%)
 Frame = +2

Query  242  VSDDEWGEEKKE--PLSaapagvavvexepaaLTETDV----LKKQLVDSFYGTNRGLSA  403
             +DDEWG E     P +         + E   +T+ D     LK+ LVD+ YG+  GL A
Sbjct  106  TNDDEWGGEPTPTPPKAKESPLFFADKAEEDPVTKEDEGREELKRCLVDTVYGSGLGLKA  165

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            SSE R EVVEL+ QLEA  PT AP +A + L+  W+L YT++
Sbjct  166  SSEVRGEVVELVAQLEAANPTSAPVQA-SELDGNWILLYTAY  206



>dbj|BAJ98223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 7/102 (7%)
 Frame = +2

Query  242  VSDDEWGEEKKE--PLSaapagvavvexepaaLTETDV----LKKQLVDSFYGTNRGLSA  403
             +DDEWG E     P +         + E   +T+ D     LK+ LVD+ YG+  GL A
Sbjct  106  TNDDEWGGEPTPTPPKAKESPLFFADKAEEDPVTKEDEGREELKRCLVDTVYGSGLGLKA  165

Query  404  SSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            SSE R EVVEL+ QLEA  PT AP +A + L+  W+L YT++
Sbjct  166  SSEVRGEVVELVAQLEAANPTSAPVQA-SELDGNWILLYTAY  206



>ref|XP_008238187.1| PREDICTED: plastoglobulin-1, chloroplastic [Prunus mume]
Length=353

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA  P PAPT    LL+  WVL YT+
Sbjct  130  LKRALADTVYGTEFGFRAGSEVRAEVLELVNQLEAVNPNPAPTANPGLLDGNWVLLYTA  188



>gb|EMT01216.1| Putative plastid-lipid-associated protein 3, chloroplastic [Aegilops 
tauschii]
Length=360

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +2

Query  203  GLANPNRKFVVR-AVSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFY  379
            G+A P +        +DDEWG    EP    P        +     E   LK+ LVD+ Y
Sbjct  92   GVAEPEQPSGADTPTNDDEWG---GEPTPTPPKAKEAPVTKEDEGREE--LKRCLVDTVY  146

Query  380  GTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            G+  GL ASSE R EVVEL+ QLEA  PT AP +A   L+  W+L YT++
Sbjct  147  GSGLGLKASSEVRGEVVELVAQLEAANPTSAPVQAPE-LDGNWILLYTAY  195



>ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica]
 gb|EMJ10503.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica]
Length=353

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA  P PAPT    LL+  WVL YT+
Sbjct  130  LKRALADTVYGTEFGFRAGSEVRAEVLELVNQLEAVNPNPAPTANPGLLDGNWVLLYTA  188



>ref|XP_007158264.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
 gb|ESW30258.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
Length=366

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK+ LVD+ YGT  G+ A SE RAEV EL+TQLEA  P  AP E   +L+  WVL YT+
Sbjct  143  LKRALVDTLYGTELGIQAGSEVRAEVSELVTQLEAVNPNLAPVEEPAILDGNWVLLYTA  201



>emb|CDY31692.1| BnaA05g08550D [Brassica napus]
Length=360

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 51/96 (53%), Gaps = 16/96 (17%)
 Frame = +2

Query  242  VSDDEWGEEKKEPLSaapagvavvexepaaLTETDVLKKQLVDSFYGTNRGLSASSETRA  421
             +DDEW E + +                  + +T  LK+ L D+ YGT  G  A SE RA
Sbjct  117  TNDDEWEEREAD----------------DGVDKTWELKRCLADTVYGTELGFRAGSEVRA  160

Query  422  EVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            EV+E++ QLEA  PT AP E   LL+  WVL YT+F
Sbjct  161  EVLEIVNQLEALNPTQAPVENPELLDGNWVLLYTAF  196



>emb|CDX84202.1| BnaC04g09640D [Brassica napus]
Length=362

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+E++ QLEA  PT AP E   LL+  WVL YT+F
Sbjct  139  LKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWVLLYTAF  198



>ref|XP_009143664.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Brassica rapa]
Length=360

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+E++ QLEA  PT AP E   LL+  WVL YT+F
Sbjct  137  LKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWVLLYTAF  196



>sp|Q94KU5.1|PAP3_BRACM RecName: Full=Plastid lipid-associated protein 3, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57566.1|AF290568_1 plastid-lipid associated protein PAP3 [Brassica rapa subsp. oleifera]
Length=360

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+E++ QLEA  PT AP E   LL+  WVL YT+F
Sbjct  137  LKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWVLLYTAF  196



>gb|AAK57563.1| plastid-lipid associated protein PAP3 [Brassica rapa subsp. oleifera]
Length=360

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK+ L D+ YGT  G  A SE RAEV+E++ QLEA  PT AP E   LL+  WVL YT+F
Sbjct  137  LKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWVLLYTAF  196



>ref|XP_006368003.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=418

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +K+ L+D+ YGT+ GL ASSE RAE +EL+ +LEA  PTP P E   LL+  W+L +T+F
Sbjct  198  MKRCLIDTVYGTDFGLRASSEVRAEALELVAKLEAANPTPNPVE---LLDGNWILVFTAF  254



>ref|XP_009790013.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Nicotiana sylvestris]
Length=252

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVL  514
            LK+ L+D+ Y T  GL ASSE RAE +EL++QLEA  PTP+P E+  LL+  W+L
Sbjct  197  LKRCLMDTVYRTEFGLRASSEIRAEALELVSQLEAANPTPSPVESPELLDGNWIL  251



>ref|XP_010279319.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=179

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAK  457
            LKK L+DS YGT+RGL ASSETRA++VELITQLEAK
Sbjct  78   LKKTLIDSLYGTDRGLRASSETRAKIVELITQLEAK  113



>ref|XP_004244405.1| PREDICTED: plastoglobulin-1, chloroplastic [Solanum lycopersicum]
Length=418

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            +K+ L+D+ YGT+ GL ASSE RAE +EL+ +LEA  PTP   E   LL+  W+L +T+F
Sbjct  198  MKRCLIDTVYGTDFGLRASSEVRAEALELVAKLEAANPTPTTVE---LLDGNWILVFTAF  254



>ref|XP_002945995.1| hypothetical protein VOLCADRAFT_46047 [Volvox carteri f. nagariensis]
 gb|EFJ52990.1| hypothetical protein VOLCADRAFT_46047 [Volvox carteri f. nagariensis]
Length=249

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            L+  L++  YGT RG++A++  R  + EL+  LEA+ P  +PT+A+T L  +W L YTS 
Sbjct  3    LRADLLEMLYGTARGVTATAAQRTAIDELVAALEARNPNTSPTDAVTALGGRWKLVYTSN  62

Query  530  I  532
            +
Sbjct  63   V  63



>ref|XP_001698965.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDO99019.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=419

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSFI  532
            K  L+D+ Y T RG++A+ + RA + EL+  LEA+ P  APT+A++ L  +W L YTS +
Sbjct  176  KAALLDAVYATARGVNATPQQRAAIDELVAALEAQNPNTAPTDAVSALAGRWKLVYTSNV  235



>ref|XP_002945997.1| hypothetical protein VOLCADRAFT_46017 [Volvox carteri f. nagariensis]
 gb|EFJ52992.1| hypothetical protein VOLCADRAFT_46017 [Volvox carteri f. nagariensis]
Length=247

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK +L+D  YGT RG+SA+S  RA + EL+  LE + P    T+A+T L  +W L YTS 
Sbjct  1    LKSRLLDMVYGTARGVSATSTQRAVIEELVEALELRNPNVMATDAVTALGGRWKLVYTSN  60

Query  530  I  532
            +
Sbjct  61   V  61



>ref|XP_001698968.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDO99022.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=320

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            LK  L+D  YGT RG+ A+  TRA + E ++ LEA+ P   PT+A++ L  +W L YTS 
Sbjct  64   LKSGLLDLVYGTARGVHAAPVTRAAIEEFVSALEARNPHSVPTDAVSALAGRWKLVYTSN  123

Query  530  I  532
            +
Sbjct  124  V  124



>ref|XP_003059745.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55697.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=238

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEA--LTLLNXKWVLAYT  523
            +K QL+D+  GT RGL+AS   RA + ELI  LEA  PTP+P  A     L  +W +AYT
Sbjct  3    VKSQLMDAVAGTKRGLAASGAARARINELIATLEASNPTPSPATADGAAGLAGEWKIAYT  62



>ref|WP_012307392.1| MULTISPECIES: fibrillin [Synechococcus]
 gb|ACA99769.1| fibrillin [Synechococcus sp. PCC 7002]
Length=196

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK  L+++  G NRGL A+   RA ++ ++ +LE + PTP P EA TLL   W L YT+
Sbjct  3    LKTNLLETIAGKNRGLIATEVDRANILAIVDRLEDQNPTPKPLEATTLLEGDWRLIYTT  61



>ref|WP_009768204.1| fibrillin [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67403.1| fibrillin [Oscillatoriales cyanobacterium JSC-12]
Length=194

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+++  G NRGL AS   +  ++  I QLE + PTP P EA  LLN  W L YT+
Sbjct  4    KADLLETIAGKNRGLLASDSQKQAILSAIAQLEDRNPTPRPVEATDLLNGDWRLIYTT  61



>ref|WP_011613884.1| fibrillin [Trichodesmium erythraeum]
 gb|ABG53567.1| PAP fibrillin [Trichodesmium erythraeum IMS101]
Length=194

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K QL++   G NRGL AS     E++  I QLE K P P P E   LLN  W L YT+
Sbjct  4    KSQLIEILTGKNRGLLASKNDHEEILGAIAQLEEKNPHPHPLEKKELLNGNWRLLYTT  61



>ref|WP_008188169.1| fibrillin [Moorea producens]
 gb|EGJ30291.1| PAP fibrillin [Moorea producens 3L]
Length=194

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K +L+++  G NRGL AS   +  ++  +TQLE + PTP P EA  LL+  W L YT+
Sbjct  4    KAELLEAIAGKNRGLLASKTDKTAILAAVTQLEGRNPTPRPLEAQDLLDGNWRLLYTT  61



>ref|XP_008349368.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
Length=205

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  443  QLEAKXPTPAPTEALTLLNXKWVLAYTSF  529
            QLEAK PTPAPTEAL LLN KW+LAYTSF
Sbjct  12   QLEAKNPTPAPTEALPLLNGKWILAYTSF  40



>ref|WP_017287997.1| hypothetical protein [Leptolyngbya boryana]
Length=194

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+++  GTNRG+ AS   +  ++  I QLE + PTP P EA+ LL+  W L YT+
Sbjct  4    KAALLEAIAGTNRGILASESEKQAILAAIAQLEDRNPTPRPLEAIHLLDGDWRLIYTT  61



>gb|AAD38023.1|AF148219_1 fibrillin [Nostoc sp. PCC 8009]
Length=194

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+D+  GTNRGL A+ + +  ++  I +LE   PTP P EA  LL+  W L YT+
Sbjct  4    KSTLIDTIAGTNRGLLANEQQKQAILAAIARLEDLNPTPRPVEATNLLDGNWRLLYTT  61



>ref|WP_006194699.1| fibrillin [Nodularia spumigena]
 gb|EAW46709.1| fibrillin [Nodularia spumigena CCY9414]
 gb|AHJ28178.1| fibrillin [Nodularia spumigena CCY9414]
Length=194

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+D+  GTNRGL AS   +  ++  I  LE   PTP P EA  LL+  W L YTS
Sbjct  4    KANLIDAIAGTNRGLLASEPQKQAILAAIANLEDLNPTPRPLEASNLLDGDWRLIYTS  61



>ref|XP_009795803.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=220

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGL-SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            +K +L D+  G NRG+  ASS+ ++E+ EL+ QLE++ PTP PT +L  +   W L Y++
Sbjct  82   IKIELYDALQGINRGIFGASSDKKSEIEELVKQLESQNPTPEPTSSLDKVAGSWKLIYST  141

Query  527  F  529
             
Sbjct  142  I  142



>ref|WP_017653873.1| fibrillin [Microchaete sp. PCC 7126]
Length=194

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            ++K  L+++  GTNRGL ASS  +  ++  I  LE   PTP P EA  LL+  W L YT+
Sbjct  2    IMKVALLEAIAGTNRGLLASSAQKQAILAAIANLEDFNPTPRPVEAANLLDGNWRLIYTT  61



>ref|XP_006367874.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=154

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTE  481
            +KK L+D+ YGT+ GL AS E RAE +EL+ +LEA  PTP P E
Sbjct  111  MKKCLIDTVYGTDFGLRASFEVRAEALELVAKLEAANPTPNPVE  154



>ref|XP_009795804.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009795805.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic 
isoform X3 [Nicotiana sylvestris]
Length=220

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGL-SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            +K +L D+  G NRG+  ASS+ ++E+ EL+ QLE++ PTP PT +L  +   W L Y++
Sbjct  82   IKIELYDALQGINRGIFGASSDKKSEIEELVKQLESQNPTPEPTSSLDKVAGSWKLIYST  141

Query  527  F  529
             
Sbjct  142  I  142



>ref|WP_024546401.1| fibrillin [Synechococcus sp. NKBG15041c]
Length=196

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            LK  L+++  G NRGL A+   RA ++ L+ +LE + PTP P  A TLL   W L YT+
Sbjct  3    LKTNLLETIAGKNRGLIATEVDRANILTLVDRLEDQNPTPKPLAASTLLEGDWRLIYTT  61



>ref|WP_015142149.1| PAP fibrillin [Pleurocapsa minor]
 gb|AFY75841.1| PAP_fibrillin [Pleurocapsa sp. PCC 7327]
Length=196

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K +L+++  G NRGL A+   + +V+  I QLE + PTP P EA  LL   W L YT+
Sbjct  4    KAKLLEAIAGKNRGLLATERDKVKVLSAIEQLEDRNPTPKPVEAKNLLEGDWRLLYTT  61



>ref|XP_009589334.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=225

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGL-SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWV  511
            T+   +K +L D+  G NRG+  ASS+ + E+ EL+ QLE++ PTP PT +L  +   W 
Sbjct  82   TDASQIKIELYDALQGINRGIFGASSDKKTEIEELVKQLESQNPTPEPTLSLDKVAGNWK  141

Query  512  LAYTSF  529
            L Y++ 
Sbjct  142  LIYSTI  147



>ref|XP_009795802.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=271

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +2

Query  350  LKKQLVDSFYGTNRGL-SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            +K +L D+  G NRG+  ASS+ ++E+ EL+ QLE++ PTP PT +L  +   W L Y++
Sbjct  82   IKIELYDALQGINRGIFGASSDKKSEIEELVKQLESQNPTPEPTSSLDKVAGSWKLIYST  141



>ref|WP_041226434.1| fibrillin [Crinalium epipsammum]
Length=194

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K +L+++  G NRGL A+   +  ++  ++QLE + PTP P EAL LL   W L YTS
Sbjct  4    KAKLLEAIAGKNRGLLATEVDKQAILVAVSQLEERNPTPKPFEALDLLEGNWRLLYTS  61



>gb|AFZ12211.1| PAP fibrillin family protein [Crinalium epipsammum PCC 9333]
Length=193

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K +L+++  G NRGL A+   +  ++  ++QLE + PTP P EAL LL   W L YTS
Sbjct  3    KAKLLEAIAGKNRGLLATEVDKQAILVAVSQLEERNPTPKPFEALDLLEGNWRLLYTS  60



>ref|XP_009589333.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=276

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  TETDVLKKQLVDSFYGTNRGL-SASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWV  511
            T+   +K +L D+  G NRG+  ASS+ + E+ EL+ QLE++ PTP PT +L  +   W 
Sbjct  82   TDASQIKIELYDALQGINRGIFGASSDKKTEIEELVKQLESQNPTPEPTLSLDKVAGNWK  141

Query  512  LAYTSF  529
            L Y++ 
Sbjct  142  LIYSTI  147



>ref|WP_008050691.1| fibrillin [Arthrospira sp. PCC 8005]
 emb|CCE16425.1| fibrillin [Arthrospira sp. PCC 8005]
 emb|CDM95072.1| fibrillin [Arthrospira sp. PCC 8005]
Length=195

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+++  G NRGL A+   +  ++  I QLE   PTP P EAL LL+  W L YT+
Sbjct  4    KATLLEAIAGKNRGLLATESDKTAILSAIAQLEDYNPTPRPVEALELLDGNWRLLYTN  61



>ref|WP_006625760.1| MULTISPECIES: fibrillin [Arthrospira]
 gb|EDZ94887.1| PAP fibrillin family protein [Arthrospira maxima CS-328]
 gb|EKD06193.1| PAP fibrillin family protein [Arthrospira platensis C1]
Length=195

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+++  G NRGL A+   +  ++  I QLE   PTP P EAL LL+  W L YT+
Sbjct  4    KATLLEAIAGKNRGLLATESDKTAILSAIAQLEDYNPTPRPVEALELLDGNWRLLYTN  61



>ref|WP_017717779.1| fibrillin [Oscillatoria sp. PCC 10802]
Length=194

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+++  G NRGL A+   R  ++  + QLE + PTP P EA  LL+  W L YT+
Sbjct  4    KAALLEAIAGKNRGLLATETDRQAILSAVAQLEDRNPTPRPVEASELLDGDWRLVYTT  61



>ref|WP_015128015.1| PAP fibrillin family protein [Calothrix sp. PCC 7507]
 gb|AFY32198.1| PAP fibrillin family protein [Calothrix sp. PCC 7507]
Length=194

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K  L+D+  GTNRGL AS   +  ++  I  LE   PTP P EA  LL+  W L YT+
Sbjct  4    KVALLDAIAGTNRGLLASVAQKQAILAAIANLEDFNPTPRPVEATNLLDGNWRLIYTT  61



>ref|WP_013323346.1| fibrillin [Cyanothece sp. PCC 7822]
 gb|ADN15277.1| PAP fibrillin family protein [Cyanothece sp. PCC 7822]
Length=197

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKXPTPAPTEALTLLNXKWVLAYTS  526
            K +L++   G NRGL AS   R  V+  I QLE   PTP P EA  LL+  W L YT+
Sbjct  4    KTKLLEIIAGKNRGLLASEADRVRVLSAIEQLEDHNPTPNPLEAKDLLSGNWRLLYTT  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200