BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012K19

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007225494.1|  hypothetical protein PRUPE_ppa000919mg             157   8e-41   Prunus persica
ref|XP_008243808.1|  PREDICTED: nucleolar protein 14                    156   1e-40   Prunus mume [ume]
gb|KHG15298.1|  Nucleolar 14                                            150   2e-38   Gossypium arboreum [tree cotton]
emb|CDP00465.1|  unnamed protein product                                149   3e-38   Coffea canephora [robusta coffee]
gb|KJB78311.1|  hypothetical protein B456_012G185400                    146   1e-37   Gossypium raimondii
ref|XP_010650046.1|  PREDICTED: nucleolar protein 14                    147   3e-37   Vitis vinifera
ref|XP_009788579.1|  PREDICTED: nucleolar protein 14-like               137   5e-37   Nicotiana sylvestris
ref|XP_008389390.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    146   5e-37   
gb|KJB78310.1|  hypothetical protein B456_012G185400                    146   5e-37   Gossypium raimondii
ref|XP_010551353.1|  PREDICTED: nucleolar protein 14                    144   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_007045792.1|  Nop14, putative isoform 2                          144   4e-36   
ref|XP_007045791.1|  Nop14, putative isoform 1                          144   4e-36   
gb|KDP45433.1|  hypothetical protein JCGZ_09682                         143   5e-36   Jatropha curcas
ref|XP_010257952.1|  PREDICTED: nucleolar protein 14                    142   9e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009356445.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    142   1e-35   
ref|XP_010044381.1|  PREDICTED: nucleolar protein 14                    142   2e-35   Eucalyptus grandis [rose gum]
gb|KCW86470.1|  hypothetical protein EUGRSUZ_B03138                     141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_011462988.1|  PREDICTED: nucleolar protein 14 isoform X1         140   6e-35   Fragaria vesca subsp. vesca
ref|XP_004297213.1|  PREDICTED: nucleolar protein 14 isoform X2         140   6e-35   Fragaria vesca subsp. vesca
emb|CBI27323.3|  unnamed protein product                                139   1e-34   Vitis vinifera
ref|XP_006348659.1|  PREDICTED: nucleolar protein 14-like               139   2e-34   Solanum tuberosum [potatoes]
ref|XP_010320846.1|  PREDICTED: nucleolar protein 14 isoform X1         139   2e-34   Solanum lycopersicum
ref|XP_010091617.1|  hypothetical protein L484_026465                   138   4e-34   
ref|XP_009597551.1|  PREDICTED: nucleolar protein 14                    137   6e-34   Nicotiana tomentosiformis
ref|XP_004144162.1|  PREDICTED: nucleolar protein 14-like               137   1e-33   
ref|XP_004165503.1|  PREDICTED: nucleolar protein 14-like               137   1e-33   
gb|KGN47665.1|  hypothetical protein Csa_6G367110                       137   1e-33   Cucumis sativus [cucumbers]
ref|XP_008445434.1|  PREDICTED: nucleolar protein 14 isoform X2         136   1e-33   Cucumis melo [Oriental melon]
ref|XP_008445433.1|  PREDICTED: nucleolar protein 14 isoform X1         136   1e-33   Cucumis melo [Oriental melon]
gb|KFK41333.1|  hypothetical protein AALP_AA2G116500                    135   4e-33   Arabis alpina [alpine rockcress]
ref|XP_006484246.1|  PREDICTED: nucleolar protein 14-like               134   8e-33   Citrus sinensis [apfelsine]
ref|XP_011009745.1|  PREDICTED: nucleolar protein 14 isoform X1         134   9e-33   Populus euphratica
ref|XP_011009752.1|  PREDICTED: nucleolar protein 14 isoform X2         134   9e-33   Populus euphratica
ref|XP_011009760.1|  PREDICTED: nucleolar protein 14 isoform X3         134   9e-33   Populus euphratica
ref|XP_011009770.1|  PREDICTED: nucleolar protein 14 isoform X4         134   9e-33   Populus euphratica
ref|XP_011070910.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    134   1e-32   Sesamum indicum [beniseed]
ref|XP_006378528.1|  hypothetical protein POPTR_0010s15000g             132   1e-32   
ref|XP_003590488.1|  Nucleolar protein                                  124   1e-32   
ref|XP_002316014.2|  hypothetical protein POPTR_0010s15000g             132   4e-32   
ref|XP_006574503.1|  PREDICTED: nucleolar protein 14-like isoform X1    132   4e-32   Glycine max [soybeans]
ref|XP_010681128.1|  PREDICTED: nucleolar protein 14                    132   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006437873.1|  hypothetical protein CICLE_v10030646mg             131   7e-32   Citrus clementina [clementine]
gb|KHN00285.1|  Nucleolar protein 14                                    130   2e-31   Glycine soja [wild soybean]
emb|CDY62483.1|  BnaCnng40350D                                          129   2e-31   Brassica napus [oilseed rape]
ref|XP_008813616.1|  PREDICTED: nucleolar protein 14-like               124   3e-31   
gb|ACG60683.1|  unknown protein                                         129   6e-31   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_006588546.1|  PREDICTED: nucleolar protein 14-like               128   1e-30   Glycine max [soybeans]
emb|CDY65810.1|  BnaA02g35820D                                          128   1e-30   Brassica napus [oilseed rape]
ref|XP_009127702.1|  PREDICTED: nucleolar protein 14                    127   1e-30   Brassica rapa
ref|XP_006651582.1|  PREDICTED: nucleolar protein 14-like               127   2e-30   Oryza brachyantha
ref|XP_010932892.1|  PREDICTED: nucleolar protein 14 isoform X2         127   3e-30   Elaeis guineensis
ref|XP_010932890.1|  PREDICTED: nucleolar protein 14 isoform X1         127   3e-30   Elaeis guineensis
ref|XP_009402831.1|  PREDICTED: nucleolar protein 14                    126   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF27073.1|AC008262_22  F4N2.4                                       125   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177070.1|  uncharacterized protein                               125   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415534.1|  PREDICTED: nucleolar protein 14-like isoform X3    125   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010415532.1|  PREDICTED: nucleolar protein 14-like isoform X1    125   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010470881.1|  PREDICTED: nucleolar protein 14-like               125   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010511932.1|  PREDICTED: nucleolar protein 14-like               125   9e-30   Camelina sativa [gold-of-pleasure]
gb|KEH42219.1|  Nop14 nucleolar-like protein                            124   1e-29   Medicago truncatula
gb|AAN08225.2|  unknown protein                                         125   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97462.1|  Nop14-like family protein, expressed                    124   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006391059.1|  hypothetical protein EUTSA_v10018096mg             124   2e-29   Eutrema salsugineum [saltwater cress]
gb|KEH42220.1|  Nop14 nucleolar-like protein                            124   3e-29   Medicago truncatula
ref|NP_001050609.1|  Os03g0598200                                       122   1e-28   
gb|KEH41125.1|  Nop14 nucleolar-like protein                            122   2e-28   Medicago truncatula
ref|XP_007145864.1|  hypothetical protein PHAVU_007G274500g             121   3e-28   Phaseolus vulgaris [French bean]
ref|XP_002888698.1|  hypothetical protein ARALYDRAFT_339148             120   4e-28   Arabidopsis lyrata subsp. lyrata
gb|EEC75694.1|  hypothetical protein OsI_12505                          120   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010232878.1|  PREDICTED: nucleolar protein 14 isoform X1         119   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_010232881.1|  PREDICTED: nucleolar protein 14 isoform X2         119   2e-27   Brachypodium distachyon [annual false brome]
gb|EPS59451.1|  hypothetical protein M569_15356                         114   3e-27   Genlisea aurea
gb|EMT11619.1|  hypothetical protein F775_01391                         118   4e-27   
gb|EMS51472.1|  hypothetical protein TRIUR3_21500                       117   7e-27   Triticum urartu
ref|XP_004497865.1|  PREDICTED: nucleolar protein 14-like               116   2e-26   Cicer arietinum [garbanzo]
ref|XP_008665060.1|  PREDICTED: nucleolar protein 14 isoform X2         114   7e-26   Zea mays [maize]
ref|XP_008665059.1|  PREDICTED: nucleolar protein 14 isoform X1         114   7e-26   Zea mays [maize]
ref|XP_004982473.1|  PREDICTED: nucleolar protein 14-like               114   8e-26   Setaria italica
ref|XP_006300707.1|  hypothetical protein CARUB_v10019758mg             113   2e-25   Capsella rubella
ref|XP_002464264.1|  hypothetical protein SORBIDRAFT_01g015150          112   4e-25   Sorghum bicolor [broomcorn]
gb|EYU22573.1|  hypothetical protein MIMGU_mgv1a000929mg                109   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_009342326.1|  PREDICTED: nucleolar protein 14-like               103   4e-24   
gb|EAZ27697.1|  hypothetical protein OsJ_11647                          100   5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009342323.1|  PREDICTED: uncharacterized protein LOC103934295  96.7    2e-20   
ref|XP_001762011.1|  predicted protein                                95.1    3e-19   
gb|KDD73522.1|  Nop14-like family protein                             77.0    5e-14   Helicosporidium sp. ATCC 50920
ref|XP_005848097.1|  hypothetical protein CHLNCDRAFT_145376           77.4    2e-13   Chlorella variabilis
ref|XP_005652081.1|  Nop14-like protein                               75.5    2e-12   Coccomyxa subellipsoidea C-169
ref|XP_010764286.1|  PREDICTED: nucleolar protein 14-like             73.9    4e-12   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006104151.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  72.4    2e-11   Myotis lucifugus
dbj|BAC37700.1|  unnamed protein product                              68.9    2e-11   Mus musculus [mouse]
ref|XP_004368115.1|  Nop14 family protein                             71.6    3e-11   Acanthamoeba castellanii str. Neff
ref|XP_001420056.1|  predicted protein                                71.6    3e-11   Ostreococcus lucimarinus CCE9901
ref|XP_003965217.1|  PREDICTED: nucleolar protein 14-like             71.6    3e-11   
emb|CEF99253.1|  Nucleolar protein 14                                 71.2    4e-11   Ostreococcus tauri
ref|XP_005812725.1|  PREDICTED: nucleolar protein 14-like             70.9    5e-11   Xiphophorus maculatus
ref|XP_004383561.1|  PREDICTED: nucleolar protein 14                  70.9    6e-11   Trichechus manatus latirostris
ref|XP_001489859.1|  PREDICTED: nucleolar protein 14 isoform X1       70.9    6e-11   Equus caballus [domestic horse]
ref|XP_003455004.1|  PREDICTED: nucleolar protein 14                  70.5    7e-11   Oreochromis niloticus
ref|XP_004432293.1|  PREDICTED: nucleolar protein 14                  70.5    7e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008422663.1|  PREDICTED: nucleolar protein 14 isoform X1       70.5    7e-11   Poecilia reticulata
ref|XP_006830005.1|  hypothetical protein AMTR_s05743p00005480        65.9    7e-11   
ref|XP_008422664.1|  PREDICTED: nucleolar protein 14 isoform X2       70.5    7e-11   
ref|XP_007559019.1|  PREDICTED: nucleolar protein 14                  70.5    8e-11   Poecilia formosa
ref|XP_008324317.1|  PREDICTED: nucleolar protein 14                  70.1    8e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004396256.1|  PREDICTED: nucleolar protein 14                  70.1    9e-11   Odobenus rosmarus divergens
ref|XP_004715155.1|  PREDICTED: nucleolar protein 14                  70.1    1e-10   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004074632.1|  PREDICTED: nucleolar protein 14                  70.1    1e-10   Oryzias latipes [Japanese rice fish]
ref|XP_006893679.1|  PREDICTED: nucleolar protein 14                  69.7    1e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002946166.1|  hypothetical protein VOLCADRAFT_102784           70.1    1e-10   Volvox carteri f. nagariensis
ref|XP_005666568.1|  PREDICTED: nucleolar protein 14                  69.7    1e-10   
ref|XP_011401646.1|  Nucleolar protein 14                             69.3    1e-10   Auxenochlorella protothecoides
dbj|BAB27758.1|  unnamed protein product                              67.8    1e-10   Mus musculus [mouse]
ref|XP_010589643.1|  PREDICTED: nucleolar protein 14 isoform X3       69.3    2e-10   
ref|XP_009939212.1|  PREDICTED: nucleolar protein 14                  69.3    2e-10   Opisthocomus hoazin [hoatzin]
ref|XP_006789083.1|  PREDICTED: nucleolar protein 14-like             69.3    2e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002916607.1|  PREDICTED: nucleolar protein 14                  69.3    2e-10   Ailuropoda melanoleuca
ref|XP_004549661.1|  PREDICTED: nucleolar protein 14-like isoform X1  69.3    2e-10   
gb|ELK06562.1|  Nucleolar protein 14                                  69.3    2e-10   Pteropus alecto
ref|XP_005931265.1|  PREDICTED: nucleolar protein 14-like isoform X1  69.3    2e-10   Haplochromis burtoni
ref|XP_005720460.1|  PREDICTED: nucleolar protein 14-like isoform X1  69.3    2e-10   Pundamilia nyererei
ref|XP_008149121.1|  PREDICTED: nucleolar protein 14                  69.3    2e-10   Eptesicus fuscus
ref|XP_005016238.1|  PREDICTED: nucleolar protein 14 isoform X2       69.3    2e-10   
ref|XP_006751589.1|  PREDICTED: nucleolar protein 14-like             68.9    2e-10   
ref|XP_005016237.1|  PREDICTED: nucleolar protein 14 isoform X1       68.9    2e-10   Anas platyrhynchos [duck]
gb|ERE89773.1|  nucleolar protein 14                                  69.3    2e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_010740964.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  68.9    2e-10   
gb|KFR15697.1|  Nucleolar protein 14                                  68.9    2e-10   Opisthocomus hoazin [hoatzin]
ref|XP_011372092.1|  PREDICTED: nucleolar protein 14                  68.9    2e-10   Pteropus vampyrus
ref|XP_006919086.1|  PREDICTED: nucleolar protein 14                  68.9    2e-10   Pteropus alecto
ref|XP_005045555.1|  PREDICTED: nucleolar protein 14                  68.9    2e-10   Ficedula albicollis
ref|XP_008294954.1|  PREDICTED: nucleolar protein 14                  68.9    3e-10   Stegastes partitus
ref|XP_010589641.1|  PREDICTED: nucleolar protein 14 isoform X1       68.9    3e-10   Loxodonta africana [African bush elephant]
ref|NP_001099483.1|  nucleolar protein 14                             68.6    3e-10   Rattus norvegicus [brown rat]
gb|EDM00083.1|  similar to 2610033H07Rik protein (predicted), iso...  68.6    3e-10   Rattus norvegicus [brown rat]
ref|XP_003707475.1|  PREDICTED: uncharacterized protein LOC100883638  68.9    3e-10   Megachile rotundata
ref|XP_008919170.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   
ref|XP_003411301.1|  PREDICTED: nucleolar protein 14 isoform X2       68.6    3e-10   Loxodonta africana [African bush elephant]
ref|XP_007060093.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Chelonia mydas [green seaturtle]
ref|XP_010846260.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Bison bison bison
emb|CAN71710.1|  hypothetical protein VITISV_013457                   67.8    3e-10   Vitis vinifera
ref|XP_003773477.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Sarcophilus harrisii
ref|XP_005319061.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Ictidomys tridecemlineatus
ref|XP_010400302.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Corvus cornix cornix
ref|NP_001092466.1|  nucleolar protein 14                             68.6    3e-10   Bos taurus [bovine]
gb|KFW78478.1|  Nucleolar protein 14                                  68.6    3e-10   Manacus vitellinus
ref|XP_009097328.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Serinus canaria [canary]
ref|XP_008643293.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Corvus brachyrhynchos
ref|XP_006251254.1|  PREDICTED: nucleolar protein 14 isoform X1       68.6    3e-10   Rattus norvegicus [brown rat]
ref|XP_006074689.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Bubalus bubalis [domestic water buffalo]
ref|XP_005485746.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   
gb|KFO55257.1|  Nucleolar protein 14                                  68.6    3e-10   Corvus brachyrhynchos
ref|XP_006985628.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Peromyscus maniculatus bairdii
gb|EFB15587.1|  hypothetical protein PANDA_004689                     68.6    3e-10   Ailuropoda melanoleuca
ref|XP_005424788.1|  PREDICTED: nucleolar protein 14                  68.6    3e-10   Geospiza fortis
ref|XP_009910710.1|  PREDICTED: nucleolar protein 14 isoform X2       68.2    4e-10   Haliaeetus albicilla
ref|XP_010581824.1|  PREDICTED: nucleolar protein 14 isoform X2       68.2    4e-10   Haliaeetus leucocephalus
ref|XP_005208306.1|  PREDICTED: nucleolar protein 14 isoform X1       68.2    4e-10   Bos taurus [bovine]
ref|XP_005517935.1|  PREDICTED: nucleolar protein 14                  68.2    4e-10   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009910711.1|  PREDICTED: nucleolar protein 14 isoform X3       68.2    4e-10   Haliaeetus albicilla
dbj|BAE36550.1|  unnamed protein product                              68.2    4e-10   Mus musculus [mouse]
ref|XP_009991109.1|  PREDICTED: nucleolar protein 14                  68.2    4e-10   Tauraco erythrolophus
gb|EWM22059.1|  Nop14-like protein                                    68.2    4e-10   Nannochloropsis gaditana
ref|XP_010581823.1|  PREDICTED: nucleolar protein 14 isoform X1       68.2    4e-10   Haliaeetus leucocephalus
ref|XP_009910709.1|  PREDICTED: nucleolar protein 14 isoform X1       68.2    4e-10   Haliaeetus albicilla
gb|KFV07563.1|  Nucleolar protein 14                                  68.2    4e-10   Tauraco erythrolophus
gb|ERE89774.1|  nucleolar protein 14                                  68.2    4e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_006875374.1|  PREDICTED: nucleolar protein 14                  68.2    4e-10   Chrysochloris asiatica
ref|XP_004579437.1|  PREDICTED: nucleolar protein 14                  68.2    4e-10   Ochotona princeps [southern American pika]
ref|XP_006128328.1|  PREDICTED: nucleolar protein 14-like             64.7    4e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_003508887.1|  PREDICTED: nucleolar protein 14                  68.2    4e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_009477825.1|  PREDICTED: nucleolar protein 14                  68.2    4e-10   Pelecanus crispus
gb|EDL37464.1|  RIKEN cDNA 2610033H07, isoform CRA_b                  68.2    4e-10   Mus musculus [mouse]
ref|XP_005998250.1|  PREDICTED: nucleolar protein 14-like             68.2    4e-10   
gb|AAH24998.1|  NOP14 nucleolar protein homolog (yeast)               68.2    5e-10   Mus musculus [mouse]
ref|XP_005365968.1|  PREDICTED: nucleolar protein 14                  68.2    5e-10   Microtus ochrogaster [prairie voles]
ref|NP_083554.2|  nucleolar protein 14                                68.2    5e-10   Mus musculus [mouse]
ref|XP_003397298.1|  PREDICTED: nucleolar protein 14-like isoform 1   68.2    5e-10   Bombus terrestris [large earth bumblebee]
ref|XP_003490222.1|  PREDICTED: nucleolar protein 14-like             67.8    5e-10   Bombus impatiens
ref|XP_004999946.1|  PREDICTED: nucleolar protein 14 isoform X2       67.8    5e-10   
ref|XP_004656062.1|  PREDICTED: nucleolar protein 14                  67.8    5e-10   Jaculus jaculus
gb|KFQ50030.1|  Nucleolar protein 14                                  67.8    6e-10   Pelecanus crispus
ref|XP_010311187.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  67.8    6e-10   Balearica regulorum gibbericeps
ref|XP_003461905.1|  PREDICTED: nucleolar protein 14 isoform X1       67.8    6e-10   Cavia porcellus [guinea pig]
ref|XP_010957526.1|  PREDICTED: nucleolar protein 14                  67.8    6e-10   Camelus bactrianus [camel]
ref|XP_011309439.1|  PREDICTED: nucleolar protein 14 homolog          67.8    6e-10   Fopius arisanus
ref|XP_010995891.1|  PREDICTED: nucleolar protein 14                  67.8    6e-10   
ref|XP_536223.3|  PREDICTED: nucleolar protein 14                     67.8    6e-10   Canis lupus familiaris [dogs]
gb|KFO08067.1|  Nucleolar protein 14                                  67.4    7e-10   Balearica regulorum gibbericeps
ref|XP_005408814.1|  PREDICTED: nucleolar protein 14                  67.4    7e-10   Chinchilla lanigera
ref|XP_010170164.1|  PREDICTED: nucleolar protein 14-like             66.6    7e-10   Antrostomus carolinensis
ref|XP_010708784.1|  PREDICTED: nucleolar protein 14 isoform X2       67.4    7e-10   Meleagris gallopavo [common turkey]
ref|XP_001950397.2|  PREDICTED: nucleolar protein 14                  67.4    7e-10   Acyrthosiphon pisum
ref|XP_010708783.1|  PREDICTED: nucleolar protein 14 isoform X1       67.4    7e-10   Meleagris gallopavo [common turkey]
ref|XP_010891122.1|  PREDICTED: nucleolar protein 14                  67.4    7e-10   Esox lucius
ref|XP_420824.2|  PREDICTED: nucleolar protein 14                     67.4    8e-10   Gallus gallus [bantam]
ref|XP_010147382.1|  PREDICTED: nucleolar protein 14                  67.4    8e-10   Eurypyga helias
ref|XP_009283658.1|  PREDICTED: nucleolar protein 14                  67.4    8e-10   Aptenodytes forsteri
ref|XP_005229872.1|  PREDICTED: nucleolar protein 14                  67.4    8e-10   Falco peregrinus [peregrine]
ref|XP_005446467.1|  PREDICTED: nucleolar protein 14                  67.4    8e-10   Falco cherrug
ref|XP_004847426.1|  PREDICTED: nucleolar protein 14                  67.4    9e-10   
ref|XP_004890977.1|  PREDICTED: nucleolar protein 14                  67.0    9e-10   
ref|XP_003801185.1|  PREDICTED: nucleolar protein 14                  67.0    9e-10   Otolemur garnettii
gb|KFP54466.1|  Nucleolar protein 14                                  66.6    9e-10   Cathartes aura
ref|XP_010294100.1|  PREDICTED: nucleolar protein 14                  67.0    9e-10   Phaethon lepturus
ref|XP_009579844.1|  PREDICTED: nucleolar protein 14                  67.0    9e-10   Fulmarus glacialis
ref|XP_009684460.1|  PREDICTED: nucleolar protein 14                  67.0    9e-10   Struthio camelus australis
gb|KFM11679.1|  Nucleolar protein 14                                  67.0    9e-10   Aptenodytes forsteri
gb|EHB06980.1|  Nucleolar protein 14                                  67.0    9e-10   Heterocephalus glaber [naked mole rat]
gb|KFQ80497.1|  Nucleolar protein 14                                  67.0    1e-09   Phoenicopterus ruber ruber
gb|KFZ63660.1|  Nucleolar protein 14                                  67.0    1e-09   Podiceps cristatus
gb|KFW02882.1|  Nucleolar protein 14                                  67.0    1e-09   Eurypyga helias
ref|XP_010071422.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Pterocles gutturalis
ref|XP_009699167.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Cariama cristata
ref|XP_009888816.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Charadrius vociferus
ref|XP_010139826.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Buceros rhinoceros silvestris
ref|XP_009814608.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Gavia stellata
ref|XP_005148574.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Melopsittacus undulatus
ref|XP_009864225.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Apaloderma vittatum
ref|XP_007496879.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Monodelphis domestica
gb|KFV44585.1|  Nucleolar protein 14                                  67.0    1e-09   Gavia stellata
ref|XP_009641499.1|  PREDICTED: nucleolar protein 14                  67.0    1e-09   Egretta garzetta
gb|KFV94056.1|  Nucleolar protein 14                                  67.0    1e-09   Fulmarus glacialis
gb|KGL97661.1|  Nucleolar protein 14                                  67.0    1e-09   Charadrius vociferus
gb|KFQ64808.1|  Nucleolar protein 14                                  67.0    1e-09   Phaethon lepturus
gb|KFO93083.1|  Nucleolar protein 14                                  67.0    1e-09   Buceros rhinoceros silvestris
gb|KFP99075.1|  Nucleolar protein 14                                  67.0    1e-09   Haliaeetus albicilla
gb|KFP85499.1|  Nucleolar protein 14                                  67.0    1e-09   Apaloderma vittatum
gb|KFP65386.1|  Nucleolar protein 14                                  67.0    1e-09   Cariama cristata
gb|KFP19579.1|  Nucleolar protein 14                                  67.0    1e-09   Egretta garzetta
gb|KFV06576.1|  Nucleolar protein 14                                  67.0    1e-09   Pterocles gutturalis
ref|XP_001696589.1|  nucleolar protein                                67.0    1e-09   Chlamydomonas reinhardtii
ref|XP_008946378.1|  PREDICTED: nucleolar protein 14                  66.6    1e-09   Merops nubicus
ref|XP_001640799.1|  predicted protein                                66.6    1e-09   Nematostella vectensis
gb|KFV87026.1|  Nucleolar protein 14                                  66.6    1e-09   Struthio camelus australis
ref|XP_004772310.1|  PREDICTED: nucleolar protein 14                  66.6    1e-09   Mustela putorius furo [black ferret]
gb|KFQ21413.1|  Nucleolar protein 14                                  66.6    1e-09   Merops nubicus
ref|XP_004481101.1|  PREDICTED: nucleolar protein 14                  66.6    1e-09   
ref|XP_002195362.1|  PREDICTED: nucleolar protein 14                  66.6    1e-09   
emb|CDQ79313.1|  unnamed protein product                              66.2    1e-09   Oncorhynchus mykiss
ref|XP_009469430.1|  PREDICTED: nucleolar protein 14                  66.6    1e-09   Nipponia nippon
ref|XP_010640058.1|  PREDICTED: nucleolar protein 14 isoform X2       66.6    1e-09   Fukomys damarensis [Damara mole rat]
ref|XP_010640057.1|  PREDICTED: nucleolar protein 14 isoform X1       66.6    1e-09   Fukomys damarensis [Damara mole rat]
ref|XP_005498506.1|  PREDICTED: nucleolar protein 14                  66.6    1e-09   Columba livia [carrier pigeon]
ref|XP_010008419.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Nestor notabilis
ref|XP_006152995.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Tupaia chinensis
gb|KFR03907.1|  Nucleolar protein 14                                  66.2    2e-09   Nipponia nippon
gb|ELW62764.1|  Nucleolar protein 14                                  66.2    2e-09   Tupaia chinensis
ref|XP_009957226.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Leptosomus discolor
ref|XP_009998569.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Chaetura pelagica
ref|XP_004624659.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Octodon degus
ref|XP_004321775.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   
ref|XP_010210825.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Tinamus guttatus
gb|KFQ15985.1|  Nucleolar protein 14                                  66.2    2e-09   Leptosomus discolor
ref|XP_007471693.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Lipotes vexillifer [baiji]
gb|KFQ46286.1|  Nucleolar protein 14                                  66.2    2e-09   Nestor notabilis
ref|XP_004265214.1|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Orcinus orca [Orca]
ref|XP_003985596.2|  PREDICTED: nucleolar protein 14                  66.2    2e-09   Felis catus [cat]
ref|XP_002517429.1|  nop14, putative                                  66.2    2e-09   
gb|KGL75833.1|  Nucleolar protein 14                                  66.2    2e-09   Tinamus guttatus
ref|XP_010187452.1|  PREDICTED: nucleolar protein 14                  65.9    2e-09   Mesitornis unicolor
ref|XP_010119845.1|  PREDICTED: nucleolar protein 14                  65.9    2e-09   Chlamydotis macqueenii
ref|XP_009908384.1|  PREDICTED: nucleolar protein 14                  65.9    2e-09   Picoides pubescens
ref|XP_009972232.1|  PREDICTED: nucleolar protein 14                  65.9    2e-09   Tyto alba [Schleiereule]
gb|KFP36334.1|  Nucleolar protein 14                                  65.9    3e-09   Chlamydotis macqueenii
ref|XP_002416603.1|  nop14, putative                                  65.9    3e-09   
gb|KFV59916.1|  Nucleolar protein 14                                  65.9    3e-09   Tyto alba [Schleiereule]
gb|KFV62620.1|  Nucleolar protein 14                                  65.9    3e-09   Picoides pubescens
ref|XP_007951708.1|  PREDICTED: nucleolar protein 14                  65.5    3e-09   Orycteropus afer afer
gb|KFQ38938.1|  Nucleolar protein 14                                  65.5    3e-09   Mesitornis unicolor
ref|XP_004038394.1|  PREDICTED: nucleolar protein 14                  65.5    3e-09   
ref|XP_008840089.1|  PREDICTED: nucleolar protein 14                  65.5    3e-09   Nannospalax galili
ref|XP_008500049.1|  PREDICTED: nucleolar protein 14                  65.5    3e-09   Calypte anna
gb|KFP07037.1|  Nucleolar protein 14                                  65.5    3e-09   Calypte anna
ref|XP_011255430.1|  PREDICTED: nucleolar protein 14 homolog          65.5    3e-09   
ref|XP_004617520.1|  PREDICTED: nucleolar protein 14                  65.5    3e-09   Sorex araneus [Eurasian shrew]
ref|NP_001133389.1|  nucleolar protein 14                             65.5    3e-09   Salmo salar
ref|XP_009327089.1|  PREDICTED: nucleolar protein 14                  65.5    3e-09   Pygoscelis adeliae
gb|KFW70458.1|  Nucleolar protein 14                                  65.1    4e-09   Pygoscelis adeliae
ref|XP_005304137.1|  PREDICTED: nucleolar protein 14 isoform X2       65.1    4e-09   
ref|XP_009562940.1|  PREDICTED: nucleolar protein 14                  65.1    4e-09   
ref|XP_005304136.1|  PREDICTED: nucleolar protein 14 isoform X1       65.1    4e-09   
gb|KFO78931.1|  Nucleolar protein 14                                  65.1    4e-09   
ref|XP_011151994.1|  PREDICTED: nucleolar protein 14 homolog          65.1    4e-09   
ref|XP_974875.1|  PREDICTED: nucleolar protein 14 homolog             64.7    5e-09   
ref|XP_001606853.2|  PREDICTED: nucleolar protein 14 homolog          64.7    5e-09   
ref|XP_011505256.1|  PREDICTED: nucleolar protein 14 homolog          64.3    7e-09   
ref|XP_002591575.1|  hypothetical protein BRAFLDRAFT_131025           64.3    7e-09   
ref|XP_003890919.1|  PREDICTED: nucleolar protein 14                  64.3    8e-09   
ref|XP_002161686.2|  PREDICTED: nucleolar protein 14-like             63.5    9e-09   
ref|XP_009070648.1|  PREDICTED: nucleolar protein 14                  63.9    1e-08   
ref|XP_397160.3|  PREDICTED: nucleolar protein 14 homolog isoform X2  63.9    1e-08   
ref|XP_006557364.1|  PREDICTED: nucleolar protein 14 homolog isof...  63.9    1e-08   
ref|XP_008053974.1|  PREDICTED: nucleolar protein 14                  63.5    1e-08   
gb|KFP70051.1|  Nucleolar protein 14                                  63.5    1e-08   
ref|XP_011161923.1|  PREDICTED: nucleolar protein 14 homolog          63.5    2e-08   
ref|XP_003692539.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  63.2    2e-08   
ref|XP_008963753.1|  PREDICTED: nucleolar protein 14 isoform X2       63.2    2e-08   
ref|NP_001278908.1|  nucleolar protein 14 isoform 2                   63.2    2e-08   
gb|EAW82490.1|  chromosome 4 open reading frame 9, isoform CRA_b      63.2    2e-08   
ref|XP_008991938.1|  PREDICTED: nucleolar protein 14 isoform X5       63.2    2e-08   
gb|EAW82493.1|  chromosome 4 open reading frame 9, isoform CRA_c      63.2    2e-08   
ref|XP_007172352.1|  PREDICTED: nucleolar protein 14                  63.2    2e-08   
ref|XP_526506.3|  PREDICTED: nucleolar protein 14 isoform X2          63.2    2e-08   
ref|XP_005554397.1|  PREDICTED: nucleolar protein 14                  62.8    2e-08   
gb|EHH14174.1|  Nucleolar complex protein 14                          62.8    2e-08   
dbj|BAF85628.1|  unnamed protein product                              62.8    2e-08   
ref|XP_003813002.1|  PREDICTED: nucleolar protein 14 isoform X1       62.8    2e-08   
ref|XP_008016255.1|  PREDICTED: nucleolar protein 14 isoform X1       62.8    2e-08   
gb|EAW82489.1|  chromosome 4 open reading frame 9, isoform CRA_a      62.8    2e-08   
gb|EHH49415.1|  Nucleolar complex protein 14                          62.8    2e-08   
ref|XP_008550367.1|  PREDICTED: nucleolar protein 14 homolog          62.8    2e-08   
gb|AAB97011.1|  unknown protein IT12                                  62.8    2e-08   
ref|XP_003934684.1|  PREDICTED: nucleolar protein 14                  62.8    2e-08   
ref|NP_003694.1|  nucleolar protein 14 isoform 1                      62.8    2e-08   
ref|XP_009445537.1|  PREDICTED: nucleolar protein 14 isoform X1       62.8    2e-08   
ref|XP_008991935.1|  PREDICTED: nucleolar protein 14 isoform X2       62.8    2e-08   
gb|KDR08721.1|  Nucleolar protein 14                                  62.8    2e-08   
ref|XP_002814567.1|  PREDICTED: nucleolar protein 14                  62.8    2e-08   
ref|XP_008991934.1|  PREDICTED: nucleolar protein 14 isoform X1       62.8    2e-08   
ref|XP_010382694.1|  PREDICTED: nucleolar protein 14                  62.8    3e-08   
ref|XP_008991937.1|  PREDICTED: nucleolar protein 14 isoform X4       62.8    3e-08   
ref|XP_008991936.1|  PREDICTED: nucleolar protein 14 isoform X3       62.8    3e-08   
ref|XP_011334425.1|  PREDICTED: nucleolar protein 14 homolog          62.4    3e-08   
ref|XP_006619322.1|  PREDICTED: nucleolar protein 14 homolog          62.4    3e-08   
ref|XP_011059434.1|  PREDICTED: nucleolar protein 14 homolog          62.4    4e-08   
ref|XP_001742471.1|  hypothetical protein                             62.0    4e-08   
ref|XP_006627260.1|  PREDICTED: nucleolar protein 14-like             62.0    4e-08   
ref|XP_006856350.1|  hypothetical protein AMTR_s00047p00175730        61.6    5e-08   
ref|XP_003221442.1|  PREDICTED: nucleolar protein 14                  61.6    5e-08   
ref|XP_007903452.1|  PREDICTED: nucleolar protein 14                  61.6    6e-08   
ref|XP_008576198.1|  PREDICTED: nucleolar protein 14                  61.6    6e-08   
ref|XP_007538946.1|  PREDICTED: nucleolar protein 14                  61.2    7e-08   
gb|ERL94557.1|  hypothetical protein D910_11834                       60.1    7e-08   
ref|NP_001003831.1|  nucleolar protein 14                             61.2    8e-08   
gb|AAH85643.1|  NOP14 nucleolar protein homolog (yeast)               61.2    8e-08   
ref|XP_004933016.1|  PREDICTED: nucleolar protein 14 homolog          60.8    1e-07   
gb|EFX71868.1|  hypothetical protein DAPPUDRAFT_308709                60.5    1e-07   
ref|XP_006262702.1|  PREDICTED: nucleolar protein 14                  60.1    2e-07   
ref|XP_006032396.1|  PREDICTED: nucleolar protein 14                  59.7    2e-07   
ref|XP_004360518.1|  U3 snoRNP protein                                59.3    3e-07   
ref|XP_002742430.1|  PREDICTED: nucleolar protein 14-like             59.3    3e-07   
gb|KFW93764.1|  Nucleolar protein 14                                  58.9    4e-07   
ref|XP_009508062.1|  PREDICTED: nucleolar protein 14                  58.9    4e-07   
ref|NP_001085573.1|  NOP14 nucleolar protein                          56.2    5e-07   
ref|XP_011455688.1|  PREDICTED: nucleolar protein 14-like             58.5    5e-07   
gb|EKC24857.1|  Nucleolar protein 14                                  58.5    5e-07   
emb|CCA14999.1|  nucleolar protein putative                           58.5    5e-07   
ref|XP_011403902.1|  PREDICTED: nucleolar protein 14-like             58.5    5e-07   
ref|XP_002504349.1|  predicted protein                                58.2    6e-07   
ref|XP_008248077.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  58.2    8e-07   
gb|ESA07668.1|  hypothetical protein GLOINDRAFT_349395                57.8    8e-07   
gb|EHJ68507.1|  hypothetical protein KGM_09100                        57.8    9e-07   
ref|XP_001201966.2|  PREDICTED: nucleolar protein 14-like             57.4    1e-06   
gb|KDO27185.1|  hypothetical protein SPRG_07434                       57.4    1e-06   
ref|XP_008608121.1|  hypothetical protein SDRG_04235                  57.4    1e-06   
ref|XP_784009.3|  PREDICTED: nucleolar protein 14-like                57.4    1e-06   
ref|XP_009052365.1|  hypothetical protein LOTGIDRAFT_115358           57.4    1e-06   
gb|EXX58796.1|  Nop14p                                                57.4    1e-06   
gb|EXX58795.1|  Nop14p                                                57.4    1e-06   
ref|XP_002939267.2|  PREDICTED: nucleolar protein 14                  57.0    2e-06   
ref|XP_003492888.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  56.6    2e-06   
emb|CCI50370.1|  unnamed protein product                              56.2    3e-06   
gb|EJU06534.1|  Nop14-like protein                                    56.2    3e-06   
gb|AAH64200.1|  LOC394902 protein                                     55.8    3e-06   
ref|XP_009495650.1|  hypothetical protein H696_03508                  55.8    4e-06   
gb|KFH69990.1|  hypothetical protein MVEG_04793                       55.8    4e-06   
ref|XP_003742455.1|  PREDICTED: nucleolar protein 14-like             55.5    5e-06   
ref|XP_003284802.1|  hypothetical protein DICPUDRAFT_148604           55.5    5e-06   
emb|CCA75627.1|  related to NOP14-nuclear and nucleolar protein w...  52.8    1e-05   
emb|CDJ89567.1|  Nop14 protein domain containing protein              54.3    1e-05   
gb|EFA74997.1|  U3 snoRNP protein                                     54.3    1e-05   
ref|XP_637176.1|  U3 snoRNP protein                                   54.3    1e-05   
gb|KDQ08229.1|  hypothetical protein BOTBODRAFT_118835                53.9    1e-05   
gb|ELT93562.1|  hypothetical protein CAPTEDRAFT_227046                53.9    2e-05   
emb|CEI92865.1|  hypothetical protein RMCBS344292_07113               53.5    2e-05   
emb|CEG64233.1|  hypothetical protein RMATCC62417_01246               53.5    2e-05   
ref|XP_011194287.1|  PREDICTED: nucleolar protein 14 homolog          53.1    3e-05   
gb|EUC56175.1|  Nop14 family protein                                  53.1    3e-05   
gb|KEP53049.1|  Nop14 family protein                                  53.1    3e-05   
gb|EPZ30988.1|  Nucleolar protein 14 domain-containing protein        52.8    3e-05   
ref|XP_004536581.1|  PREDICTED: nucleolar protein 14 homolog          52.8    4e-05   
gb|KIH49859.1|  hypothetical protein ANCDUO_20065                     51.6    4e-05   
ref|XP_005112713.1|  PREDICTED: nucleolar protein 14-like isoform X1  52.0    6e-05   
ref|XP_001994896.1|  GH17488                                          52.0    6e-05   
emb|CDJ82379.1|  Nop14 protein domain containing protein              52.0    6e-05   
gb|EIE77069.1|  hypothetical protein RO3G_01773                       51.6    9e-05   
dbj|GAA97776.1|  hypothetical protein E5Q_04455                       51.6    1e-04   
ref|XP_001851100.1|  nop14                                            51.2    1e-04   
ref|XP_007365055.1|  Nop14-like protein                               51.2    1e-04   
ref|XP_011214231.1|  PREDICTED: nucleolar protein 14 homolog          51.2    1e-04   
emb|CDI52240.1|  nop14-like protein                                   50.4    2e-04   
ref|XP_008035521.1|  Nop14-like protein                               50.4    2e-04   
ref|XP_002128116.1|  PREDICTED: nucleolar protein 14-like             50.4    2e-04   
emb|CCF54515.1|  related to NOP14-nuclear and nucleolar protein w...  50.4    2e-04   
ref|XP_002054416.1|  GJ22818                                          50.4    2e-04   
ref|XP_003064853.1|  predicted protein                                50.4    3e-04   
gb|KIM76408.1|  hypothetical protein PILCRDRAFT_826416                50.1    3e-04   
ref|XP_005175928.1|  PREDICTED: nucleolar protein 14 homolog          50.1    3e-04   
ref|XP_011387223.1|  hypothetical protein UMAG_01310                  50.1    3e-04   
ref|XP_004345026.1|  hypothetical protein CAOG_06277                  50.1    3e-04   
ref|XP_007268627.1|  Nop14-like protein                               50.1    3e-04   
emb|CCO30039.1|  putative nucleolar complex protein 14                49.7    3e-04   
emb|CEL59285.1|  putative nucleolar complex protein 14 OS=Schizos...  49.7    4e-04   
emb|CBQ70722.1|  related to NOP14-nuclear and nucleolar protein w...  49.3    4e-04   
emb|CDH56927.1|  nop14-like protein                                   49.3    5e-04   
gb|EPB82072.1|  hypothetical protein HMPREF1544_11200                 48.9    7e-04   
dbj|GAN00582.1|  nop14-like protein                                   48.9    7e-04   
gb|EST06112.1|  hypothetical protein PSEUBRA_SCAF3g03607              48.9    7e-04   
emb|CCU97730.1|  unnamed protein product                              48.9    7e-04   
emb|CBJ25573.1|  similar to RIKEN cDNA 2610033H07                     48.9    8e-04   
dbj|GAC96934.1|  potential small subunit rRNA processome component    48.5    8e-04   
ref|XP_003036590.1|  hypothetical protein SCHCODRAFT_80297            48.5    8e-04   
gb|KIL70330.1|  hypothetical protein M378DRAFT_183871                 48.5    9e-04   



>ref|XP_007225494.1| hypothetical protein PRUPE_ppa000919mg [Prunus persica]
 gb|EMJ26693.1| hypothetical protein PRUPE_ppa000919mg [Prunus persica]
Length=962

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP +I MKL+AP PNPFE IWSRRKFDILGKKRKGEERRIGL+RS AIEKRKNTLLKEYE
Sbjct  58   GPSSIAMKLQAPKPNPFETIWSRRKFDILGKKRKGEERRIGLSRSHAIEKRKNTLLKEYE  117

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            QS KSSVFVDKRIGE N+EL EFDKAI RSQRER  K  KKSKYNLSDGEE
Sbjct  118  QSNKSSVFVDKRIGEHNDELDEFDKAIRRSQRERLSKQNKKSKYNLSDGEE  168



>ref|XP_008243808.1| PREDICTED: nucleolar protein 14 [Prunus mume]
Length=966

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP +I MKL+AP PNPFE IWSRRKFDILGKKRKGEERRIGL+RS AIEKRKNTLLKEYE
Sbjct  58   GPSSIAMKLQAPKPNPFETIWSRRKFDILGKKRKGEERRIGLSRSRAIEKRKNTLLKEYE  117

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            QS KSSVFVDKRIGE N+EL EFDKAI RSQRER  K  KKSKYNLSDGEE
Sbjct  118  QSNKSSVFVDKRIGEHNDELDEFDKAIRRSQRERLSKQNKKSKYNLSDGEE  168



>gb|KHG15298.1| Nucleolar 14 [Gossypium arboreum]
Length=945

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P AI MKLK+  PNPFE IWSRRKFDILGKKRKGEERRIGLARSLAI+KRK TLLKEYEQ
Sbjct  25   PDAISMKLKSQKPNPFETIWSRRKFDILGKKRKGEERRIGLARSLAIQKRKKTLLKEYEQ  84

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            S KSSVFVDKRIGEQN+++GEF+K ILRSQRER+LKL+K+SK+NLSDGEE
Sbjct  85   STKSSVFVDKRIGEQNDDMGEFEKGILRSQRERQLKLRKRSKFNLSDGEE  134



>emb|CDP00465.1| unnamed protein product [Coffea canephora]
Length=906

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  191  MKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            MK KAP PNPFE IWSRRKFDILGKKRKGE+RRIGLARSLAIEKRK TLLKEYEQS KSS
Sbjct  1    MKQKAPQPNPFETIWSRRKFDILGKKRKGEQRRIGLARSLAIEKRKKTLLKEYEQSGKSS  60

Query  371  VFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            VF+DKRIGEQNE LGEFDKAI+RSQRER+LKL KKSKYNLSDGEE
Sbjct  61   VFLDKRIGEQNELLGEFDKAIMRSQRERQLKLSKKSKYNLSDGEE  105



>gb|KJB78311.1| hypothetical protein B456_012G185400 [Gossypium raimondii]
Length=693

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P  I MKLK+  PNPFE IWSRRKFDILGKKRKGEERRIG ARSLAI+KRK TLLKEYEQ
Sbjct  25   PDVISMKLKSQKPNPFETIWSRRKFDILGKKRKGEERRIGRARSLAIQKRKKTLLKEYEQ  84

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAI  433
            S KSSVFVDKRIGEQN++LGEF+K I
Sbjct  85   STKSSVFVDKRIGEQNDDLGEFEKGI  110



>ref|XP_010650046.1| PREDICTED: nucleolar protein 14 [Vitis vinifera]
Length=959

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  170  SGPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            S P ++ MKLKAP  NPFE IWSR KFDILGKKRKGE++RIGLARS AI+KR  TLLKEY
Sbjct  25   SAPNSVAMKLKAPQSNPFETIWSRTKFDILGKKRKGEQKRIGLARSRAIQKRNATLLKEY  84

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQSAKSSVF+DKRIGEQN+ LGEFDKAILRSQRER+LKLKKKSKYNLSDGEE
Sbjct  85   EQSAKSSVFLDKRIGEQNDALGEFDKAILRSQRERQLKLKKKSKYNLSDGEE  136



>ref|XP_009788579.1| PREDICTED: nucleolar protein 14-like [Nicotiana sylvestris]
Length=173

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPA--PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GPK   MK KA A   NPFE IWSRRKFDILGKKRKGEERRIG ARS AIEKRK TLLKE
Sbjct  26   GPKLKDMKHKAAAKKENPFETIWSRRKFDILGKKRKGEERRIGEARSSAIEKRKKTLLKE  85

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQSAKSS+FVDKRIGE +E LGEFDKAI
Sbjct  86   YEQSAKSSIFVDKRIGENDEGLGEFDKAI  114



>ref|XP_008389390.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14-like [Malus 
domestica]
Length=921

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A+ MK + P  PNPFE IWSRRKFDILGKKRKGEERR+GL+RS AIEKRKNTLL+EY
Sbjct  49   GPNAVAMKHQXPLKPNPFETIWSRRKFDILGKKRKGEERRVGLSRSRAIEKRKNTLLREY  108

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQS K+SVFVDKRIGE N+EL EFDKAI R+QRE +LK  KK KYNLSDGEE
Sbjct  109  EQSNKASVFVDKRIGEHNDELNEFDKAIXRAQREHQLKTNKKGKYNLSDGEE  160



>gb|KJB78310.1| hypothetical protein B456_012G185400 [Gossypium raimondii]
Length=945

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P  I MKLK+  PNPFE IWSRRKFDILGKKRKGEERRIG ARSLAI+KRK TLLKEYEQ
Sbjct  25   PDVISMKLKSQKPNPFETIWSRRKFDILGKKRKGEERRIGRARSLAIQKRKKTLLKEYEQ  84

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAI  433
            S KSSVFVDKRIGEQN++LGEF+K I
Sbjct  85   STKSSVFVDKRIGEQNDDLGEFEKGI  110



>ref|XP_010551353.1| PREDICTED: nucleolar protein 14 [Tarenaya hassleriana]
Length=947

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +2

Query  170  SGPKAIGMKLKA-PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            +GP+A+ MK KA  A NPFE+IWSRRKFDILGKKRKGEERR+GLARS A+EKR+ TLLKE
Sbjct  19   TGPEAVAMKAKALKAENPFESIWSRRKFDILGKKRKGEERRVGLARSRAVEKRQKTLLKE  78

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQS KSSVFVDKRIGEQN+ELGEFDK I
Sbjct  79   YEQSLKSSVFVDKRIGEQNDELGEFDKGI  107



>ref|XP_007045792.1| Nop14, putative isoform 2 [Theobroma cacao]
 gb|EOY01624.1| Nop14, putative isoform 2 [Theobroma cacao]
Length=984

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P AI MKLKA   NPFE IWSRRKFDILGKKRKGEE RIGL+RSLAI+KRK TLLKEYEQ
Sbjct  67   PDAISMKLKAEKSNPFETIWSRRKFDILGKKRKGEELRIGLSRSLAIQKRKKTLLKEYEQ  126

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAI  433
            S KSSVFVD RIGEQN+ELGEF+K I
Sbjct  127  STKSSVFVDNRIGEQNDELGEFEKGI  152



>ref|XP_007045791.1| Nop14, putative isoform 1 [Theobroma cacao]
 gb|EOY01623.1| Nop14, putative isoform 1 [Theobroma cacao]
Length=983

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P AI MKLKA   NPFE IWSRRKFDILGKKRKGEE RIGL+RSLAI+KRK TLLKEYEQ
Sbjct  67   PDAISMKLKAEKSNPFETIWSRRKFDILGKKRKGEELRIGLSRSLAIQKRKKTLLKEYEQ  126

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAI  433
            S KSSVFVD RIGEQN+ELGEF+K I
Sbjct  127  STKSSVFVDNRIGEQNDELGEFEKGI  152



>gb|KDP45433.1| hypothetical protein JCGZ_09682 [Jatropha curcas]
Length=959

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = +2

Query  170  SGPKAIGMKLKA-PAPNPFEAIWSRRKFDILGKKR-KGEERRIGLARSLAIEKRKNTLLK  343
            SGP A+ MK+K  P  NPFE IWSRRKFDILGKK+ KGEERRIGLARSLAI+KRK TLLK
Sbjct  24   SGPNAVAMKVKTTPKDNPFETIWSRRKFDILGKKKGKGEERRIGLARSLAIDKRKKTLLK  83

Query  344  EYEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EYEQS K+SVF+DKRIGE+N+ELGEFDKAI+RSQRE +LK+ KKSKYNLSDGEE
Sbjct  84   EYEQSGKASVFIDKRIGEKNDELGEFDKAIMRSQREHQLKIGKKSKYNLSDGEE  137



>ref|XP_010257952.1| PREDICTED: nucleolar protein 14 [Nelumbo nucifera]
Length=947

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP A+ MK K    NPFE IWSRRKFDILGKKRKGEE+R+GLARS AIEKRK TLLKEYE
Sbjct  31   GPNAMAMKSKPANENPFETIWSRRKFDILGKKRKGEEKRVGLARSRAIEKRKKTLLKEYE  90

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            QS KSSVF+DKRIGEQN+ LGEFDKAILRSQ ER+LKL+K SKYNLSDGEE
Sbjct  91   QSGKSSVFLDKRIGEQNDALGEFDKAILRSQHERKLKLRKSSKYNLSDGEE  141



>ref|XP_009356445.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Pyrus x 
bretschneideri]
Length=934

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A+ MK +AP  PNPFE I SRRKF+ILGKKRKGEERR+GL+RS AIEKRKNTLLKEY
Sbjct  49   GPNAVAMKHQAPLKPNPFETIXSRRKFNILGKKRKGEERRVGLSRSRAIEKRKNTLLKEY  108

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQS K+SVFVDKRIGE N+EL EFDKAI R+QRE +LK  KKSKYNLSDGEE
Sbjct  109  EQSNKASVFVDKRIGEHNDELNEFDKAIRRAQREHQLKTNKKSKYNLSDGEE  160



>ref|XP_010044381.1| PREDICTED: nucleolar protein 14 [Eucalyptus grandis]
Length=956

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P A+ MK KAP PNPFE IWSRRKFDILGKKRKGEERR+GLARS AIEKRKNTLLKEYEQ
Sbjct  27   PDAVAMKTKAPKPNPFETIWSRRKFDILGKKRKGEERRVGLARSRAIEKRKNTLLKEYEQ  86

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
              K+SVFVDKRIGE  E + EF+KAILRSQRE +LKL KKSKYNLSDGEE
Sbjct  87   GGKASVFVDKRIGEDKEGMEEFEKAILRSQREYKLKLNKKSKYNLSDGEE  136



>gb|KCW86470.1| hypothetical protein EUGRSUZ_B03138 [Eucalyptus grandis]
Length=955

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P A+ MK KAP PNPFE IWSRRKFDILGKKRKGEERR+GLARS AIEKRKNTLLKEYEQ
Sbjct  27   PDAVAMKTKAPKPNPFETIWSRRKFDILGKKRKGEERRVGLARSRAIEKRKNTLLKEYEQ  86

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
              K+SVFVDKRIGE  E + EF+KAILRSQRE +LKL KKSKYNLSDGEE
Sbjct  87   GGKASVFVDKRIGEDKEGMEEFEKAILRSQREYKLKLNKKSKYNLSDGEE  136



>ref|XP_011462988.1| PREDICTED: nucleolar protein 14 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=953

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A  MK++ P PNPFE IWSRRKFD+LGKKRKGEERR+GLARS AIEKRK TLLKEYE+S 
Sbjct  54   AAAMKVQPPKPNPFETIWSRRKFDVLGKKRKGEERRVGLARSQAIEKRKKTLLKEYEKSG  113

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KSSVFVDKRIGE N+EL EFDKAI R+QRER+LK  KKSKYNLSDGE+
Sbjct  114  KSSVFVDKRIGEGNDELDEFDKAIRRTQRERQLKQSKKSKYNLSDGED  161



>ref|XP_004297213.1| PREDICTED: nucleolar protein 14 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=952

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A  MK++ P PNPFE IWSRRKFD+LGKKRKGEERR+GLARS AIEKRK TLLKEYE+S 
Sbjct  54   AAAMKVQPPKPNPFETIWSRRKFDVLGKKRKGEERRVGLARSQAIEKRKKTLLKEYEKSG  113

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KSSVFVDKRIGE N+EL EFDKAI R+QRER+LK  KKSKYNLSDGE+
Sbjct  114  KSSVFVDKRIGEGNDELDEFDKAIRRTQRERQLKQSKKSKYNLSDGED  161



>emb|CBI27323.3| unnamed protein product [Vitis vinifera]
Length=899

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  191  MKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            MKLKAP  NPFE IWSR KFDILGKKRKGE++RIGLARS AI+KR  TLLKEYEQSAKSS
Sbjct  1    MKLKAPQSNPFETIWSRTKFDILGKKRKGEQKRIGLARSRAIQKRNATLLKEYEQSAKSS  60

Query  371  VFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            VF+DKRIGEQN+ LGEFDKAILRSQRER+LKLKKKSKYNLSDGEE
Sbjct  61   VFLDKRIGEQNDALGEFDKAILRSQRERQLKLKKKSKYNLSDGEE  105



>ref|XP_006348659.1| PREDICTED: nucleolar protein 14-like [Solanum tuberosum]
Length=940

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  191  MKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            MKLKAP  NPFE IWSRRKFDILGKKRKGE+RRIG ARS AIEKRK TLLKEYEQSAKSS
Sbjct  32   MKLKAPKENPFETIWSRRKFDILGKKRKGEQRRIGEARSSAIEKRKKTLLKEYEQSAKSS  91

Query  371  VFVDKRIGEQNEELGEFDKAI  433
            +FVDKRIGE +E LGEFDKAI
Sbjct  92   MFVDKRIGENDEGLGEFDKAI  112



>ref|XP_010320846.1| PREDICTED: nucleolar protein 14 isoform X1 [Solanum lycopersicum]
Length=940

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  191  MKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            MKLKAP  NPFE IWSRRKFDILGKKRKGE+RRIG ARS AIEKRK TLLKEYEQSAKSS
Sbjct  32   MKLKAPKENPFETIWSRRKFDILGKKRKGEQRRIGEARSSAIEKRKKTLLKEYEQSAKSS  91

Query  371  VFVDKRIGEQNEELGEFDKAI  433
            +FVDKRIGE +E LGEFDKAI
Sbjct  92   MFVDKRIGENDEGLGEFDKAI  112



>ref|XP_010091617.1| hypothetical protein L484_026465 [Morus notabilis]
 gb|EXB44883.1| hypothetical protein L484_026465 [Morus notabilis]
Length=969

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 104/136 (76%), Gaps = 24/136 (18%)
 Frame = +2

Query  170  SGPKAIGMKLKAPAPN-PFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEK--------  322
            SGP+A+ MK++ P PN PFE IWSRRKFDILGKKRKGEERRIGLARS AIEK        
Sbjct  22   SGPEAVAMKVQVPKPNNPFETIWSRRKFDILGKKRKGEERRIGLARSQAIEKATSQASFP  81

Query  323  ---------------RKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerr  457
                           RK TLLK+YEQS KSSVFVD+RIGEQN++LGEFDKAILRSQRER+
Sbjct  82   EFSSEISPFFCDVLLRKKTLLKDYEQSGKSSVFVDRRIGEQNDDLGEFDKAILRSQRERQ  141

Query  458  lklkkkskynlsDGEE  505
            LK+ KKSKYNLSDGEE
Sbjct  142  LKISKKSKYNLSDGEE  157



>ref|XP_009597551.1| PREDICTED: nucleolar protein 14 [Nicotiana tomentosiformis]
Length=947

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPA--PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GPK  GMK KA A   NPFE IWSRRKFDILGKKRKGEERRIG ARS AIEKRK TLLKE
Sbjct  26   GPKLKGMKHKAAAKKENPFETIWSRRKFDILGKKRKGEERRIGEARSSAIEKRKKTLLKE  85

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQSAKSS FVDKRIGE +E LGEFDKAI
Sbjct  86   YEQSAKSSSFVDKRIGENDEGLGEFDKAI  114



>ref|XP_004144162.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus]
Length=913

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A+ MK+ AP  NPFE+IWS RKFD+LGKKRKGEERRIGLARSLAIEKRK TLLKEYE+S 
Sbjct  27   ALTMKVSAPKANPFESIWSHRKFDVLGKKRKGEERRIGLARSLAIEKRKKTLLKEYERSR  86

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KS+ F DKRIGE +EELGEFDKAILRSQRE + KL K SK+NLSDGEE
Sbjct  87   KSTEFSDKRIGEWDEELGEFDKAILRSQRELKRKLSKSSKFNLSDGEE  134



>ref|XP_004165503.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus]
Length=914

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A+ MK+ AP  NPFE+IWS RKFD+LGKKRKGEERRIGLARSLAIEKRK TLLKEYE+S 
Sbjct  28   ALTMKVSAPKANPFESIWSHRKFDVLGKKRKGEERRIGLARSLAIEKRKKTLLKEYERSR  87

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KS+ F DKRIGE +EELGEFDKAILRSQRE + KL K SK+NLSDGEE
Sbjct  88   KSTEFSDKRIGEWDEELGEFDKAILRSQRELKRKLSKSSKFNLSDGEE  135



>gb|KGN47665.1| hypothetical protein Csa_6G367110 [Cucumis sativus]
Length=947

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A+ MK+ AP  NPFE+IWS RKFD+LGKKRKGEERRIGLARSLAIEKRK TLLKEYE+S 
Sbjct  28   ALTMKVSAPKANPFESIWSHRKFDVLGKKRKGEERRIGLARSLAIEKRKKTLLKEYERSR  87

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KS+ F DKRIGE +EELGEFDKAILRSQRE + KL K SK+NLSDGEE
Sbjct  88   KSTEFSDKRIGEWDEELGEFDKAILRSQRELKRKLSKSSKFNLSDGEE  135



>ref|XP_008445434.1| PREDICTED: nucleolar protein 14 isoform X2 [Cucumis melo]
Length=946

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A+ MK+ AP  NPFE+IWS RKFD+LGKKRKGEERRIGLARSLAIEKRK TLLKEYE+S 
Sbjct  28   ALTMKVSAPKANPFESIWSHRKFDVLGKKRKGEERRIGLARSLAIEKRKKTLLKEYERSR  87

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KS+ F DKRIGE +EELGEFDKAILRSQRE + KL K SK+NLSDGEE
Sbjct  88   KSTEFSDKRIGEWDEELGEFDKAILRSQRELKRKLHKSSKFNLSDGEE  135



>ref|XP_008445433.1| PREDICTED: nucleolar protein 14 isoform X1 [Cucumis melo]
Length=947

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A+ MK+ AP  NPFE+IWS RKFD+LGKKRKGEERRIGLARSLAIEKRK TLLKEYE+S 
Sbjct  28   ALTMKVSAPKANPFESIWSHRKFDVLGKKRKGEERRIGLARSLAIEKRKKTLLKEYERSR  87

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KS+ F DKRIGE +EELGEFDKAILRSQRE + KL K SK+NLSDGEE
Sbjct  88   KSTEFSDKRIGEWDEELGEFDKAILRSQRELKRKLHKSSKFNLSDGEE  135



>gb|KFK41333.1| hypothetical protein AALP_AA2G116500 [Arabis alpina]
Length=909

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +2

Query  170  SGPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            +GP A+ MK K+  A NPFE+IWSRRKFDILGKKRKGEERRIG +RS +++KRKNTLLKE
Sbjct  20   TGPDAVAMKAKSQKAANPFESIWSRRKFDILGKKRKGEERRIGQSRSRSVDKRKNTLLKE  79

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            YEQS KSSVF+D RIGE ++E+GEFDK I+RSQRER+LKL KK+ YNLSDGEE
Sbjct  80   YEQSLKSSVFMDNRIGEHDDEIGEFDKGIIRSQRERQLKLAKKNMYNLSDGEE  132



>ref|XP_006484246.1| PREDICTED: nucleolar protein 14-like [Citrus sinensis]
Length=939

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +2

Query  185  IGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            + MK K+  A NPFE IWSRRKFDILGKKRKGEE RIGL+RSLAI+KR NTLLKEYEQS 
Sbjct  24   VAMKNKSTKADNPFETIWSRRKFDILGKKRKGEEVRIGLSRSLAIQKRTNTLLKEYEQSG  83

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KSSVFVDKRIGE+N+ LGEFDKAI+RSQR+R+LKL KKSKYNLSDGEE
Sbjct  84   KSSVFVDKRIGERNDGLGEFDKAIMRSQRQRQLKLGKKSKYNLSDGEE  131



>ref|XP_011009745.1| PREDICTED: nucleolar protein 14 isoform X1 [Populus euphratica]
Length=959

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 75/93 (81%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPA------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
             PK++ MK  A +       NPFE IWSRRKFDILGKKRKGEE RIGL+R  AIEKRK T
Sbjct  26   APKSVAMKASAASNDNKNSSNPFETIWSRRKFDILGKKRKGEELRIGLSRCRAIEKRKKT  85

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEYE+S KSSVF+DKRIGEQNE+LGEFDKAI
Sbjct  86   LLKEYEESGKSSVFLDKRIGEQNEQLGEFDKAI  118



>ref|XP_011009752.1| PREDICTED: nucleolar protein 14 isoform X2 [Populus euphratica]
Length=958

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 75/93 (81%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPA------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
             PK++ MK  A +       NPFE IWSRRKFDILGKKRKGEE RIGL+R  AIEKRK T
Sbjct  26   APKSVAMKASAASNDNKNSSNPFETIWSRRKFDILGKKRKGEELRIGLSRCRAIEKRKKT  85

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEYE+S KSSVF+DKRIGEQNE+LGEFDKAI
Sbjct  86   LLKEYEESGKSSVFLDKRIGEQNEQLGEFDKAI  118



>ref|XP_011009760.1| PREDICTED: nucleolar protein 14 isoform X3 [Populus euphratica]
Length=958

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 75/93 (81%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPA------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
             PK++ MK  A +       NPFE IWSRRKFDILGKKRKGEE RIGL+R  AIEKRK T
Sbjct  26   APKSVAMKASAASNDNKNSSNPFETIWSRRKFDILGKKRKGEELRIGLSRCRAIEKRKKT  85

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEYE+S KSSVF+DKRIGEQNE+LGEFDKAI
Sbjct  86   LLKEYEESGKSSVFLDKRIGEQNEQLGEFDKAI  118



>ref|XP_011009770.1| PREDICTED: nucleolar protein 14 isoform X4 [Populus euphratica]
Length=957

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 75/93 (81%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPA------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
             PK++ MK  A +       NPFE IWSRRKFDILGKKRKGEE RIGL+R  AIEKRK T
Sbjct  26   APKSVAMKASAASNDNKNSSNPFETIWSRRKFDILGKKRKGEELRIGLSRCRAIEKRKKT  85

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEYE+S KSSVF+DKRIGEQNE+LGEFDKAI
Sbjct  86   LLKEYEESGKSSVFLDKRIGEQNEQLGEFDKAI  118



>ref|XP_011070910.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Sesamum 
indicum]
Length=944

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = +2

Query  194  KLKAPAPNPFEAIWSRRKFDILGKKRKGEERR-IGLARSLAIEKRKNTLLKEYEQSAKSS  370
            K KAP  NPFE+IWSRRKFDILGKKRK +ERR IGL+RSLAI+KR+ TLLKEYEQS KSS
Sbjct  34   KTKAPKENPFESIWSRRKFDILGKKRKEDERRRIGLSRSLAIQKRQKTLLKEYEQSTKSS  93

Query  371  VFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            VFVDKRIGEQNE LGEFDKAILRSQRER+LKLKKKSKYNLSDGEE
Sbjct  94   VFVDKRIGEQNEGLGEFDKAILRSQRERQLKLKKKSKYNLSDGEE  138



>ref|XP_006378528.1| hypothetical protein POPTR_0010s15000g [Populus trichocarpa]
 gb|ERP56325.1| hypothetical protein POPTR_0010s15000g [Populus trichocarpa]
Length=662

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 74/93 (80%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPA------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
             P ++ MK  A +       NPFE IWSRRKFDILGKKRKGEE RIGL+R  AIEKRK T
Sbjct  28   APNSVAMKASAASKDNKNSSNPFETIWSRRKFDILGKKRKGEELRIGLSRCRAIEKRKKT  87

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEYE+S KSSVF+DKRIGEQNE+LGEFDKAI
Sbjct  88   LLKEYEESGKSSVFLDKRIGEQNEQLGEFDKAI  120



>ref|XP_003590488.1| Nucleolar protein [Medicago truncatula]
Length=137

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKA--PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GP+A+ MK KA     NPFE+IWSRRKFD++G+KRKG+ +R+GLARSLAIEKRK TLLKE
Sbjct  29   GPEAVAMKAKAQKTNSNPFESIWSRRKFDVMGQKRKGDTKRMGLARSLAIEKRKKTLLKE  88

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQS KSS F+D+RIGE +E L +F KAI
Sbjct  89   YEQSTKSSEFIDRRIGENDEGLDDFGKAI  117



>ref|XP_002316014.2| hypothetical protein POPTR_0010s15000g [Populus trichocarpa]
 gb|EEF02185.2| hypothetical protein POPTR_0010s15000g [Populus trichocarpa]
Length=961

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 74/93 (80%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPA------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
             P ++ MK  A +       NPFE IWSRRKFDILGKKRKGEE RIGL+R  AIEKRK T
Sbjct  28   APNSVAMKASAASKDNKNSSNPFETIWSRRKFDILGKKRKGEELRIGLSRCRAIEKRKKT  87

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEYE+S KSSVF+DKRIGEQNE+LGEFDKAI
Sbjct  88   LLKEYEESGKSSVFLDKRIGEQNEQLGEFDKAI  120



>ref|XP_006574503.1| PREDICTED: nucleolar protein 14-like isoform X1 [Glycine max]
Length=947

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 4/91 (4%)
 Frame = +2

Query  173  GPKAIGMKLKA----PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLL  340
            GP+ + MK+KA     A NPFE+IWSRRKF++LG+KRKGE RR+GLARSLAI+KR NTLL
Sbjct  25   GPEGVAMKVKANNNATASNPFESIWSRRKFEVLGQKRKGEARRMGLARSLAIQKRNNTLL  84

Query  341  KEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            KEY QSAKSS+FVDKRIGE++E L EF KAI
Sbjct  85   KEYHQSAKSSLFVDKRIGEKDEALDEFGKAI  115



>ref|XP_010681128.1| PREDICTED: nucleolar protein 14 [Beta vulgaris subsp. vulgaris]
Length=937

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +2

Query  185  IGMKLKA-PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            + MKLKA P  NPFE IWSRRKFD++GKKRKGEE RIG AR+ AIEKRK TLLKEYEQS 
Sbjct  25   VSMKLKAAPKENPFETIWSRRKFDVIGKKRKGEECRIGQARARAIEKRKKTLLKEYEQSG  84

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            K+SVFVDKRIGEQ++ LGEFDKAILRSQRER++ +KK SKYNLSDGEE
Sbjct  85   KASVFVDKRIGEQDDALGEFDKAILRSQRERQMNIKKTSKYNLSDGEE  132



>ref|XP_006437873.1| hypothetical protein CICLE_v10030646mg [Citrus clementina]
 gb|ESR51113.1| hypothetical protein CICLE_v10030646mg [Citrus clementina]
Length=939

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +2

Query  185  IGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            + MK K+  A NPFE IWSRRKFDILGKKRKGEE RIGL+RSLAI+KR  TLLKEYEQS 
Sbjct  24   VAMKNKSTKADNPFETIWSRRKFDILGKKRKGEEVRIGLSRSLAIQKRTKTLLKEYEQSG  83

Query  362  KSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            KSSVFVDKRIGE+N+ LGEFDKAI+RSQR+R+LKL KKSKYNLSDGEE
Sbjct  84   KSSVFVDKRIGERNDGLGEFDKAIMRSQRQRQLKLGKKSKYNLSDGEE  131



>gb|KHN00285.1| Nucleolar protein 14 [Glycine soja]
Length=925

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 4/91 (4%)
 Frame = +2

Query  173  GPKAIGMKLKA----PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLL  340
            GP+ + MK+KA     A NPFE+IWSRRKF++LG+KRKGE RR+GLARSLAI+KR +TLL
Sbjct  25   GPEGVAMKVKANNNATASNPFESIWSRRKFEVLGQKRKGEARRMGLARSLAIQKRNDTLL  84

Query  341  KEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            KEY QSAKSS+FVDKRIGE++E L EF KAI
Sbjct  85   KEYHQSAKSSLFVDKRIGEKDEALDEFGKAI  115



>emb|CDY62483.1| BnaCnng40350D [Brassica napus]
Length=688

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE+IWSRRKFD+LGKKRKGEERR+GL+RS A++KRKNTLLKEYEQS KSSVF+DKRIG
Sbjct  36   NPFESIWSRRKFDVLGKKRKGEERRVGLSRSRAVDKRKNTLLKEYEQSLKSSVFMDKRIG  95

Query  395  EQNEELGEFDKAI  433
            E + ELGEFDK +
Sbjct  96   EHDNELGEFDKGV  108



>ref|XP_008813616.1| PREDICTED: nucleolar protein 14-like [Phoenix dactylifera]
Length=265

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE IWSRRKFDILGKKRKGEERR+GLARSLAI+KRK TLLKEYE+S KSS F+DKRIG
Sbjct  42   NPFETIWSRRKFDILGKKRKGEERRVGLARSLAIQKRKKTLLKEYEESTKSSKFLDKRIG  101

Query  395  EQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            E+++ L EFDKA++R QRE +LKLK+ SKYNLSDGEE
Sbjct  102  EKDDTLQEFDKAVMRMQREHQLKLKRTSKYNLSDGEE  138



>gb|ACG60683.1| unknown protein [Brassica oleracea var. alboglabra]
Length=879

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE+IWSRRKFD+LGKKRKGEERR+GL+RS A++KRKNTLLKEYEQS KSSVF+DKRIG
Sbjct  36   NPFESIWSRRKFDVLGKKRKGEERRVGLSRSRAVDKRKNTLLKEYEQSLKSSVFMDKRIG  95

Query  395  EQNEELGEFDKAI  433
            E + ELGEFDK +
Sbjct  96   EHDNELGEFDKGV  108



>ref|XP_006588546.1| PREDICTED: nucleolar protein 14-like [Glycine max]
Length=954

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 6/93 (6%)
 Frame = +2

Query  173  GPKAIGMKLKA------PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
            GP+ + MK+KA       A NPFE+IWSRRKF++LG+KRKGE RR+GLARSLAI+KR +T
Sbjct  29   GPEGVAMKVKANNNNNGTASNPFESIWSRRKFEVLGQKRKGEARRMGLARSLAIQKRNDT  88

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKEY QSAKSS+FVDKRIGE++E L +F KAI
Sbjct  89   LLKEYHQSAKSSLFVDKRIGEKDEALDDFGKAI  121



>emb|CDY65810.1| BnaA02g35820D [Brassica napus]
Length=892

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE+IW+RRKFD+LGKKRKGEERR+GL+RS A++KRKNTLLKEYEQS KSSVF+DKRIG
Sbjct  36   NPFESIWARRKFDVLGKKRKGEERRVGLSRSRAVDKRKNTLLKEYEQSLKSSVFMDKRIG  95

Query  395  EQNEELGEFDKAI  433
            E + ELGEFDK +
Sbjct  96   EHDNELGEFDKGV  108



>ref|XP_009127702.1| PREDICTED: nucleolar protein 14 [Brassica rapa]
Length=904

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE+IW+RRKFD+LGKKRKGEERR+GL+RS A++KRKNTLLKEYEQS KSSVF+DKRIG
Sbjct  36   NPFESIWARRKFDVLGKKRKGEERRVGLSRSRAVDKRKNTLLKEYEQSLKSSVFMDKRIG  95

Query  395  EQNEELGEFDKAI  433
            E + ELGEFDK +
Sbjct  96   EHDNELGEFDKGV  108



>ref|XP_006651582.1| PREDICTED: nucleolar protein 14-like [Oryza brachyantha]
Length=941

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = +2

Query  170  SGPKAIGMKLK----APAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTL  337
            +GP A+ MK +    A + NPFEAIWSRRKFD+LGKKRKGEE+R+G ARS AI KR+NTL
Sbjct  30   NGPAAVAMKARGAATAASNNPFEAIWSRRKFDVLGKKRKGEEQRVGRARSEAIHKRENTL  89

Query  338  LKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LKE+EQS KSSVF D+RIGE++E L EFDKAI
Sbjct  90   LKEFEQSGKSSVFHDRRIGERDETLPEFDKAI  121



>ref|XP_010932892.1| PREDICTED: nucleolar protein 14 isoform X2 [Elaeis guineensis]
Length=944

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A  MK   P   NPFE IWSRRKFDILGKKRKGEERR+GLARSLAIEKRK TLLKEY
Sbjct  28   GPAAAAMKAAKPVRANPFETIWSRRKFDILGKKRKGEERRVGLARSLAIEKRKKTLLKEY  87

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            E+S KSS F+DKRIGE+++ L EFDKA++R QRER+LKLK+ SKYNLSDGEE
Sbjct  88   EESTKSSKFLDKRIGEKDDTLQEFDKAVMRMQRERQLKLKRTSKYNLSDGEE  139



>ref|XP_010932890.1| PREDICTED: nucleolar protein 14 isoform X1 [Elaeis guineensis]
 ref|XP_010932891.1| PREDICTED: nucleolar protein 14 isoform X1 [Elaeis guineensis]
Length=945

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A  MK   P   NPFE IWSRRKFDILGKKRKGEERR+GLARSLAIEKRK TLLKEY
Sbjct  28   GPAAAAMKAAKPVRANPFETIWSRRKFDILGKKRKGEERRVGLARSLAIEKRKKTLLKEY  87

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            E+S KSS F+DKRIGE+++ L EFDKA++R QRER+LKLK+ SKYNLSDGEE
Sbjct  88   EESTKSSKFLDKRIGEKDDTLQEFDKAVMRMQRERQLKLKRTSKYNLSDGEE  139



>ref|XP_009402831.1| PREDICTED: nucleolar protein 14 [Musa acuminata subsp. malaccensis]
Length=944

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE IWSRRKFD++GK+RKGEERRIGL+RSLA+EKRK TLLKEYEQSAKSSVF+D RIG
Sbjct  45   NPFETIWSRRKFDVVGKRRKGEERRIGLSRSLAVEKRKKTLLKEYEQSAKSSVFLDNRIG  104

Query  395  EQNEELGEFDKAI  433
            E+++ L EFDKA+
Sbjct  105  EKDDTLQEFDKAV  117



>gb|AAF27073.1|AC008262_22 F4N2.4 [Arabidopsis thaliana]
Length=891

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A+ MK K     NPFE+I SRRKFDILGKKRKGEER + ++R+ A++KRKNTL KEY
Sbjct  20   GPDAVAMKAKTQKVDNPFESIRSRRKFDILGKKRKGEERFVSVSRTRAVDKRKNTLEKEY  79

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQS KSSVF+DKRIGEQN+ELGEFDK I+RSQR+R+LKL KKS YNLSDGEE
Sbjct  80   EQSLKSSVFLDKRIGEQNDELGEFDKGIIRSQRQRQLKLAKKSMYNLSDGEE  131



>ref|NP_177070.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34882.1| uncharacterized protein AT1G69070 [Arabidopsis thaliana]
Length=901

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A+ MK K     NPFE+I SRRKFDILGKKRKGEER + ++R+ A++KRKNTL KEY
Sbjct  20   GPDAVAMKAKTQKVDNPFESIRSRRKFDILGKKRKGEERFVSVSRTRAVDKRKNTLEKEY  79

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQS KSSVF+DKRIGEQN+ELGEFDK I+RSQR+R+LKL KKS YNLSDGEE
Sbjct  80   EQSLKSSVFLDKRIGEQNDELGEFDKGIIRSQRQRQLKLAKKSMYNLSDGEE  131



>ref|XP_010415534.1| PREDICTED: nucleolar protein 14-like isoform X3 [Camelina sativa]
Length=906

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +2

Query  170  SGPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            +GP A+ MK K     NPFE+I SR+KF+ILGKKRKGEERRI ++R+LA++KRKNTL KE
Sbjct  19   TGPDAVAMKAKPKKVVNPFESITSRQKFEILGKKRKGEERRISVSRTLAVDKRKNTLEKE  78

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            YE+S K+SVF+DKRIGEQN+ELGEFDK I+RSQRER+LKL KKS YNLSDGEE
Sbjct  79   YERSLKASVFLDKRIGEQNDELGEFDKGIIRSQRERQLKLAKKSMYNLSDGEE  131



>ref|XP_010415532.1| PREDICTED: nucleolar protein 14-like isoform X1 [Camelina sativa]
 ref|XP_010415533.1| PREDICTED: nucleolar protein 14-like isoform X2 [Camelina sativa]
Length=906

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +2

Query  170  SGPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            +GP A+ MK K     NPFE+I SR+KF+ILGKKRKGEERRI ++R+LA++KRKNTL KE
Sbjct  19   TGPDAVAMKAKPKKVVNPFESITSRQKFEILGKKRKGEERRISVSRTLAVDKRKNTLEKE  78

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            YE+S K+SVF+DKRIGEQN+ELGEFDK I+RSQRER+LKL KKS YNLSDGEE
Sbjct  79   YERSLKASVFLDKRIGEQNDELGEFDKGIIRSQRERQLKLAKKSMYNLSDGEE  131



>ref|XP_010470881.1| PREDICTED: nucleolar protein 14-like [Camelina sativa]
Length=907

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +2

Query  170  SGPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            +GP A+ MK K     NPFE+I SR+KF+ILGKKRKGEERRI ++R+LA++KRKNTL KE
Sbjct  19   TGPDAVAMKAKPKKVVNPFESITSRQKFEILGKKRKGEERRISVSRTLAVDKRKNTLEKE  78

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            YE+S K+SVF+DKRIGEQN+ELGEFDK I+RSQRER+LKL KKS YNLSDGEE
Sbjct  79   YERSLKASVFLDKRIGEQNDELGEFDKGIIRSQRERQLKLAKKSMYNLSDGEE  131



>ref|XP_010511932.1| PREDICTED: nucleolar protein 14-like [Camelina sativa]
Length=905

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +2

Query  170  SGPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            +GP A+ MK K     NPFE+I SR+KF+ILGKKRKGEERRI ++R+LA++KRKNTL KE
Sbjct  19   TGPDAVAMKAKPKKVVNPFESITSRQKFEILGKKRKGEERRISVSRTLAVDKRKNTLEKE  78

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            YE+S K+SVF+DKRIGEQN+ELGEFDK I+RSQRER+LKL KKS YNLSDGEE
Sbjct  79   YERSLKASVFLDKRIGEQNDELGEFDKGIIRSQRERQLKLAKKSMYNLSDGEE  131



>gb|KEH42219.1| Nop14 nucleolar-like protein [Medicago truncatula]
Length=720

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKA--PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GP+A+ MK KA     NPFE+IWSRRKFD++G+KRKG+ +R+GLARSLAIEKRK TLLKE
Sbjct  29   GPEAVAMKAKAQKTNSNPFESIWSRRKFDVMGQKRKGDTKRMGLARSLAIEKRKKTLLKE  88

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQS KSS F+D+RIGE +E L +F KAI
Sbjct  89   YEQSTKSSEFIDRRIGENDEGLDDFGKAI  117



>gb|AAN08225.2| unknown protein [Oryza sativa Japonica Group]
 gb|AAO59991.1| unknown protein [Oryza sativa Japonica Group]
Length=952

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 11/99 (11%)
 Frame = +2

Query  170  SGPKAIGMKLK-----------APAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAI  316
            +GP A+ MK +           + + NPFEAIWSRRKFD+LGKKRKGEERRIG ARS AI
Sbjct  31   NGPAAVAMKARGAAAAAAAAAASGSNNPFEAIWSRRKFDVLGKKRKGEERRIGRARSEAI  90

Query  317  EKRKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
             KR+NTLLKE+EQSAKSSVF D+RIGE++E L EFDK I
Sbjct  91   HKRENTLLKEFEQSAKSSVFQDRRIGERDETLPEFDKVI  129



>gb|ABF97462.1| Nop14-like family protein, expressed [Oryza sativa Japonica Group]
Length=929

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 11/99 (11%)
 Frame = +2

Query  170  SGPKAIGMKLK-----------APAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAI  316
            +GP A+ MK +           + + NPFEAIWSRRKFD+LGKKRKGEERRIG ARS AI
Sbjct  31   NGPAAVAMKARGAAAAAAAAAASGSNNPFEAIWSRRKFDVLGKKRKGEERRIGRARSEAI  90

Query  317  EKRKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
             KR+NTLLKE+EQSAKSSVF D+RIGE++E L EFDK I
Sbjct  91   HKRENTLLKEFEQSAKSSVFQDRRIGERDETLPEFDKVI  129



>ref|XP_006391059.1| hypothetical protein EUTSA_v10018096mg [Eutrema salsugineum]
 gb|ESQ28345.1| hypothetical protein EUTSA_v10018096mg [Eutrema salsugineum]
Length=911

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +2

Query  182  AIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQS  358
            A+ MK KA  A NPFE+IWSR++F +LGKK +G ERR+GL+RS A++KRKNTLLKEYEQS
Sbjct  29   AVAMKAKAQKAENPFESIWSRQRFPVLGKKNEGGERRVGLSRSRAVDKRKNTLLKEYEQS  88

Query  359  AKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
             K+SVF+D RIGE N+ELGEFDKAI+RSQRER+LKL KKS YNLSDGEE
Sbjct  89   LKASVFMDNRIGEHNDELGEFDKAIIRSQRERQLKLAKKSMYNLSDGEE  137



>gb|KEH42220.1| Nop14 nucleolar-like protein [Medicago truncatula]
Length=964

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKA--PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GP+A+ MK KA     NPFE+IWSRRKFD++G+KRKG+ +R+GLARSLAIEKRK TLLKE
Sbjct  29   GPEAVAMKAKAQKTNSNPFESIWSRRKFDVMGQKRKGDTKRMGLARSLAIEKRKKTLLKE  88

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQS KSS F+D+RIGE +E L +F KAI
Sbjct  89   YEQSTKSSEFIDRRIGENDEGLDDFGKAI  117



>ref|NP_001050609.1| Os03g0598200 [Oryza sativa Japonica Group]
 dbj|BAF12523.1| Os03g0598200 [Oryza sativa Japonica Group]
Length=912

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFEAIWSRRKFD+LGKKRKGEERRIG ARS AI KR+NTLLKE+EQSAKSSVF D+RIG
Sbjct  17   NPFEAIWSRRKFDVLGKKRKGEERRIGRARSEAIHKRENTLLKEFEQSAKSSVFQDRRIG  76

Query  395  EQNEELGEFDKAI  433
            E++E L EFDK I
Sbjct  77   ERDETLPEFDKVI  89



>gb|KEH41125.1| Nop14 nucleolar-like protein [Medicago truncatula]
Length=946

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKA--PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GP+A+ MK KA     NPFE+IWSRRKF+++G+KRKG+ +R+GLARSLA+EKRK TLLKE
Sbjct  30   GPEAVAMKAKAQKTNTNPFESIWSRRKFEVMGQKRKGDTKRMGLARSLAVEKRKKTLLKE  89

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQS KSS F+D+RIGE +E L +F KAI
Sbjct  90   YEQSTKSSEFIDRRIGENDEGLDDFGKAI  118



>ref|XP_007145864.1| hypothetical protein PHAVU_007G274500g [Phaseolus vulgaris]
 gb|ESW17858.1| hypothetical protein PHAVU_007G274500g [Phaseolus vulgaris]
Length=955

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 10/97 (10%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPN----------PFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEK  322
            GP+ + MK+KA +            PFE+IWSRRKF++LG+KRKGE RR+GLAR+LAI+K
Sbjct  27   GPEGVAMKVKAKSNKSNGGGGGGSNPFESIWSRRKFEVLGQKRKGEARRMGLARTLAIQK  86

Query  323  RKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            R NTLLKEY+QSAKSS+FVD+RIGE +  L EF KAI
Sbjct  87   RNNTLLKEYQQSAKSSLFVDRRIGENDHALDEFGKAI  123



>ref|XP_002888698.1| hypothetical protein ARALYDRAFT_339148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64957.1| hypothetical protein ARALYDRAFT_339148 [Arabidopsis lyrata subsp. 
lyrata]
Length=901

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAP-APNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            GP A+ MK K     NPFE I SRRKFDILGKKRKGEER + ++R+ A++KRKNTL KEY
Sbjct  20   GPDAVAMKAKTQKVDNPFELIRSRRKFDILGKKRKGEERFVSVSRTRAVDKRKNTLQKEY  79

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQS K+SVF+DKRIGE ++ELGEFDK I+RSQR+R+LKL KKS YNLSDGEE
Sbjct  80   EQSLKASVFLDKRIGEHDDELGEFDKGIIRSQRQRQLKLAKKSMYNLSDGEE  131



>gb|EEC75694.1| hypothetical protein OsI_12505 [Oryza sativa Indica Group]
Length=947

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFEAIWSRRKFD+LGKKRKGEERRI  ARS AI KR+NTLLKE+EQSAKSSVF D+RIG
Sbjct  52   NPFEAIWSRRKFDVLGKKRKGEERRIVRARSEAIHKRENTLLKEFEQSAKSSVFQDRRIG  111

Query  395  EQNEELGEFDKAI  433
            E++E L EFDKAI
Sbjct  112  ERDETLPEFDKAI  124



>ref|XP_010232878.1| PREDICTED: nucleolar protein 14 isoform X1 [Brachypodium distachyon]
Length=940

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 7/93 (8%)
 Frame = +2

Query  176  PKAIGMKLKAPA-------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
            P A+ MK +  A        NPFEAIWSRRKFD+LGKKRKGEERR   +RS AI KR+NT
Sbjct  35   PTAVAMKARGAAAAAAAERSNPFEAIWSRRKFDVLGKKRKGEERRTSRSRSEAIHKRENT  94

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKE++QSAKSSVF D+RIGE++E L EFDKAI
Sbjct  95   LLKEFQQSAKSSVFHDRRIGERDETLPEFDKAI  127



>ref|XP_010232881.1| PREDICTED: nucleolar protein 14 isoform X2 [Brachypodium distachyon]
Length=939

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 7/93 (8%)
 Frame = +2

Query  176  PKAIGMKLKAPA-------PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNT  334
            P A+ MK +  A        NPFEAIWSRRKFD+LGKKRKGEERR   +RS AI KR+NT
Sbjct  35   PTAVAMKARGAAAAAAAERSNPFEAIWSRRKFDVLGKKRKGEERRTSRSRSEAIHKRENT  94

Query  335  LLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            LLKE++QSAKSSVF D+RIGE++E L EFDKAI
Sbjct  95   LLKEFQQSAKSSVFHDRRIGERDETLPEFDKAI  127



>gb|EPS59451.1| hypothetical protein M569_15356, partial [Genlisea aurea]
Length=318

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +2

Query  194  KLKAPAPNPFEAIWSRRKFDILGKKRKGEERR-IGLARSLAIEKRKNTLLKEYEQSAKSS  370
            K K P  NPFE I+SRRKF+ILGKKRK +ERR IGL+RSL I+KR+ TLLKEYEQ+ KSS
Sbjct  29   KSKEPKENPFENIYSRRKFNILGKKRKNDERRSIGLSRSLGIQKRQKTLLKEYEQNKKSS  88

Query  371  VFVDKRIGEQNEELGEFDKAI  433
            VF+DKRIGE NE L EFDK I
Sbjct  89   VFLDKRIGENNEGLEEFDKVI  109



>gb|EMT11619.1| hypothetical protein F775_01391 [Aegilops tauschii]
Length=950

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFEAIWSRRKFD+LGKKRKGEERR   +RS AI KR+NTLLKE+EQSAKSSVF D+RIG
Sbjct  15   NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAIHKRENTLLKEFEQSAKSSVFHDRRIG  74

Query  395  EQNEELGEFDKAI  433
            E++E L E+DKAI
Sbjct  75   ERDETLPEYDKAI  87



>gb|EMS51472.1| hypothetical protein TRIUR3_21500 [Triticum urartu]
Length=1042

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFEAIWSRRKFD+LGKKRKGEERR   +RS AI KR+NTLLKE+EQSAKSSVF D+RIG
Sbjct  95   NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAIHKRENTLLKEFEQSAKSSVFHDRRIG  154

Query  395  EQNEELGEFDKAI  433
            E++E L E+DKAI
Sbjct  155  ERDETLPEYDKAI  167



>ref|XP_004497865.1| PREDICTED: nucleolar protein 14-like [Cicer arietinum]
Length=946

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPN--PFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GP+ + MK KAP  N  PFE+I S+RKF++LG+KRKG+ +R+GL RS AIEKRK TLLKE
Sbjct  33   GPEGVAMKAKAPKANDNPFESIRSKRKFEVLGQKRKGDAKRMGLVRSAAIEKRKKTLLKE  92

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            YEQS KSS FVDKRIGE +E L EF KA+
Sbjct  93   YEQSTKSSQFVDKRIGENDEALDEFGKAV  121



>ref|XP_008665060.1| PREDICTED: nucleolar protein 14 isoform X2 [Zea mays]
 tpg|DAA50242.1| TPA: hypothetical protein ZEAMMB73_053356 [Zea mays]
Length=921

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = +2

Query  185  IGMKLKAPAP----NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            + MK +  A     NPFEAIWSRRKFD+LGKKRKGEERR+  +RS AI KR+NTLLKE+ 
Sbjct  29   VAMKARGAAAEERNNPFEAIWSRRKFDVLGKKRKGEERRVSRSRSEAIRKRENTLLKEFV  88

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +SAKSSVF D+RIGE+++ L EFDKAI
Sbjct  89   ESAKSSVFHDRRIGERDDTLPEFDKAI  115



>ref|XP_008665059.1| PREDICTED: nucleolar protein 14 isoform X1 [Zea mays]
Length=922

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = +2

Query  185  IGMKLKAPAP----NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            + MK +  A     NPFEAIWSRRKFD+LGKKRKGEERR+  +RS AI KR+NTLLKE+ 
Sbjct  29   VAMKARGAAAEERNNPFEAIWSRRKFDVLGKKRKGEERRVSRSRSEAIRKRENTLLKEFV  88

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +SAKSSVF D+RIGE+++ L EFDKAI
Sbjct  89   ESAKSSVFHDRRIGERDDTLPEFDKAI  115



>ref|XP_004982473.1| PREDICTED: nucleolar protein 14-like [Setaria italica]
Length=931

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFEAIWSRRKFD+LGKKRKGEE+R+  +RS AI KR+NTLLKE+E+SAKSSVF D+RIG
Sbjct  49   NPFEAIWSRRKFDVLGKKRKGEEQRVSRSRSEAIRKRENTLLKEFEESAKSSVFHDRRIG  108

Query  395  EQNEELGEFDKAI  433
            E+++ L EFDKA+
Sbjct  109  ERDDTLPEFDKAV  121



>ref|XP_006300707.1| hypothetical protein CARUB_v10019758mg [Capsella rubella]
 gb|EOA33605.1| hypothetical protein CARUB_v10019758mg [Capsella rubella]
Length=900

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE+  SR+KF+ILGKKRKGEERR+ ++R+LA++KRKNTL KEYE+S K++VF+DKRIG
Sbjct  35   NPFESFTSRQKFEILGKKRKGEERRVSISRTLAVDKRKNTLEKEYERSLKATVFLDKRIG  94

Query  395  EQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            EQ++ELGEFDK I+RSQRER+LKL KKS YNLSDGEE
Sbjct  95   EQDDELGEFDKGIIRSQRERQLKLAKKSMYNLSDGEE  131



>ref|XP_002464264.1| hypothetical protein SORBIDRAFT_01g015150 [Sorghum bicolor]
 gb|EER91262.1| hypothetical protein SORBIDRAFT_01g015150 [Sorghum bicolor]
Length=925

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +2

Query  185  IGMKLKAPAP----NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            + MK +  A     NPFEAIWSRRKFD+LGKKRKGEERR+  +RS AI KR+NTLLKE+ 
Sbjct  31   VAMKARGAAAEERSNPFEAIWSRRKFDVLGKKRKGEERRVSRSRSEAIRKRENTLLKEFM  90

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +S KSSVF D+RIGE+++ L EFDKAI
Sbjct  91   ESGKSSVFHDRRIGERDDALPEFDKAI  117



>gb|EYU22573.1| hypothetical protein MIMGU_mgv1a000929mg [Erythranthe guttata]
Length=940

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +2

Query  188  GMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERR-IGLARSLAIEKRKNTLLKEYEQSAK  364
             +K KAP  NPFE+IWSRRKF+ILGKKRK EERR IG +RS+ ++KR+NTLLKEYEQS K
Sbjct  29   AIKKKAPKENPFESIWSRRKFNILGKKRKEEERRRIGHSRSIGLQKRQNTLLKEYEQSKK  88

Query  365  SSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGEE  505
            SSVFVD RIGEQ+E LGEFDKAILRSQRER+L LKKKSKYN+SDGEE
Sbjct  89   SSVFVDNRIGEQSEALGEFDKAILRSQRERQLNLKKKSKYNISDGEE  135



>ref|XP_009342326.1| PREDICTED: nucleolar protein 14-like [Pyrus x bretschneideri]
Length=180

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +2

Query  191  MKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKS  367
            MK + P  PNP E IWSRRKFD+LGK  K +   +  + +LA  KRKNTLLKEYEQS K+
Sbjct  1    MKHQVPLKPNPLETIWSRRKFDVLGKSAKAKSAELA-SPALAPLKRKNTLLKEYEQSNKA  59

Query  368  SVFVDKRIGEQNEELGEFDKAI  433
            SVFVDK+IGE N+EL EFDKAI
Sbjct  60   SVFVDKQIGEHNDELNEFDKAI  81



>gb|EAZ27697.1| hypothetical protein OsJ_11647 [Oryza sativa Japonica Group]
Length=951

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 12/99 (12%)
 Frame = +2

Query  170  SGPKAIGMKLK-----------APAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAI  316
            +GP A+ MK +           + + NPFEAIWSRRKFD+LGKKRKGE      A +L  
Sbjct  31   NGPAAVAMKARGAAAAAAAAAASGSNNPFEAIWSRRKFDVLGKKRKGESA-ASAAPALRP  89

Query  317  EKRKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
              R+NTLLKE+EQSAKSSVF D+RIGE++E L EFDK I
Sbjct  90   STRENTLLKEFEQSAKSSVFQDRRIGERDETLPEFDKVI  128



>ref|XP_009342323.1| PREDICTED: uncharacterized protein LOC103934295 [Pyrus x bretschneideri]
Length=404

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  263  KKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +KRKGEERR+GL+RS AIEKRKNTLLKEYEQS K+SVFVDK+IGE N+EL EFDKAI
Sbjct  166  QKRKGEERRVGLSRSRAIEKRKNTLLKEYEQSNKASVFVDKQIGEHNDELNEFDKAI  222



>ref|XP_001762011.1| predicted protein [Physcomitrella patens]
 gb|EDQ73115.1| predicted protein [Physcomitrella patens]
Length=942

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKG-EERRIGLARSLAIEKRKNTLLKEY  349
            GPK  G      + N FE +W+RRKFD+LGKK+KG + +R+GLARS A+EKRK +LL EY
Sbjct  25   GPKTQG----GHSENVFETLWTRRKFDVLGKKQKGGDAKRVGLARSAAVEKRKKSLLPEY  80

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +Q  K++ F+D R GE +E LG+ DKAI
Sbjct  81   KQRGKTNAFLDSRFGEHDESLGDEDKAI  108



>gb|KDD73522.1| Nop14-like family protein, partial [Helicosporidium sp. ATCC 
50920]
Length=251

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = +2

Query  179  KAIGMKLKAP-AP-NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            KA   +  AP AP NPFE + ++++FDILG+K KGE R  G  RS A EKRKNTLL EY+
Sbjct  10   KAFRGRRAAPEAPENPFERLSNKKRFDILGRKVKGETRETGKLRSAAAEKRKNTLLVEYK  69

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            Q  K++ FVD+R GE ++ + E +K++
Sbjct  70   QLRKANAFVDRRFGENDKTMTEEEKSL  96



>ref|XP_005848097.1| hypothetical protein CHLNCDRAFT_145376 [Chlorella variabilis]
 gb|EFN55995.1| hypothetical protein CHLNCDRAFT_145376 [Chlorella variabilis]
Length=538

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P A   + K  APN FE + ++++F ILG+K KGE R++G  R+ A E+RKNTLL EY Q
Sbjct  16   PLAAQERHKEEAPNLFERLSNKKRFSILGRKVKGETRQLGKLRTAAGERRKNTLLVEYRQ  75

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAI  433
              KS+ F+D+R GE +E L   +KA+
Sbjct  76   LRKSNAFIDRRFGEDDESLTADEKAL  101



>ref|XP_005652081.1| Nop14-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27537.1| Nop14-like protein [Coccomyxa subellipsoidea C-169]
Length=983

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PN FE I++R+KF++LGKK+KGE R+ G +RS A++KR  TLL EY++  KS+ FVD+R 
Sbjct  19   PNLFEHIYNRKKFNVLGKKQKGE-RKHGKSRSDAVDKRNKTLLVEYKELRKSNAFVDRRF  77

Query  392  GEQNEELGEFDKAI  433
            GE +  L E +KA+
Sbjct  78   GEDDSTLTEEEKAL  91



>ref|XP_010764286.1| PREDICTED: nucleolar protein 14-like [Notothenia coriiceps]
Length=697

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI KRK+TLLKEY+Q  KSS F+D+R G
Sbjct  26   NPFEVKINRKKFDILGQKSKHDVGLPGVSRSKAINKRKDTLLKEYKQKGKSSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E +  +   DK +
Sbjct  86   EYDTNMAPEDKIL  98



>ref|XP_006104151.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Myotis 
lucifugus]
Length=860

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF+DK
Sbjct  27   PNPNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARAIQKRTQTLLKEYKERDKSNVFIDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  87   RFGEYNSHISAEEKMM  102



>dbj|BAC37700.1| unnamed protein product [Mus musculus]
Length=190

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRF  88

Query  392  GEQNEEL  412
            GE N  +
Sbjct  89   GEYNSNI  95



>ref|XP_004368115.1| Nop14 family protein [Acanthamoeba castellanii str. Neff]
 gb|ELR25360.1| Nop14 family protein [Acanthamoeba castellanii str. Neff]
Length=938

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P  NPFE    R KF +LG+  K  E+  G +R +A E RK+TLLKEYEQ  K++ FVD+
Sbjct  21   PKINPFERKIVRPKFSVLGRNLKETEKTAGQSRQVATESRKSTLLKEYEQLGKANKFVDQ  80

Query  386  RIGEQNEELGEFDKAI  433
            RIGE+++ L   DKA+
Sbjct  81   RIGEKDKSLSREDKAL  96



>ref|XP_001420056.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98349.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=975

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 4/88 (5%)
 Frame = +2

Query  170  SGPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            SGP   G+ +K+     FE +  RRKFDILG+K KGE   +  AR+ AIEKR+ TLL E+
Sbjct  27   SGPSPSGVTVKSA----FETVSHRRKFDILGRKVKGERGNVLQARTEAIEKRRRTLLVEH  82

Query  350  EQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            E + K++ F+D+R GE +  L   +K I
Sbjct  83   EANGKANAFLDRRFGEHDSGLSVEEKNI  110



>ref|XP_003965217.1| PREDICTED: nucleolar protein 14-like [Takifugu rubripes]
Length=871

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS AI KRK TLLKEY+Q  KSS F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKVKHDVGLPGVSRSKAITKRKETLLKEYKQKNKSSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>emb|CEF99253.1| Nucleolar protein 14 [Ostreococcus tauri]
Length=975

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  221  FEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIGEQ  400
            FE++  R+KFDILG+K KGE   +  AR+ AIEKR+ TLL+E+E++ K++ FVD+R GE 
Sbjct  35   FESVSVRKKFDILGRKVKGERGNVIKARTEAIEKRRRTLLREHEENGKANSFVDRRFGES  94

Query  401  NEELGEFDKAI  433
            ++ L   DK I
Sbjct  95   DDGLSAEDKHI  105



>ref|XP_005812725.1| PREDICTED: nucleolar protein 14-like [Xiphophorus maculatus]
Length=868

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS AI KRK TLLKEY+Q  KS+ F+D+R+G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAINKRKETLLKEYKQKNKSNKFIDRRLG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDAKMTPEDKIL  98



>ref|XP_004383561.1| PREDICTED: nucleolar protein 14 [Trichechus manatus latirostris]
Length=854

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A G+K K P PNPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY++  
Sbjct  20   ARGVKAK-PNPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKERD  78

Query  362  KSSVFVDKRIGEQNEEL  412
            KS+VF DKR GE N  L
Sbjct  79   KSNVFRDKRFGEYNSSL  95



>ref|XP_001489859.1| PREDICTED: nucleolar protein 14 isoform X1 [Equus caballus]
 ref|XP_008530608.1| PREDICTED: nucleolar protein 14 isoform X1 [Equus przewalskii]
Length=853

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF DK
Sbjct  27   PNPNPFEVKINRQKFQVLGRKTRHDVGLPGVSRARAIQKRTQTLLKEYKERDKSNVFTDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  87   RFGEYNSNISPEEKMM  102



>ref|XP_003455004.1| PREDICTED: nucleolar protein 14 [Oreochromis niloticus]
Length=867

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS A+ KRK TLLKEY+Q  +SS F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAVNKRKETLLKEYKQKNRSSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>ref|XP_004432293.1| PREDICTED: nucleolar protein 14 [Ceratotherium simum simum]
Length=855

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF DK
Sbjct  27   PNPNPFEVKINRQKFQVLGRKTRHDVGLPGVSRARAIQKRTQTLLKEYKERDKSNVFTDK  86

Query  386  RIGEQNEELG  415
            R GE N  + 
Sbjct  87   RFGEYNSNIS  96



>ref|XP_008422663.1| PREDICTED: nucleolar protein 14 isoform X1 [Poecilia reticulata]
Length=871

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS AI KRK TLLKEY+Q  KS+ F+D+R+G
Sbjct  26   NPFEVKINRKKFDVLGRKGKHDVGLPGVSRSKAINKRKETLLKEYKQKNKSNKFIDRRLG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDAKMAPEDKIL  98



>ref|XP_006830005.1| hypothetical protein AMTR_s05743p00005480 [Amborella trichopoda]
 gb|ERM97421.1| hypothetical protein AMTR_s05743p00005480 [Amborella trichopoda]
Length=99

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  170  SGPKAIGMKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEK  322
            S  +A  MK +A    +PFE++W+R KF+ILGKKRKGEERRIG ARS+AIEK
Sbjct  29   SARQAAAMKQQASVKVSPFESLWTRSKFNILGKKRKGEERRIGQARSIAIEK  80



>ref|XP_008422664.1| PREDICTED: nucleolar protein 14 isoform X2 [Poecilia reticulata]
Length=848

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS AI KRK TLLKEY+Q  KS+ F+D+R+G
Sbjct  26   NPFEVKINRKKFDVLGRKGKHDVGLPGVSRSKAINKRKETLLKEYKQKNKSNKFIDRRLG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDAKMAPEDKIL  98



>ref|XP_007559019.1| PREDICTED: nucleolar protein 14 [Poecilia formosa]
Length=876

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS AI KRK TLLKEY+Q  KS+ F+D+R+G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAIIKRKETLLKEYKQKNKSNKFIDRRLG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDAKMAPEDKIL  98



>ref|XP_008324317.1| PREDICTED: nucleolar protein 14 [Cynoglossus semilaevis]
Length=886

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS AI KRK TLLKE++Q  KSS F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKTKHDVGLPGVSRSKAINKRKETLLKEFKQKNKSSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>ref|XP_004396256.1| PREDICTED: nucleolar protein 14 [Odobenus rosmarus divergens]
Length=854

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K +    + G++R+ A++KR  TLLKEY++  KS++F DK
Sbjct  27   PNPNPFEVKVNRQKFPVLGRKARHAVGQPGVSRARAVQKRTQTLLKEYKERDKSNIFTDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  87   RFGEYNSNMSSEEKMV  102



>ref|XP_004715155.1| PREDICTED: nucleolar protein 14 [Echinops telfairi]
Length=788

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +  + G++R+ AI+KR  TLLKEY++  KS++F DK
Sbjct  15   PKPNPFEVKVNRQKFQVLGRKTRHDVGQPGVSRARAIKKRTQTLLKEYKERDKSNIFKDK  74

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  75   RFGEYNSSMSSEEKML  90



>ref|XP_004074632.1| PREDICTED: nucleolar protein 14 [Oryzias latipes]
Length=867

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF++LG+K K +    G++RS AI KRK TLLKEY+Q  K+S FVD+R+G
Sbjct  26   NPFEVKINRKKFEVLGRKTKHDVGLPGVSRSKAINKRKETLLKEYKQKNKASKFVDRRLG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDAKIAPEDKIL  98



>ref|XP_006893679.1| PREDICTED: nucleolar protein 14 [Elephantulus edwardii]
Length=860

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF ILG+K + +    G++R+ A++KR  TLLKEY++  K+SVF DK
Sbjct  27   PNPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAVKKRTQTLLKEYKERDKASVFRDK  86

Query  386  RIGEQNEEL  412
            R GE N  L
Sbjct  87   RFGEYNSNL  95



>ref|XP_002946166.1| hypothetical protein VOLCADRAFT_102784 [Volvox carteri f. nagariensis]
 gb|EFJ53161.1| hypothetical protein VOLCADRAFT_102784 [Volvox carteri f. nagariensis]
Length=1105

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +2

Query  191  MKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            MK K   PNPFE   S+  FD +G++  G+++ +  AR  A+ +RK TLL EY Q  K++
Sbjct  22   MKAKPKKPNPFELKGSKGHFDTIGRRVSGKKQNVIQARQEAVNRRKKTLLVEYRQLRKAN  81

Query  371  VFVDKRIGEQNEELGEFDKAI  433
             F+D+R GE + EL E DK I
Sbjct  82   TFIDRRFGETDPELTETDKGI  102



>ref|XP_005666568.1| PREDICTED: nucleolar protein 14, partial [Sus scrofa]
Length=611

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  27   PNPNPFEVKVNRQKFQVLGRKTRHDVGMPGVSRARALQKRTQTLLKEYKERDKSNVFTDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE +  L   +K +
Sbjct  87   RFGEYDSNLSPEEKML  102



>ref|XP_011401646.1| Nucleolar protein 14 [Auxenochlorella protothecoides]
 gb|KFM28610.1| Nucleolar protein 14 [Auxenochlorella protothecoides]
Length=613

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  173  GP--KAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKE  346
            GP  K  G K   P PN FE + S +KFD+LG+K+    +     RS A E RKNTLL E
Sbjct  6    GPVKKRYGSKKAEPVPNLFERLSSHKKFDVLGRKKLNGPQEKSRLRSAAHELRKNTLLVE  65

Query  347  YEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            Y+Q  KS+ F+D+R GE +E L   +KA+
Sbjct  66   YKQLRKSNAFIDRRFGEDDESLTADEKAL  94



>dbj|BAB27758.1| unnamed protein product [Mus musculus]
Length=301

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRF  88

Query  392  GEQNEEL  412
            GE N  +
Sbjct  89   GEYNSNI  95



>ref|XP_010589643.1| PREDICTED: nucleolar protein 14 isoform X3 [Loxodonta africana]
Length=716

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A G+K K P PNPFE   +++KF ILG+K + +    G++R+ AI+KR  TLLKEY+   
Sbjct  20   ARGVKAK-PNPNPFEVKVNKQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKDRN  78

Query  362  KSSVFVDKRIGEQNEELGEFDKAI  433
            KS+VF DKR GE N  L   +K +
Sbjct  79   KSNVFKDKRFGEYNSNLSPEEKMM  102



>ref|XP_009939212.1| PREDICTED: nucleolar protein 14 [Opisthocomus hoazin]
Length=869

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 16/101 (16%)
 Frame = +2

Query  179  KAIGMKLKAPAP----------------NPFEAIWSRRKFDILGKKRKGEERRIGLARSL  310
            KA   K K PAP                NPFE   +R+KFDILG+K K +    G++RS 
Sbjct  3    KAAKRKRKVPAPAAAKGPVKSAMAMVKSNPFEVKVNRQKFDILGRKTKNDVGLPGVSRSK  62

Query  311  AIEKRKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAI  433
            AI+KR  TLLKEY++  K++VF DKR GE N ++   +K I
Sbjct  63   AIKKRTQTLLKEYKEREKTNVFKDKRFGEYNTKISPEEKMI  103



>ref|XP_006789083.1| PREDICTED: nucleolar protein 14-like [Neolamprologus brichardi]
Length=865

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS A+ KRK TLLKEY+Q  + S F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAVNKRKETLLKEYKQKNRCSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>ref|XP_002916607.1| PREDICTED: nucleolar protein 14 [Ailuropoda melanoleuca]
Length=828

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  197  LKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVF  376
            ++ P PNPFE   +R+KF +LG+K +    + G++R+ A++KR  TLLKEY++  KS+VF
Sbjct  1    MEGPNPNPFEVKVNRQKFPVLGRKARHAVGQPGVSRARAVQKRTQTLLKEYKERDKSNVF  60

Query  377  VDKRIGEQNEELGEFDKAI  433
             DKR GE +  +   +K I
Sbjct  61   TDKRFGEYSSNMSPEEKMI  79



>ref|XP_004549661.1| PREDICTED: nucleolar protein 14-like isoform X1 [Maylandia zebra]
 ref|XP_004549662.1| PREDICTED: nucleolar protein 14-like isoform X2 [Maylandia zebra]
Length=864

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS A+ KRK TLLKEY+Q  + S F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAVNKRKETLLKEYKQKNRCSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>gb|ELK06562.1| Nucleolar protein 14 [Pteropus alecto]
Length=771

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P  NPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  KS+VFVDK
Sbjct  24   PNSNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARAIQKRCRTLLKEYKERDKSNVFVDK  83

Query  386  RIGEQN  403
            R+GE N
Sbjct  84   RLGEYN  89



>ref|XP_005931265.1| PREDICTED: nucleolar protein 14-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005931266.1| PREDICTED: nucleolar protein 14-like isoform X2 [Haplochromis 
burtoni]
Length=862

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS A+ KRK TLLKEY+Q  + S F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAVNKRKETLLKEYKQKNRCSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>ref|XP_005720460.1| PREDICTED: nucleolar protein 14-like isoform X1 [Pundamilia nyererei]
 ref|XP_005720461.1| PREDICTED: nucleolar protein 14-like isoform X2 [Pundamilia nyererei]
Length=862

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFD+LG+K K +    G++RS A+ KRK TLLKEY+Q  + S F+D+R G
Sbjct  26   NPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAVNKRKETLLKEYKQKNRCSKFIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>ref|XP_008149121.1| PREDICTED: nucleolar protein 14 [Eptesicus fuscus]
Length=850

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P  NPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY +  KS+VF+DK
Sbjct  27   PNSNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARAIQKRTQTLLKEYRERDKSNVFIDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  L   +K +
Sbjct  87   RFGEYNSSLSAEEKMM  102



>ref|XP_005016238.1| PREDICTED: nucleolar protein 14 isoform X2 [Anas platyrhynchos]
Length=871

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKEKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_006751589.1| PREDICTED: nucleolar protein 14-like [Leptonychotes weddellii]
Length=588

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K +    + G++R+ AI+KR  TLLKEY++  KS+VF DK
Sbjct  27   PIPNPFEVKVNRQKFPVLGRKARHAVGQPGVSRARAIQKRTQTLLKEYKERDKSNVFTDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE +  +   +K +
Sbjct  87   RFGEYSSNMSSEEKMM  102



>ref|XP_005016237.1| PREDICTED: nucleolar protein 14 isoform X1 [Anas platyrhynchos]
 gb|EOB03824.1| Nucleolar protein 14, partial [Anas platyrhynchos]
Length=884

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKEKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>gb|ERE89773.1| nucleolar protein 14 [Cricetulus griseus]
Length=1279

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  197  LKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVF  376
            L    PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF
Sbjct  66   LAKANPNPFEVKVNRQKFHILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVF  125

Query  377  VDKRIGEQNEELGEFDKAI  433
             DKR GE N  +   +K +
Sbjct  126  TDKRFGEYNSNISPEEKMM  144



>ref|XP_010740964.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Larimichthys 
crocea]
Length=877

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI KRK TLLKEY+Q  KS+  +D+R G
Sbjct  26   NPFEVKINRKKFDILGRKSKHDVGLPGVSRSKAINKRKETLLKEYKQKNKSNKLIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>gb|KFR15697.1| Nucleolar protein 14, partial [Opisthocomus hoazin]
Length=840

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_011372092.1| PREDICTED: nucleolar protein 14 [Pteropus vampyrus]
Length=845

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P  NPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  KS+VFVDK
Sbjct  24   PNSNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARAIQKRCRTLLKEYKERDKSNVFVDK  83

Query  386  RIGEQN  403
            R+GE N
Sbjct  84   RLGEYN  89



>ref|XP_006919086.1| PREDICTED: nucleolar protein 14 [Pteropus alecto]
Length=845

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P  NPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  KS+VFVDK
Sbjct  24   PNSNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARAIQKRCRTLLKEYKERDKSNVFVDK  83

Query  386  RIGEQN  403
            R+GE N
Sbjct  84   RLGEYN  89



>ref|XP_005045555.1| PREDICTED: nucleolar protein 14 [Ficedula albicollis]
Length=871

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKITPEEKMI  103



>ref|XP_008294954.1| PREDICTED: nucleolar protein 14 [Stegastes partitus]
Length=874

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI KRK TLLKEY+Q  KS+  +D+R G
Sbjct  26   NPFEVKINRKKFDILGRKTKHDVGLPGVSRSKAITKRKETLLKEYKQKNKSNKLIDRRFG  85

Query  395  EQNEELGEFDKAI  433
            E + ++   DK +
Sbjct  86   EYDTKMAPEDKIL  98



>ref|XP_010589641.1| PREDICTED: nucleolar protein 14 isoform X1 [Loxodonta africana]
Length=896

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A G+K K P PNPFE   +++KF ILG+K + +    G++R+ AI+KR  TLLKEY+   
Sbjct  20   ARGVKAK-PNPNPFEVKVNKQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKDRN  78

Query  362  KSSVFVDKRIGEQNEELGEFDKAI  433
            KS+VF DKR GE N  L   +K +
Sbjct  79   KSNVFKDKRFGEYNSNLSPEEKMM  102



>ref|NP_001099483.1| nucleolar protein 14 [Rattus norvegicus]
 gb|EDM00085.1| similar to 2610033H07Rik protein (predicted), isoform CRA_c [Rattus 
norvegicus]
Length=640

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEEL  412
            GE N  +
Sbjct  89   GEYNSNI  95



>gb|EDM00083.1| similar to 2610033H07Rik protein (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=653

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_003707475.1| PREDICTED: uncharacterized protein LOC100883638 [Megachile rotundata]
Length=920

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   ++ K ++LGKK K ++   G++R+ AI KRK TLL+EY+   K+++F+DKRIG
Sbjct  25   NPFEVHINKDKQNVLGKKSKADKGLPGISRAKAINKRKGTLLQEYKLKNKANLFLDKRIG  84

Query  395  EQNEELGEFDKAI  433
            E+N  + E DKAI
Sbjct  85   EKNVNMNEEDKAI  97



>ref|XP_008919170.1| PREDICTED: nucleolar protein 14 [Manacus vitellinus]
Length=867

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR +TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTHTLLKEYKEREKANVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N  +   +K I
Sbjct  91   EYNTNITPEEKMI  103



>ref|XP_003411301.1| PREDICTED: nucleolar protein 14 isoform X2 [Loxodonta africana]
Length=857

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A G+K K P PNPFE   +++KF ILG+K + +    G++R+ AI+KR  TLLKEY+   
Sbjct  20   ARGVKAK-PNPNPFEVKVNKQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKDRN  78

Query  362  KSSVFVDKRIGEQNEELG  415
            KS+VF DKR GE N  L 
Sbjct  79   KSNVFKDKRFGEYNSNLS  96



>ref|XP_007060093.1| PREDICTED: nucleolar protein 14 [Chelonia mydas]
 gb|EMP35551.1| Nucleolar protein 14 [Chelonia mydas]
Length=869

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +2

Query  170  SGPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            +GP   GM L     NPFE   +++KF+ILG++ K +    G++RS A++KR  TLLKEY
Sbjct  18   TGPSGAGMAL--VKNNPFEVKINKQKFNILGRRTKHDVGLPGVSRSKAVKKRTQTLLKEY  75

Query  350  EQSAKSSVFVDKRIGEQNEELG  415
            ++  KSSVF DKR GE N ++ 
Sbjct  76   KEREKSSVFKDKRFGEYNTKIS  97



>ref|XP_010846260.1| PREDICTED: nucleolar protein 14 [Bison bison bison]
Length=871

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A+G + + P PNPFE   +R+KF +LG+K + +    G++R+ A++KR  TLLKEY++  
Sbjct  19   ALGSRAR-PNPNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARALQKRTQTLLKEYKERD  77

Query  362  KSSVFVDKRIGEQNEELGEFDKAI  433
            KS+VF DKR GE N  +   +K +
Sbjct  78   KSNVFRDKRFGEYNSSISPEEKMM  101



>emb|CAN71710.1| hypothetical protein VITISV_013457 [Vitis vinifera]
Length=392

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  323  RKNTLLKEYEQSAKSSVFVDKRIGEQNEELGEFDKAIlrsqrerrlklkkkskynlsDGE  502
            R  TLLKEYEQSAKSSVF+DKRIGEQN+ LGEFDKAILRSQRER+LKLKKKSKYNLSDGE
Sbjct  262  RNATLLKEYEQSAKSSVFLDKRIGEQNDALGEFDKAILRSQRERQLKLKKKSKYNLSDGE  321

Query  503  E  505
            E
Sbjct  322  E  322



>ref|XP_003773477.1| PREDICTED: nucleolar protein 14 [Sarcophilus harrisii]
Length=863

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKINRQKFQILGRKTRHDVGLPGISRAKAIKKRTQTLLKEYKERDKSNVFTDKRF  88

Query  392  GEQNEELG  415
            GE N ++ 
Sbjct  89   GEYNTKIS  96



>ref|XP_005319061.1| PREDICTED: nucleolar protein 14 [Ictidomys tridecemlineatus]
Length=860

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G+AR+ AI KR  TLLKEY++  KS++F DKR 
Sbjct  29   PNPFEVKINRQKFQILGRKTRHDVGLPGVARARAIRKRTQTLLKEYKERDKSNIFTDKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_010400302.1| PREDICTED: nucleolar protein 14 [Corvus cornix cornix]
Length=864

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKITPEEKMI  103



>ref|NP_001092466.1| nucleolar protein 14 [Bos taurus]
 gb|AAI42445.1| NOP14 protein [Bos taurus]
 tpg|DAA28436.1| TPA: probable nucleolar complex protein 14 [Bos taurus]
Length=869

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  26   PNPNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARALQKRTQTLLKEYKERDKSNVFRDK  85

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  86   RFGEYNSSISPEEKMM  101



>gb|KFW78478.1| Nucleolar protein 14, partial [Manacus vitellinus]
Length=838

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR +TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTHTLLKEYKEREKANVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N  +   +K I
Sbjct  62   EYNTNITPEEKMI  74



>ref|XP_009097328.1| PREDICTED: nucleolar protein 14 [Serinus canaria]
Length=867

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKITPEEKMI  103



>ref|XP_008643293.1| PREDICTED: nucleolar protein 14 [Corvus brachyrhynchos]
Length=863

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKITPEEKMI  103



>ref|XP_006251254.1| PREDICTED: nucleolar protein 14 isoform X1 [Rattus norvegicus]
 gb|EDM00084.1| similar to 2610033H07Rik protein (predicted), isoform CRA_b [Rattus 
norvegicus]
Length=862

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_006074689.1| PREDICTED: nucleolar protein 14 [Bubalus bubalis]
Length=871

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  26   PNPNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARALQKRTQTLLKEYKERDKSNVFRDK  85

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  86   RFGEYNSSISPEEKMM  101



>ref|XP_005485746.1| PREDICTED: nucleolar protein 14 [Zonotrichia albicollis]
Length=871

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKITPEEKMI  103



>gb|KFO55257.1| Nucleolar protein 14, partial [Corvus brachyrhynchos]
Length=834

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKITPEEKMI  74



>ref|XP_006985628.1| PREDICTED: nucleolar protein 14 [Peromyscus maniculatus bairdii]
Length=862

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSSMS  96



>gb|EFB15587.1| hypothetical protein PANDA_004689 [Ailuropoda melanoleuca]
Length=827

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K +    + G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  3    PNPNPFEVKVNRQKFPVLGRKARHAVGQPGVSRARAVQKRTQTLLKEYKERDKSNVFTDK  62

Query  386  RIGEQNEELGEFDKAI  433
            R GE +  +   +K I
Sbjct  63   RFGEYSSNMSPEEKMI  78



>ref|XP_005424788.1| PREDICTED: nucleolar protein 14 [Geospiza fortis]
Length=877

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKITPEEKMI  103



>ref|XP_009910710.1| PREDICTED: nucleolar protein 14 isoform X2 [Haliaeetus albicilla]
Length=839

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP  + M +     NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY+
Sbjct  19   GPVKLAMAM--VKSNPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYK  76

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +  K++VF DKR GE N ++   +K I
Sbjct  77   EREKTNVFKDKRFGEYNAKISPEEKMI  103



>ref|XP_010581824.1| PREDICTED: nucleolar protein 14 isoform X2 [Haliaeetus leucocephalus]
Length=839

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP  + M +     NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY+
Sbjct  19   GPVKLAMAM--VKSNPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYK  76

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +  K++VF DKR GE N ++   +K I
Sbjct  77   EREKTNVFKDKRFGEYNAKISPEEKMI  103



>ref|XP_005208306.1| PREDICTED: nucleolar protein 14 isoform X1 [Bos taurus]
Length=919

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K + +    G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  26   PNPNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARALQKRTQTLLKEYKERDKSNVFRDK  85

Query  386  RIGEQNEELGEFDKAI  433
            R GE N  +   +K +
Sbjct  86   RFGEYNSSISPEEKMM  101



>ref|XP_005517935.1| PREDICTED: nucleolar protein 14 [Pseudopodoces humilis]
Length=873

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N  +   +K I
Sbjct  91   EYNTRITPEEKMI  103



>ref|XP_009910711.1| PREDICTED: nucleolar protein 14 isoform X3 [Haliaeetus albicilla]
Length=807

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP  + M +     NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY+
Sbjct  19   GPVKLAMAM--VKSNPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYK  76

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +  K++VF DKR GE N ++   +K I
Sbjct  77   EREKTNVFKDKRFGEYNAKISPEEKMI  103



>dbj|BAE36550.1| unnamed protein product [Mus musculus]
Length=788

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_009991109.1| PREDICTED: nucleolar protein 14 [Tauraco erythrolophus]
Length=874

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY+   K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKDREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>gb|EWM22059.1| Nop14-like protein [Nannochloropsis gaditana]
Length=1001

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  173  GPKAIGMKLKAPAP----NPFEAIWSRR-KFDILGKKRKGEERRIGLARSLAIEKRKNTL  337
            GP   G +    +P    NPF+A+ +RR KF +L K+ KG+ R +G AR +A+E+RK TL
Sbjct  39   GPLGPGSRSTTRSPTASGNPFDAVGNRRAKFTVLNKRAKGQVRNVGKARQMAVERRKKTL  98

Query  338  LKEYEQSAKSSVFVDKRIGEQNEEL  412
            L EY  S K +VF D+R GE +  L
Sbjct  99   LVEYRASKKDNVFKDRRFGEDDPTL  123



>ref|XP_010581823.1| PREDICTED: nucleolar protein 14 isoform X1 [Haliaeetus leucocephalus]
Length=869

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP  + M +     NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY+
Sbjct  19   GPVKLAMAM--VKSNPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYK  76

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +  K++VF DKR GE N ++   +K I
Sbjct  77   EREKTNVFKDKRFGEYNAKISPEEKMI  103



>ref|XP_009910709.1| PREDICTED: nucleolar protein 14 isoform X1 [Haliaeetus albicilla]
Length=869

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP  + M +     NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY+
Sbjct  19   GPVKLAMAM--VKSNPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYK  76

Query  353  QSAKSSVFVDKRIGEQNEELGEFDKAI  433
            +  K++VF DKR GE N ++   +K I
Sbjct  77   EREKTNVFKDKRFGEYNAKISPEEKMI  103



>gb|KFV07563.1| Nucleolar protein 14, partial [Tauraco erythrolophus]
Length=845

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY+   K++VF DKR G
Sbjct  2    NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKDREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|ERE89774.1| nucleolar protein 14 [Cricetulus griseus]
Length=1237

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFHILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEEL  412
            GE N  +
Sbjct  89   GEYNSNI  95



>ref|XP_006875374.1| PREDICTED: nucleolar protein 14 [Chrysochloris asiatica]
Length=862

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  182  AIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSA  361
            A G+K K P PNPFE   +R+KF +LG+K + +    G++R+ AI+KR  TLLKEY++  
Sbjct  20   ARGVKAK-PNPNPFEVKVNRQKFQVLGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKERE  78

Query  362  KSSVFVDKRIGEQNEELGEFDKAI  433
            KS+VF D+R GE N  +   +K +
Sbjct  79   KSNVFKDRRFGEYNRNMSPEEKMM  102



>ref|XP_004579437.1| PREDICTED: nucleolar protein 14 [Ochotona princeps]
Length=837

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF +LG++ + +    G++R+ A++KR  TLLKEY++  KSSVF+DKR 
Sbjct  22   PNPFEVKVNRQKFQVLGRRTRHDVGLPGVSRARALKKRTQTLLKEYKERDKSSVFLDKRF  81

Query  392  GEQNEELGEFDKAI  433
            GE    +   DK +
Sbjct  82   GEYEHSMSAEDKML  95



>ref|XP_006128328.1| PREDICTED: nucleolar protein 14-like [Pelodiscus sinensis]
Length=166

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = +2

Query  173  GPKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYE  352
            GP   G  +     NPFE   +++KF ILG+K K +    G++RS A++KR  TLLKEY+
Sbjct  19   GPSGAGTSM--VKNNPFEVKVNKQKFHILGRKTKHDVGLPGISRSKAVKKRTQTLLKEYK  76

Query  353  QSAKSSVFVDKRIGEQNEEL  412
            +  KS++F DKR GE N ++
Sbjct  77   ERGKSNIFKDKRFGEYNTKI  96



>ref|XP_003508887.1| PREDICTED: nucleolar protein 14 [Cricetulus griseus]
 ref|XP_007609705.1| PREDICTED: nucleolar protein 14 [Cricetulus griseus]
Length=863

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFHILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_009477825.1| PREDICTED: nucleolar protein 14 [Pelecanus crispus]
Length=870

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  KS+VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKSNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>gb|EDL37464.1| RIKEN cDNA 2610033H07, isoform CRA_b [Mus musculus]
Length=868

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  37   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRF  96

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  97   GEYNSNIS  104



>ref|XP_005998250.1| PREDICTED: nucleolar protein 14-like [Latimeria chalumnae]
Length=834

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +++KF+ILG+K K +    G++RS AI+KRK TLL EY+Q  KS+ F+DKR G
Sbjct  25   NPFEVKINKQKFNILGRKTKHDHGLPGVSRSKAIKKRKETLLNEYKQKDKSNTFIDKRFG  84

Query  395  EQNEELG  415
            E + +L 
Sbjct  85   EYDTKLA  91



>gb|AAH24998.1| NOP14 nucleolar protein homolog (yeast) [Mus musculus]
Length=860

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_005365968.1| PREDICTED: nucleolar protein 14 [Microtus ochrogaster]
Length=859

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|NP_083554.2| nucleolar protein 14 [Mus musculus]
 sp|Q8R3N1.2|NOP14_MOUSE RecName: Full=Nucleolar protein 14; AltName: Full=Nucleolar complex 
protein 14 [Mus musculus]
 gb|AAH43043.1| NOP14 nucleolar protein homolog (yeast) [Mus musculus]
 gb|EDL37463.1| RIKEN cDNA 2610033H07, isoform CRA_a [Mus musculus]
Length=860

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRF  88

Query  392  GEQNEELG  415
            GE N  + 
Sbjct  89   GEYNSNIS  96



>ref|XP_003397298.1| PREDICTED: nucleolar protein 14-like isoform 1 [Bombus terrestris]
 ref|XP_003397299.1| PREDICTED: nucleolar protein 14-like isoform 2 [Bombus terrestris]
Length=884

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  200  KAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFV  379
            K  + NPFE   ++ K ++LG+K K ++   G++R+ AI+KRK TLL+EY+   K ++F+
Sbjct  21   KKKSLNPFEVHVNKNKQNVLGRKSKTDDGLPGVSRAKAIKKRKQTLLQEYKLKNKDNLFL  80

Query  380  DKRIGEQNEELGEFDKAI  433
            DKRIGE+N  L E DKA+
Sbjct  81   DKRIGEKNLSLSEEDKAL  98



>ref|XP_003490222.1| PREDICTED: nucleolar protein 14-like [Bombus impatiens]
Length=883

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  200  KAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFV  379
            K  + NPFE   ++ K ++LG+K K +E   G++R+ AI+KRK TLL+EY+   K ++F+
Sbjct  21   KKKSLNPFEVHVNKNKQNVLGRKSKTDEGLPGVSRAKAIKKRKETLLQEYKLKNKDNLFL  80

Query  380  DKRIGEQNEELGEFDKAI  433
            D+RIGE+N  L E DKA+
Sbjct  81   DRRIGEKNLSLNEEDKAL  98



>ref|XP_004999946.1| PREDICTED: nucleolar protein 14 isoform X2 [Cavia porcellus]
Length=755

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +2

Query  200  KAPA---PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            KAPA   PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+
Sbjct  15   KAPAKTSPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERDKSN  74

Query  371  VFVDKRIGEQNEEL  412
            VF D+R GE +  L
Sbjct  75   VFKDRRFGEYDHSL  88



>ref|XP_004656062.1| PREDICTED: nucleolar protein 14 [Jaculus jaculus]
Length=867

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFTDKRF  88

Query  392  GEQNEELGEFDKAI  433
            GE N  +   +K +
Sbjct  89   GEYNSNISPEEKMM  102



>gb|KFQ50030.1| Nucleolar protein 14, partial [Pelecanus crispus]
Length=841

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  KS+VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKSNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_010311187.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Balearica 
regulorum gibbericeps]
Length=875

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR +TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTHTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_003461905.1| PREDICTED: nucleolar protein 14 isoform X1 [Cavia porcellus]
Length=843

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +2

Query  200  KAPA---PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            KAPA   PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+
Sbjct  15   KAPAKTSPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERDKSN  74

Query  371  VFVDKRIGEQNEELG  415
            VF D+R GE +  L 
Sbjct  75   VFKDRRFGEYDHSLS  89



>ref|XP_010957526.1| PREDICTED: nucleolar protein 14, partial [Camelus bactrianus]
Length=852

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF ILG+K + +    G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  24   PNPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALQKRTQTLLKEYKERDKSNVFKDK  83

Query  386  RIGEQNEELGEFDKAI  433
            R GE + ++   +K +
Sbjct  84   RFGEYSSDISPEEKML  99



>ref|XP_011309439.1| PREDICTED: nucleolar protein 14 homolog [Fopius arisanus]
Length=890

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  194  KLKAPAP-NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            KL+   P NPFE   ++ K  +LG+K K +    G+AR+ AI+KRK+TLL+E+ Q  K +
Sbjct  20   KLEGKKPINPFEVHINKDKQKVLGRKSKADRGLPGVARTKAIKKRKHTLLQEFTQRDKDN  79

Query  371  VFVDKRIGEQNEELGEFDKAI  433
            VF+DKRIGE+N  + + +KAI
Sbjct  80   VFMDKRIGERNASMSQEEKAI  100



>ref|XP_010995891.1| PREDICTED: nucleolar protein 14 [Camelus dromedarius]
Length=855

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF ILG+K + +    G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  27   PNPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALQKRTQTLLKEYKERDKSNVFKDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE + ++   +K +
Sbjct  87   RFGEYSSDISPEEKML  102



>ref|XP_536223.3| PREDICTED: nucleolar protein 14 [Canis lupus familiaris]
Length=857

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K +    + G++R+ A++KR  TLLKEY++  KS+VF DK
Sbjct  27   PNPNPFEVKVNRQKFPVLGRKARHAVGQPGVSRARAVQKRTQTLLKEYKERDKSNVFTDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE +  +   +K +
Sbjct  87   RFGEYSSSMSPEEKMM  102



>gb|KFO08067.1| Nucleolar protein 14, partial [Balearica regulorum gibbericeps]
Length=828

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR +TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTHTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_005408814.1| PREDICTED: nucleolar protein 14 [Chinchilla lanigera]
Length=857

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +2

Query  200  KAPA---PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSS  370
            +APA   PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+
Sbjct  15   RAPAKINPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERDKSN  74

Query  371  VFVDKRIGEQNEELGEFDKAI  433
            VF DKR+GE + ++   +K +
Sbjct  75   VFKDKRLGEYSSDMSPEEKMM  95



>ref|XP_010170164.1| PREDICTED: nucleolar protein 14-like, partial [Caprimulgus carolinensis]
Length=445

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  34   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKERGKTNVFKDKRFG  93

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  94   EYNTKISPEEKMI  106



>ref|XP_010708784.1| PREDICTED: nucleolar protein 14 isoform X2 [Meleagris gallopavo]
Length=625

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKEKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_001950397.2| PREDICTED: nucleolar protein 14 [Acyrthosiphon pisum]
Length=835

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   + +KF ILG+K K E  + G+ARS +I+KRK +LL EY+   KS+ FVD+RIG
Sbjct  12   NPFELHINNKKFTILGRKSKNEVGKPGIARSKSIQKRKKSLLLEYKLKDKSNKFVDRRIG  71

Query  395  EQNEELGEFDKAI  433
            E+N  +   D+ I
Sbjct  72   EKNRAMTADDRVI  84



>ref|XP_010708783.1| PREDICTED: nucleolar protein 14 isoform X1 [Meleagris gallopavo]
Length=668

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKEKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_010891122.1| PREDICTED: nucleolar protein 14 [Esox lucius]
Length=859

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI KRK TLLKEY+   KS+ F+DKR G
Sbjct  27   NPFEVKINRKKFDILGRKSKHDVGLPGVSRSKAINKRKETLLKEYKTKDKSNKFIDKRFG  86

Query  395  EQNEEL  412
            E + ++
Sbjct  87   EYDTKM  92



>ref|XP_420824.2| PREDICTED: nucleolar protein 14 [Gallus gallus]
Length=878

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKEKTNVFRDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_010147382.1| PREDICTED: nucleolar protein 14 [Eurypyga helias]
Length=869

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009283658.1| PREDICTED: nucleolar protein 14 [Aptenodytes forsteri]
Length=870

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_005229872.1| PREDICTED: nucleolar protein 14 [Falco peregrinus]
Length=873

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_005446467.1| PREDICTED: nucleolar protein 14 [Falco cherrug]
Length=873

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_004847426.1| PREDICTED: nucleolar protein 14 [Heterocephalus glaber]
Length=916

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY+   KS+VF DKR 
Sbjct  90   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKDRDKSNVFKDKRF  149

Query  392  GEQNEELGEFDKAI  433
            GE N ++   +K +
Sbjct  150  GEYNSDISPEEKML  163



>ref|XP_004890977.1| PREDICTED: nucleolar protein 14 [Heterocephalus glaber]
Length=916

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY+   KS+VF DKR 
Sbjct  90   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKDRDKSNVFKDKRF  149

Query  392  GEQNEELGEFDKAI  433
            GE N ++   +K +
Sbjct  150  GEYNSDISPEEKML  163



>ref|XP_003801185.1| PREDICTED: nucleolar protein 14 [Otolemur garnettii]
Length=852

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +2

Query  203  APA---PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSV  373
            APA   PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY +  KS+V
Sbjct  19   APARVCPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYRERDKSNV  78

Query  374  FVDKRIGEQNEELGEFDKAI  433
            F DKR GE N  +   +K +
Sbjct  79   FRDKRFGEYNSNISPEEKMM  98



>gb|KFP54466.1| Nucleolar protein 14, partial [Cathartes aura]
Length=530

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_010294100.1| PREDICTED: nucleolar protein 14 [Phaethon lepturus]
Length=866

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009579844.1| PREDICTED: nucleolar protein 14 [Fulmarus glacialis]
Length=868

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009684460.1| PREDICTED: nucleolar protein 14 [Struthio camelus australis]
Length=875

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  KS+VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKDKSNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E + +L   +K I
Sbjct  91   EYDTKLSPEEKMI  103



>gb|KFM11679.1| Nucleolar protein 14, partial [Aptenodytes forsteri]
Length=841

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|EHB06980.1| Nucleolar protein 14 [Heterocephalus glaber]
Length=848

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY+   KS+VF DKR 
Sbjct  22   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKDRDKSNVFKDKRF  81

Query  392  GEQNEELGEFDKAI  433
            GE N ++   +K +
Sbjct  82   GEYNSDISPEEKML  95



>gb|KFQ80497.1| Nucleolar protein 14, partial [Phoenicopterus ruber ruber]
Length=839

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFZ63660.1| Nucleolar protein 14, partial [Podiceps cristatus]
Length=846

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNSKISPEEKMI  74



>gb|KFW02882.1| Nucleolar protein 14, partial [Eurypyga helias]
Length=831

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_010071422.1| PREDICTED: nucleolar protein 14 [Pterocles gutturalis]
Length=872

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009699167.1| PREDICTED: nucleolar protein 14 [Cariama cristata]
Length=870

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009888816.1| PREDICTED: nucleolar protein 14 [Charadrius vociferus]
Length=865

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_010139826.1| PREDICTED: nucleolar protein 14 [Buceros rhinoceros silvestris]
Length=871

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009814608.1| PREDICTED: nucleolar protein 14 [Gavia stellata]
Length=860

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_005148574.1| PREDICTED: nucleolar protein 14 [Melopsittacus undulatus]
Length=866

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009864225.1| PREDICTED: nucleolar protein 14 [Apaloderma vittatum]
Length=869

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFRDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_007496879.1| PREDICTED: nucleolar protein 14 [Monodelphis domestica]
Length=855

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  173  GPKAIGMKLKAPA-PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEY  349
            G +A   + K PA  NPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY
Sbjct  10   GSQAGVQRAKPPANSNPFEVKINRQKFHILGRKTRHDVGLPGISRAKAIKKRTQTLLKEY  69

Query  350  EQSAKSSVFVDKRIGEQNEELG  415
            ++  KS+VF DKR GE N ++ 
Sbjct  70   KERDKSNVFTDKRFGEYNTKIS  91



>gb|KFV44585.1| Nucleolar protein 14, partial [Gavia stellata]
Length=831

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_009641499.1| PREDICTED: nucleolar protein 14 [Egretta garzetta]
Length=871

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>gb|KFV94056.1| Nucleolar protein 14, partial [Fulmarus glacialis]
Length=839

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KGL97661.1| Nucleolar protein 14, partial [Charadrius vociferus]
Length=836

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFQ64808.1| Nucleolar protein 14, partial [Phaethon lepturus]
Length=837

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFO93083.1| Nucleolar protein 14, partial [Buceros rhinoceros silvestris]
Length=842

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFP99075.1| Nucleolar protein 14, partial [Haliaeetus albicilla]
Length=840

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNAKISPEEKMI  74



>gb|KFP85499.1| Nucleolar protein 14, partial [Apaloderma vittatum]
Length=838

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFRDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFP65386.1| Nucleolar protein 14, partial [Cariama cristata]
Length=841

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFP19579.1| Nucleolar protein 14, partial [Egretta garzetta]
Length=842

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|KFV06576.1| Nucleolar protein 14, partial [Pterocles gutturalis]
Length=843

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_001696589.1| nucleolar protein [Chlamydomonas reinhardtii]
 gb|EDP08566.1| nucleolar protein [Chlamydomonas reinhardtii]
Length=1137

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  176  PKAIGMKLKAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQ  355
            P A  MK +   PNPFE   S+  FD +G++  G+++ +  AR  A+ +RK TLL EY  
Sbjct  18   PLAAQMKSQPKKPNPFELKGSKGHFDTMGRRSAGKKKNVIEARQEAVNRRKKTLLVEYRS  77

Query  356  SAKSSVFVDKRIGEQNEELGEFDKAI  433
              K++ FVD+R GE + E+ E DK +
Sbjct  78   LRKANTFVDRRFGEGDPEMSEADKGL  103



>ref|XP_008946378.1| PREDICTED: nucleolar protein 14 [Merops nubicus]
Length=870

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_001640799.1| predicted protein [Nematostella vectensis]
 gb|EDO48736.1| predicted protein [Nematostella vectensis]
Length=860

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  200  KAPAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFV  379
            K    NPFE   +++K++ILG+K K +    G++RS A++KR+ TLL EY+Q  K+++FV
Sbjct  22   KTVTNNPFEVHVNKQKYEILGRKMKHDRGLPGVSRSKAMKKRQKTLLTEYKQKNKANIFV  81

Query  380  DKRIGEQNEELGEFDKAI  433
            DKR GE + E+   DK +
Sbjct  82   DKRFGENDAEMTLEDKLM  99



>gb|KFV87026.1| Nucleolar protein 14, partial [Struthio camelus australis]
Length=846

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  KS+VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEKDKSNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E + +L   +K I
Sbjct  62   EYDTKLSPEEKMI  74



>ref|XP_004772310.1| PREDICTED: nucleolar protein 14 [Mustela putorius furo]
Length=854

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  206  PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDK  385
            P PNPFE   +R+KF +LG+K +    + G++R+ A+ KR  TLLKEY++  KS+VF DK
Sbjct  27   PNPNPFEVKVNRQKFPVLGRKARHAVGQPGVSRARAVHKRTQTLLKEYKERDKSNVFTDK  86

Query  386  RIGEQNEELGEFDKAI  433
            R GE +  +   +K +
Sbjct  87   RFGEYSSTMSPEEKMM  102



>gb|KFQ21413.1| Nucleolar protein 14, partial [Merops nubicus]
Length=841

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>ref|XP_004481101.1| PREDICTED: nucleolar protein 14 [Dasypus novemcinctus]
Length=863

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  188  GMKLKA-PAPNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAK  364
            G ++KA P  NPFE   +R+KF ILG+K + +    G++R+ AI+KR  TLLKEY++  K
Sbjct  15   GTQVKAKPNLNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIKKRTQTLLKEYKERDK  74

Query  365  SSVFVDKRIGEQNEELGEFDKAI  433
            S+VF D+R GE N  +   +K +
Sbjct  75   SNVFTDRRFGEYNRNISPEEKMM  97



>ref|XP_002195362.1| PREDICTED: nucleolar protein 14 [Taeniopygia guttata]
Length=865

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFDILGRKTKNDVGLPGVSRSKAIKKRNQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E + ++   +K I
Sbjct  91   EYSTKISPEEKMI  103



>emb|CDQ79313.1| unnamed protein product [Oncorhynchus mykiss]
Length=600

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KFDILG+K K +    G++RS AI KRK TLLKEY+   K++ F+DKR G
Sbjct  26   NPFEVKINRKKFDILGRKSKHDVGLPGVSRSKAINKRKETLLKEYKTKDKANKFIDKRFG  85

Query  395  EQNEEL  412
            E + ++
Sbjct  86   EYDTKM  91



>ref|XP_009469430.1| PREDICTED: nucleolar protein 14 [Nipponia nippon]
Length=871

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKANVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_010640058.1| PREDICTED: nucleolar protein 14 isoform X2 [Fukomys damarensis]
Length=828

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +2

Query  203  APA---PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSV  373
            APA   PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY+   KS+V
Sbjct  16   APAKAKPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKDRDKSNV  75

Query  374  FVDKRIGEQNEEL  412
            F DKR GE N  +
Sbjct  76   FKDKRFGEYNSNI  88



>ref|XP_010640057.1| PREDICTED: nucleolar protein 14 isoform X1 [Fukomys damarensis]
 gb|KFO25720.1| Nucleolar protein 14 [Fukomys damarensis]
Length=831

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  203  APA---PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSV  373
            APA   PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY+   KS+V
Sbjct  16   APAKAKPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKDRDKSNV  75

Query  374  FVDKRIGEQNEELG  415
            F DKR GE N  + 
Sbjct  76   FKDKRFGEYNSNIS  89



>ref|XP_005498506.1| PREDICTED: nucleolar protein 14 [Columba livia]
 gb|EMC81453.1| Nucleolar protein 14 [Columba livia]
Length=872

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKANVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNAKISPEEKMI  103



>ref|XP_010008419.1| PREDICTED: nucleolar protein 14 [Nestor notabilis]
Length=838

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKINRQKFSILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKTNVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_006152995.1| PREDICTED: nucleolar protein 14 [Tupaia chinensis]
Length=853

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERDKSNVFKDKRF  88

Query  392  GEQN  403
            GE N
Sbjct  89   GEYN  92



>gb|KFR03907.1| Nucleolar protein 14, partial [Nipponia nippon]
Length=842

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI+KR  TLLKEY++  K++VF DKR G
Sbjct  2    NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIKKRTQTLLKEYKEREKANVFKDKRFG  61

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  62   EYNTKISPEEKMI  74



>gb|ELW62764.1| Nucleolar protein 14 [Tupaia chinensis]
Length=840

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  PNPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRI  391
            PNPFE   +R+KF ILG+K + +    G++R+ AI KR  TLLKEY++  KS+VF DKR 
Sbjct  29   PNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERDKSNVFKDKRF  88

Query  392  GEQN  403
            GE N
Sbjct  89   GEYN  92



>ref|XP_009957226.1| PREDICTED: nucleolar protein 14 [Leptosomus discolor]
Length=868

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS A++KR  TLLKEY++  K+ VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAVKKRTQTLLKEYKEREKTHVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



>ref|XP_009998569.1| PREDICTED: nucleolar protein 14 [Chaetura pelagica]
Length=871

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  215  NPFEAIWSRRKFDILGKKRKGEERRIGLARSLAIEKRKNTLLKEYEQSAKSSVFVDKRIG  394
            NPFE   +R+KF+ILG+K K +    G++RS AI KR  TLLKEY++  K++VF DKR G
Sbjct  31   NPFEVKVNRQKFNILGRKTKNDVGLPGVSRSKAIRKRTQTLLKEYKEREKANVFKDKRFG  90

Query  395  EQNEELGEFDKAI  433
            E N ++   +K I
Sbjct  91   EYNTKISPEEKMI  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510