BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012I23

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB20721.1|  hypothetical protein B456_003G161000                    140   3e-37   Gossypium raimondii
gb|KJB20720.1|  hypothetical protein B456_003G161000                    140   3e-36   Gossypium raimondii
gb|KJB20719.1|  hypothetical protein B456_003G161000                    140   3e-36   Gossypium raimondii
gb|KHG00577.1|  hypothetical protein F383_17805                         140   4e-36   Gossypium arboreum [tree cotton]
emb|CDY26592.1|  BnaA09g46850D                                          135   3e-34   Brassica napus [oilseed rape]
ref|XP_009118058.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    134   7e-34   Brassica rapa
ref|XP_009118057.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    134   8e-34   Brassica rapa
ref|XP_010553507.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   7e-33   
ref|XP_010553505.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_010553509.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   8e-33   
ref|XP_010553508.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   8e-33   
ref|XP_010553504.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   8e-33   Tarenaya hassleriana [spider flower]
emb|CDY57781.1|  BnaCnng32440D                                          130   1e-32   Brassica napus [oilseed rape]
ref|XP_010458710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    130   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008448958.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    130   2e-32   Cucumis melo [Oriental melon]
emb|CDX86759.1|  BnaA09g21490D                                          130   3e-32   
ref|XP_009124794.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    129   3e-32   Brassica rapa
ref|XP_006477422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   4e-32   Citrus sinensis [apfelsine]
ref|XP_006477421.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   4e-32   Citrus sinensis [apfelsine]
ref|XP_006477420.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   4e-32   Citrus sinensis [apfelsine]
ref|XP_004147971.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   5e-32   
ref|XP_006477418.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   5e-32   Citrus sinensis [apfelsine]
ref|XP_002887973.1|  zinc finger family protein                         129   5e-32   Arabidopsis lyrata subsp. lyrata
gb|KJB39631.1|  hypothetical protein B456_007G022500                    129   5e-32   Gossypium raimondii
ref|XP_010494577.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006477419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   5e-32   Citrus sinensis [apfelsine]
ref|XP_010476241.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    129   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006440560.1|  hypothetical protein CICLE_v10020554mg             128   7e-32   Citrus clementina [clementine]
ref|XP_006440563.1|  hypothetical protein CICLE_v10020554mg             128   7e-32   Citrus clementina [clementine]
ref|XP_006440561.1|  hypothetical protein CICLE_v10020554mg             128   7e-32   Citrus clementina [clementine]
ref|NP_172736.2|  E3 ubiquitin-protein ligase                           128   8e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08874.1|  unnamed protein product                                128   8e-32   Coffea canephora [robusta coffee]
ref|XP_011463818.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    128   8e-32   Fragaria vesca subsp. vesca
ref|XP_011463819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    128   9e-32   Fragaria vesca subsp. vesca
ref|XP_004133878.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    128   9e-32   Cucumis sativus [cucumbers]
ref|XP_006440562.1|  hypothetical protein CICLE_v10020554mg             128   1e-31   Citrus clementina [clementine]
ref|XP_010533709.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    128   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010529547.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    128   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010529546.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    127   1e-31   Tarenaya hassleriana [spider flower]
gb|EYU32071.1|  hypothetical protein MIMGU_mgv1a008136mg                127   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006391774.1|  hypothetical protein EUTSA_v10023515mg             127   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006391773.1|  hypothetical protein EUTSA_v10023515mg             127   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_011093163.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    127   1e-31   Sesamum indicum [beniseed]
ref|XP_009788378.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    122   2e-31   Nicotiana sylvestris
ref|XP_006304987.1|  hypothetical protein CARUB_v10009353mg             127   2e-31   Capsella rubella
emb|CDY16029.1|  BnaC08g40940D                                          127   2e-31   Brassica napus [oilseed rape]
ref|XP_008438088.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    127   2e-31   
ref|XP_008438087.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    127   2e-31   Cucumis melo [Oriental melon]
ref|XP_006417201.1|  hypothetical protein EUTSA_v10007780mg             127   3e-31   Eutrema salsugineum [saltwater cress]
emb|CDY31275.1|  BnaC08g15700D                                          127   3e-31   Brassica napus [oilseed rape]
ref|XP_008800795.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    126   6e-31   Phoenix dactylifera
ref|XP_006396865.1|  hypothetical protein EUTSA_v10028703mg             125   9e-31   Eutrema salsugineum [saltwater cress]
gb|KHG14407.1|  hypothetical protein F383_04260                         125   9e-31   Gossypium arboreum [tree cotton]
ref|XP_010545944.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   1e-30   Tarenaya hassleriana [spider flower]
gb|KFK31927.1|  hypothetical protein AALP_AA6G177200                    125   1e-30   Arabis alpina [alpine rockcress]
ref|XP_010545928.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_010545919.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_010545936.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   1e-30   Tarenaya hassleriana [spider flower]
gb|ACN40787.1|  unknown                                                 125   1e-30   Picea sitchensis
ref|XP_009401775.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK43535.1|  hypothetical protein AALP_AA1G139400                    125   1e-30   Arabis alpina [alpine rockcress]
ref|XP_009401774.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009778598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    124   2e-30   Nicotiana sylvestris
gb|KEH31714.1|  zinc finger, C3HC4 type (RING finger) protein           124   2e-30   Medicago truncatula
emb|CAN65431.1|  hypothetical protein VITISV_017099                     123   3e-30   Vitis vinifera
ref|XP_009762973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    124   3e-30   Nicotiana sylvestris
ref|XP_010430403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    124   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004511598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    124   4e-30   Cicer arietinum [garbanzo]
ref|NP_567379.1|  E3 ubiquitin-protein ligase                           123   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008780243.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    120   5e-30   
ref|XP_009110628.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    123   5e-30   Brassica rapa
ref|XP_009110629.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    123   5e-30   Brassica rapa
ref|XP_010473550.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    123   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010422123.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    123   6e-30   Camelina sativa [gold-of-pleasure]
emb|CAB39939.1|  putative protein                                       123   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302394.1|  hypothetical protein CARUB_v10020462mg             123   7e-30   Capsella rubella
ref|XP_010434567.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    123   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002271651.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    123   7e-30   Vitis vinifera
ref|XP_010418331.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    122   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006287901.1|  hypothetical protein CARUB_v10001135mg             122   9e-30   Capsella rubella
ref|XP_010455583.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    122   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002874711.1|  hypothetical protein ARALYDRAFT_327304             122   1e-29   Arabidopsis lyrata subsp. lyrata
ref|NP_564810.1|  zinc finger, C3HC4 type (RING finger) family pr...    122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540680.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    122   1e-29   Tarenaya hassleriana [spider flower]
gb|AAM63303.1|  unknown                                                 122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540663.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    122   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010540654.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    122   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010540671.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    122   1e-29   Tarenaya hassleriana [spider flower]
gb|AAL24200.1|  At1g63170/F16M19_7                                      122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    121   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_003570089.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    121   3e-29   Brachypodium distachyon [annual false brome]
gb|KJB25759.1|  hypothetical protein B456_004G208600                    121   3e-29   Gossypium raimondii
gb|KFK40526.1|  hypothetical protein AALP_AA2G007300                    120   4e-29   Arabis alpina [alpine rockcress]
ref|XP_003611137.1|  E3 ubiquitin-protein ligase                        120   5e-29   Medicago truncatula
ref|XP_010278589.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010278591.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010278588.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   6e-29   
ref|XP_010278590.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   6e-29   
ref|XP_009148567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   6e-29   Brassica rapa
emb|CDY66607.1|  BnaA06g38090D                                          120   6e-29   Brassica napus [oilseed rape]
ref|XP_003525718.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   7e-29   Glycine max [soybeans]
gb|KHG06982.1|  hypothetical protein F383_33104                         120   9e-29   Gossypium arboreum [tree cotton]
emb|CDY60265.1|  BnaC05g49290D                                          119   1e-28   Brassica napus [oilseed rape]
ref|XP_003517458.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    119   1e-28   Glycine max [soybeans]
ref|XP_004229832.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    119   1e-28   Solanum lycopersicum
gb|EPS63490.1|  hypothetical protein M569_11294                         119   2e-28   Genlisea aurea
ref|XP_007040144.1|  Zinc finger, C3HC4 type (RING finger) family...    118   2e-28   Theobroma cacao [chocolate]
ref|XP_007040145.1|  Zinc finger, C3HC4 type (RING finger) family...    118   3e-28   Theobroma cacao [chocolate]
ref|XP_004515807.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    118   3e-28   Cicer arietinum [garbanzo]
ref|XP_010112554.1|  E3 ubiquitin-protein ligase                        118   3e-28   Morus notabilis
ref|XP_007158469.1|  hypothetical protein PHAVU_002G155000g             118   3e-28   Phaseolus vulgaris [French bean]
ref|XP_008383660.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    118   3e-28   
ref|XP_010940871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    118   4e-28   Elaeis guineensis
ref|XP_010940872.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    118   4e-28   Elaeis guineensis
ref|XP_009617349.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    118   4e-28   Nicotiana tomentosiformis
ref|XP_006345510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    118   4e-28   Solanum tuberosum [potatoes]
ref|XP_008358659.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    118   4e-28   
ref|XP_006590532.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    117   5e-28   Glycine max [soybeans]
ref|XP_003538385.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    117   5e-28   Glycine max [soybeans]
dbj|BAD29468.1|  ring zinc finger protein-like                          118   5e-28   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047717.2|  Os02g0674700                                       117   5e-28   
ref|XP_007155554.1|  hypothetical protein PHAVU_003G211600g             117   7e-28   Phaseolus vulgaris [French bean]
gb|KHG06981.1|  hypothetical protein F383_33104                         119   7e-28   Gossypium arboreum [tree cotton]
ref|XP_006339453.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    117   8e-28   Solanum tuberosum [potatoes]
ref|XP_009382298.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393489.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411463.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    116   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK02342.1|  predicted protein                                      116   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO63535.1|  hypothetical protein CISIN_1g020491mg                   115   2e-27   Citrus sinensis [apfelsine]
gb|KDO63537.1|  hypothetical protein CISIN_1g020491mg                   115   2e-27   Citrus sinensis [apfelsine]
gb|KDO63536.1|  hypothetical protein CISIN_1g020491mg                   115   2e-27   Citrus sinensis [apfelsine]
gb|KHG00725.1|  hypothetical protein F383_22058                         116   2e-27   Gossypium arboreum [tree cotton]
ref|XP_002889965.1|  protein binding protein                            115   2e-27   
dbj|BAK00653.1|  predicted protein                                      116   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002509740.1|  cleavage and polyadenylation specificity fac...    116   2e-27   Ricinus communis
dbj|BAK01729.1|  predicted protein                                      115   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010933860.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    115   2e-27   Elaeis guineensis
ref|XP_010933858.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    115   2e-27   Elaeis guineensis
tpg|DAA60523.1|  TPA: putative RING zinc finger domain superfamil...    113   2e-27   
ref|XP_003550874.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    115   3e-27   Glycine max [soybeans]
ref|NP_001031032.1|  E3 ubiquitin-protein ligase                        115   4e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CBI38762.3|  unnamed protein product                                114   4e-27   Vitis vinifera
ref|XP_009346865.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    114   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_004295567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    114   8e-27   Fragaria vesca subsp. vesca
ref|NP_001130198.1|  uncharacterized LOC100191292                       114   1e-26   Zea mays [maize]
ref|XP_008803038.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    114   1e-26   Phoenix dactylifera
ref|XP_008803037.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    114   1e-26   Phoenix dactylifera
ref|XP_011091747.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    113   1e-26   
ref|XP_004240042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    114   1e-26   Solanum lycopersicum
ref|XP_003570086.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    114   1e-26   Brachypodium distachyon [annual false brome]
gb|KDP25486.1|  hypothetical protein JCGZ_20642                         113   2e-26   Jatropha curcas
ref|XP_008651537.1|  PREDICTED: protein binding protein isoform X2      113   2e-26   Zea mays [maize]
ref|NP_001151256.1|  protein binding protein                            113   2e-26   Zea mays [maize]
tpg|DAA60522.1|  TPA: putative RING zinc finger domain superfamil...    113   2e-26   
ref|XP_008651536.1|  PREDICTED: protein binding protein isoform X1      113   2e-26   Zea mays [maize]
gb|ACN30552.1|  unknown                                                 109   2e-26   Zea mays [maize]
dbj|BAJ98696.1|  predicted protein                                      113   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009615319.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    112   3e-26   Nicotiana tomentosiformis
ref|XP_009615318.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    112   3e-26   Nicotiana tomentosiformis
gb|EYU35067.1|  hypothetical protein MIMGU_mgv1a008119mg                112   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_008799543.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    112   5e-26   Phoenix dactylifera
ref|XP_008799545.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    112   5e-26   Phoenix dactylifera
ref|XP_002962655.1|  hypothetical protein SELMODRAFT_78385              112   5e-26   
ref|XP_010919263.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    112   5e-26   Elaeis guineensis
ref|XP_002980437.1|  hypothetical protein SELMODRAFT_112292             112   5e-26   
ref|XP_010919264.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    112   5e-26   Elaeis guineensis
ref|XP_009116780.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    111   8e-26   Brassica rapa
emb|CDY52328.1|  BnaA09g38770D                                          111   9e-26   Brassica napus [oilseed rape]
ref|NP_001182980.1|  uncharacterized protein LOC100501295               107   9e-26   
ref|XP_008225188.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    111   1e-25   Prunus mume [ume]
gb|KJB52053.1|  hypothetical protein B456_008G244300                    109   1e-25   Gossypium raimondii
ref|XP_010255487.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    111   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009369023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    111   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_010255490.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    111   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010255491.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    111   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009369025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    111   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009369026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    111   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_010255488.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    111   1e-25   Nelumbo nucifera [Indian lotus]
emb|CDY21061.1|  BnaA08g24640D                                          110   1e-25   Brassica napus [oilseed rape]
ref|XP_009369024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_007211433.1|  hypothetical protein PRUPE_ppa007140mg             110   1e-25   Prunus persica
ref|XP_006857849.1|  hypothetical protein AMTR_s00069p00064990          110   2e-25   
ref|XP_010661149.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   2e-25   Vitis vinifera
ref|XP_003631422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   2e-25   Vitis vinifera
ref|XP_009626445.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    110   2e-25   Nicotiana tomentosiformis
gb|KJB52054.1|  hypothetical protein B456_008G244300                    109   2e-25   Gossypium raimondii
ref|NP_567110.1|  RING/U-box superfamily protein                        110   2e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAB71048.1|  putative protein                                       110   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KDO86039.1|  hypothetical protein CISIN_1g017405mg                   108   2e-25   Citrus sinensis [apfelsine]
ref|XP_008238809.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   3e-25   Prunus mume [ume]
ref|XP_008238810.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   3e-25   Prunus mume [ume]
gb|KDO86037.1|  hypothetical protein CISIN_1g017405mg                   109   3e-25   Citrus sinensis [apfelsine]
ref|XP_008345901.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    110   3e-25   Malus domestica [apple tree]
ref|XP_008670056.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   3e-25   
ref|XP_002876598.1|  hypothetical protein ARALYDRAFT_486593             110   3e-25   
ref|XP_001754436.1|  predicted protein                                  109   4e-25   
emb|CDX71761.1|  BnaC08g31130D                                          109   4e-25   
gb|ADK63418.1|  C3HC4 type zinc finger protein                          109   4e-25   Brassica rapa
gb|KCW77596.1|  hypothetical protein EUGRSUZ_D01910                     109   4e-25   Eucalyptus grandis [rose gum]
gb|KCW77597.1|  hypothetical protein EUGRSUZ_D01910                     109   4e-25   Eucalyptus grandis [rose gum]
ref|XP_011033785.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   4e-25   Populus euphratica
emb|CDX74763.1|  BnaA05g05090D                                          109   4e-25   
ref|XP_002303571.2|  hypothetical protein POPTR_0003s12350g             109   4e-25   Populus trichocarpa [western balsam poplar]
gb|KDO86038.1|  hypothetical protein CISIN_1g017405mg                   108   5e-25   Citrus sinensis [apfelsine]
ref|XP_011033783.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   5e-25   Populus euphratica
gb|KJB52052.1|  hypothetical protein B456_008G244300                    109   5e-25   Gossypium raimondii
ref|XP_011033784.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   5e-25   Populus euphratica
ref|XP_009143169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    109   5e-25   Brassica rapa
ref|XP_002459812.1|  hypothetical protein SORBIDRAFT_02g011130          109   5e-25   Sorghum bicolor [broomcorn]
ref|XP_009345443.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009345445.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009345444.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009345446.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    109   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_006445135.1|  hypothetical protein CICLE_v10020664mg             108   7e-25   Citrus clementina [clementine]
ref|XP_008392388.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    108   7e-25   
ref|XP_009142362.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    108   7e-25   Brassica rapa
ref|XP_008392390.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    108   8e-25   
gb|KDO86036.1|  hypothetical protein CISIN_1g017405mg                   108   8e-25   Citrus sinensis [apfelsine]
ref|XP_008392389.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    108   8e-25   
ref|XP_003563155.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    108   9e-25   Brachypodium distachyon [annual false brome]
ref|XP_008392391.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    108   9e-25   
emb|CDY37062.1|  BnaA04g26400D                                          108   9e-25   Brassica napus [oilseed rape]
emb|CDY49194.1|  BnaA09g10840D                                          108   9e-25   Brassica napus [oilseed rape]
ref|XP_009112973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    108   1e-24   Brassica rapa
ref|XP_009112972.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    108   1e-24   Brassica rapa
emb|CDY47347.1|  BnaCnng14840D                                          108   1e-24   Brassica napus [oilseed rape]
ref|XP_006279088.1|  hypothetical protein CARUB_v10012711mg             107   2e-24   
ref|XP_006364123.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    107   2e-24   Solanum tuberosum [potatoes]
ref|NP_001147541.1|  protein binding protein                            107   2e-24   Zea mays [maize]
gb|AEW07558.1|  hypothetical protein 0_5075_01                          102   3e-24   Pinus lambertiana
ref|XP_006279087.1|  hypothetical protein CARUB_v10012711mg             107   3e-24   Capsella rubella
gb|AFW59158.1|  putative RING zinc finger domain superfamily protein    106   4e-24   
ref|XP_006402511.1|  hypothetical protein EUTSA_v10006041mg             107   4e-24   
ref|XP_007209235.1|  hypothetical protein PRUPE_ppa007012mg             107   4e-24   Prunus persica
ref|XP_004956144.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    106   4e-24   Setaria italica
ref|XP_010934468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    107   4e-24   Elaeis guineensis
ref|XP_010934467.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    107   4e-24   Elaeis guineensis
gb|AEW07559.1|  hypothetical protein 0_5075_01                          102   4e-24   Pinus radiata
ref|XP_004956145.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    106   4e-24   Setaria italica
gb|AFG60447.1|  hypothetical protein 0_5075_01                          102   5e-24   Pinus taeda
ref|XP_004976528.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    105   1e-23   Setaria italica
ref|NP_001150553.1|  LOC100284185                                       105   1e-23   
ref|XP_008662009.1|  PREDICTED: LOC100284185 isoform X1                 105   1e-23   
ref|XP_002969635.1|  hypothetical protein SELMODRAFT_66385              105   1e-23   
ref|XP_002970900.1|  hypothetical protein SELMODRAFT_66382              105   1e-23   
ref|XP_010053324.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    105   2e-23   Eucalyptus grandis [rose gum]
ref|XP_004252582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    104   2e-23   Solanum lycopersicum
ref|XP_010053666.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    104   2e-23   Eucalyptus grandis [rose gum]
gb|KDP28678.1|  hypothetical protein JCGZ_14449                         103   4e-23   Jatropha curcas
emb|CAE02249.2|  OSJNBb0032E06.5                                        103   5e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87715.1|  unknown                                                 103   6e-23   Zea mays [maize]
ref|XP_010671755.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   7e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010469042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    103   8e-23   Camelina sativa [gold-of-pleasure]
gb|ACF78887.1|  unknown                                                 102   1e-22   Zea mays [maize]
ref|XP_007051906.1|  RING/U-box superfamily protein, putative           102   1e-22   Theobroma cacao [chocolate]
ref|XP_011023403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    102   1e-22   Populus euphratica
ref|XP_010092737.1|  E3 ubiquitin-protein ligase                        102   1e-22   
emb|CDY27362.1|  BnaC04g50430D                                          105   1e-22   Brassica napus [oilseed rape]
gb|KJB41240.1|  hypothetical protein B456_007G096300                    100   2e-22   Gossypium raimondii
ref|XP_001784296.1|  predicted protein                                  101   2e-22   
ref|XP_002511805.1|  cleavage and polyadenylation specificity fac...    102   2e-22   Ricinus communis
ref|XP_008355580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   2e-22   
ref|XP_008355581.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   2e-22   
gb|KHF98416.1|  hypothetical protein F383_13016                         102   2e-22   Gossypium arboreum [tree cotton]
ref|XP_008355584.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   2e-22   
ref|XP_008355582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   2e-22   
ref|XP_010413448.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    101   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010512452.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    101   2e-22   Camelina sativa [gold-of-pleasure]
gb|KJB41242.1|  hypothetical protein B456_007G096300                    101   2e-22   Gossypium raimondii
gb|KJB41241.1|  hypothetical protein B456_007G096300                    101   2e-22   Gossypium raimondii
gb|KJB41239.1|  hypothetical protein B456_007G096300                    101   3e-22   Gossypium raimondii
ref|NP_001059583.1|  Os07g0463400                                       100   7e-22   
gb|EEC81984.1|  hypothetical protein OsI_25906                        99.8    1e-21   Oryza sativa Indica Group [Indian rice]
gb|ABR17177.1|  unknown                                               99.8    1e-21   Picea sitchensis
ref|XP_003623820.1|  E3 ubiquitin-protein ligase                      99.0    2e-21   Medicago truncatula
ref|XP_010101532.1|  hypothetical protein L484_008863                 98.2    2e-21   
gb|ABR18161.1|  unknown                                               99.0    2e-21   Picea sitchensis
ref|XP_009351549.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  99.0    3e-21   
ref|XP_010251799.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  98.2    3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010251798.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  98.2    4e-21   
ref|XP_007220471.1|  hypothetical protein PRUPE_ppa007521mg           98.2    4e-21   
ref|XP_002880197.1|  hypothetical protein ARALYDRAFT_322232           98.2    5e-21   
ref|XP_010544693.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  98.2    5e-21   
ref|XP_010544692.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  98.2    5e-21   
ref|XP_010534170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      97.8    5e-21   
ref|XP_008232745.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  97.8    5e-21   
ref|XP_008389083.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  94.7    5e-21   
ref|XP_003533627.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  97.8    5e-21   
ref|XP_011035060.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  97.8    6e-21   
ref|XP_011035055.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  97.8    7e-21   
ref|XP_011035074.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  97.4    8e-21   
ref|XP_002320753.2|  hypothetical protein POPTR_0014s07110g           97.4    8e-21   
ref|XP_011035066.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  97.4    8e-21   
ref|XP_009420927.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  96.7    1e-20   
gb|KEH40622.1|  zinc finger (C3HC4-type RING finger) family protein   96.7    1e-20   
gb|ADK63393.1|  C3HC4 type zinc finger protein                        95.9    2e-20   
gb|KEH40623.1|  zinc finger (C3HC4-type RING finger) family protein   95.9    2e-20   
ref|XP_011463168.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      95.9    3e-20   
gb|KJB30722.1|  hypothetical protein B456_005G157000                  95.5    3e-20   
gb|KDP38117.1|  hypothetical protein JCGZ_04760                       95.5    3e-20   
ref|XP_008354302.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  95.5    4e-20   
ref|XP_008381749.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      95.5    4e-20   
ref|XP_003630948.1|  E3 ubiquitin-protein ligase                      95.1    4e-20   
ref|XP_009608303.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.7    6e-20   
ref|XP_004503351.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.7    7e-20   
emb|CDY70309.1|  BnaCnng67740D                                        94.4    9e-20   
ref|XP_004498249.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    1e-19   
ref|XP_006828464.1|  hypothetical protein AMTR_s00060p00138860        92.4    1e-19   
ref|XP_006491024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.0    1e-19   
ref|XP_003518612.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.0    1e-19   
ref|XP_003552356.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.0    1e-19   
ref|XP_007223310.1|  hypothetical protein PRUPE_ppa007296mg           94.0    2e-19   
ref|XP_006583718.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  92.8    3e-19   
ref|XP_006583716.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  92.8    3e-19   
gb|ABK96450.1|  unknown                                               91.7    3e-19   
ref|XP_009765931.1|  PREDICTED: cleavage and polyadenylation spec...  95.5    3e-19   
ref|XP_010271358.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  92.8    4e-19   
emb|CDY50582.1|  BnaC02g39560D                                        91.7    4e-19   
ref|XP_002312464.2|  zinc finger family protein                       92.4    4e-19   
ref|XP_006355061.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  95.1    4e-19   
gb|KFK30652.1|  hypothetical protein AALP_AA6G009800                  92.0    5e-19   
ref|XP_006391188.1|  hypothetical protein EUTSA_v10018815mg           92.0    5e-19   
ref|XP_010676528.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  92.0    5e-19   
ref|XP_008789278.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...  92.0    5e-19   
ref|XP_008789277.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...  92.0    6e-19   
ref|XP_007045268.1|  Zinc finger isoform 2                            91.3    6e-19   
ref|XP_011021770.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  90.9    7e-19   
ref|XP_009127596.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  91.7    7e-19   
ref|XP_006294289.1|  hypothetical protein CARUB_v10023298mg           92.4    7e-19   
ref|XP_006302484.1|  hypothetical protein CARUB_v10020579mg           91.7    7e-19   
ref|XP_007045267.1|  Zinc finger, C3HC4 type (RING finger) family...  91.3    1e-18   
ref|XP_011021769.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  91.3    1e-18   
ref|XP_010511779.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  91.3    1e-18   
gb|KFK37366.1|  hypothetical protein AALP_AA4G247400                  91.3    1e-18   
ref|XP_006469322.1|  PREDICTED: cleavage and polyadenylation spec...  94.0    1e-18   
ref|XP_010651669.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      90.9    2e-18   
ref|XP_010470747.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  90.9    2e-18   
emb|CAN61404.1|  hypothetical protein VITISV_014258                   90.9    2e-18   
ref|XP_010107068.1|  E3 ubiquitin protein ligase RIE1                 91.7    2e-18   
ref|XP_008389170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      90.9    2e-18   
ref|XP_002301335.1|  zinc finger family protein                       90.9    2e-18   
emb|CDY71708.1|  BnaCnng74070D                                        90.5    2e-18   
ref|XP_010419065.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  90.1    3e-18   
ref|XP_010319559.1|  PREDICTED: cleavage and polyadenylation spec...  92.8    3e-18   
ref|XP_002526000.1|  cleavage and polyadenylation specificity fac...  92.8    3e-18   
gb|AAM61051.1|  putative RING zinc finger protein                     89.7    4e-18   
gb|KDO60761.1|  hypothetical protein CISIN_1g018193mg                 89.0    4e-18   
ref|NP_176974.1|  C3HC4-type RING finger domain-containing protein    89.4    4e-18   
gb|KCW64497.1|  hypothetical protein EUGRSUZ_G02105                   89.7    4e-18   
ref|XP_010272924.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  89.4    4e-18   
ref|XP_006448161.1|  hypothetical protein CICLE_v10015731mg           89.0    5e-18   
emb|CDY12686.1|  BnaA02g13540D                                        89.4    5e-18   
emb|CDX96049.1|  BnaA07g26820D                                        89.0    6e-18   
ref|XP_009105357.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      89.0    7e-18   
ref|XP_006448160.1|  hypothetical protein CICLE_v10015731mg           87.8    7e-18   
gb|KDO60760.1|  hypothetical protein CISIN_1g018193mg                 89.0    8e-18   
ref|XP_002887158.1|  hypothetical protein ARALYDRAFT_475916           88.6    9e-18   
ref|XP_006448162.1|  hypothetical protein CICLE_v10015731mg           88.6    9e-18   
ref|XP_011024112.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  88.2    1e-17   
ref|XP_010932732.1|  PREDICTED: uncharacterized protein LOC105053331  91.3    1e-17   
ref|XP_009408396.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      88.2    1e-17   
gb|KJB15335.1|  hypothetical protein B456_002G172200                  88.2    1e-17   
gb|KHG00424.1|  E3 ubiquitin ligase RIE1 -like protein                87.4    2e-17   
ref|XP_010066571.1|  PREDICTED: cleavage and polyadenylation spec...  90.5    2e-17   
gb|KJB15334.1|  hypothetical protein B456_002G172200                  87.8    2e-17   
ref|XP_008780251.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  85.5    2e-17   
emb|CDX68417.1|  BnaC01g24950D                                        87.0    2e-17   
emb|CDY13386.1|  BnaC06g13710D                                        84.7    2e-17   
ref|XP_002314782.2|  hypothetical protein POPTR_0010s11660g           87.0    2e-17   
ref|XP_011070565.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  86.7    5e-17   
ref|XP_011070566.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  86.7    5e-17   
emb|CDY01880.1|  BnaC06g29200D                                        86.3    7e-17   
gb|EYU30132.1|  hypothetical protein MIMGU_mgv1a010797mg              85.9    7e-17   
gb|EYU30133.1|  hypothetical protein MIMGU_mgv1a010797mg              85.9    7e-17   
ref|XP_009419123.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  85.5    1e-16   
ref|XP_010527797.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      85.5    1e-16   
ref|XP_010910998.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  83.2    1e-16   
ref|XP_010430653.1|  PREDICTED: cleavage and polyadenylation spec...  87.8    1e-16   
ref|XP_010518550.1|  PREDICTED: cleavage and polyadenylation spec...  87.4    2e-16   
ref|XP_007160430.1|  hypothetical protein PHAVU_002G321300g           84.7    2e-16   
ref|XP_002875087.1|  hypothetical protein ARALYDRAFT_322516           87.0    2e-16   
ref|XP_006584880.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  84.3    3e-16   
ref|XP_003525228.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  84.0    4e-16   
emb|CDX71399.1|  BnaC04g16340D                                        80.1    1e-15   
ref|XP_010502156.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      83.2    1e-15   
gb|KHN16532.1|  E3 ubiquitin protein ligase RIE1                      82.4    1e-15   
ref|XP_006291380.1|  hypothetical protein CARUB_v10017517mg           82.4    2e-15   
ref|XP_010695901.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  82.4    2e-15   
gb|KFK33397.1|  hypothetical protein AALP_AA5G007500                  82.4    2e-15   
ref|XP_008778191.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.4    2e-15   
ref|XP_006395857.1|  hypothetical protein EUTSA_v10004486mg           82.4    2e-15   
gb|KHN21610.1|  E3 ubiquitin protein ligase RIE1                      81.3    3e-15   
ref|XP_004150618.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  81.6    3e-15   
ref|XP_006658537.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  81.3    3e-15   
gb|AAD12712.1|  putative cleavage and polyadenylation specifity f...  83.6    4e-15   
ref|XP_009101309.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      81.3    4e-15   
ref|XP_008467019.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      81.3    4e-15   
emb|CDY17638.1|  BnaA06g34570D                                        81.3    4e-15   
emb|CDY36255.1|  BnaC07g21090D                                        80.1    1e-14   
ref|XP_002452592.1|  hypothetical protein SORBIDRAFT_04g028660        80.1    1e-14   
dbj|BAE99481.1|  putative cleavage and polyadenylation specifity ...  77.0    3e-14   
ref|NP_849924.1|  E3 ubiquitin protein ligase RIE1                    78.2    6e-14   
ref|NP_001149757.1|  LOC100283384                                     77.8    9e-14   
gb|KJB60892.1|  hypothetical protein B456_009G330000                  75.9    4e-13   
dbj|BAK01779.1|  predicted protein                                    73.9    2e-12   
ref|XP_003570691.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  73.9    2e-12   
ref|XP_004953845.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  72.0    1e-11   
ref|XP_007153246.1|  hypothetical protein PHAVU_003G019100g           71.2    2e-11   
ref|XP_007139958.1|  hypothetical protein PHAVU_008G073000g           71.2    2e-11   
ref|XP_008679100.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  70.5    4e-11   
gb|KHG10998.1|  E3 ubiquitin ligase RIE1 -like protein                69.7    6e-11   
ref|XP_004249338.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  65.9    1e-09   
ref|XP_010312169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  65.9    1e-09   
ref|XP_009399941.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  65.1    2e-09   
ref|XP_006576759.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.9    4e-09   
ref|XP_009606721.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.9    5e-09   
ref|XP_009606720.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.9    5e-09   
ref|XP_003521096.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.9    5e-09   
ref|XP_009773934.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.5    5e-09   
ref|XP_009773935.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.5    5e-09   
ref|XP_009773936.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.5    5e-09   
ref|XP_009606719.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.9    6e-09   
ref|XP_009773933.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.5    7e-09   
ref|XP_009773932.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  63.5    7e-09   
ref|XP_002878219.1|  hypothetical protein ARALYDRAFT_907322           60.8    8e-09   
ref|XP_004498315.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  63.2    8e-09   
ref|XP_004493307.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  62.8    1e-08   
ref|XP_002862928.1|  predicted protein                                60.8    2e-08   
ref|XP_008443208.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  61.6    3e-08   
ref|XP_004136763.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  61.6    3e-08   
ref|XP_002283980.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  61.2    5e-08   
gb|EEC73955.1|  hypothetical protein OsI_08846                        60.5    6e-08   
ref|XP_010673203.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  60.1    1e-07   
ref|XP_003553376.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  59.7    1e-07   
ref|XP_007162014.1|  hypothetical protein PHAVU_001G116400g           59.3    2e-07   
emb|CDP14337.1|  unnamed protein product                              59.3    2e-07   
ref|XP_008455807.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  56.6    4e-07   
ref|XP_006430473.1|  hypothetical protein CICLE_v10012313mg           57.8    5e-07   
ref|XP_006482012.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  57.8    6e-07   
ref|XP_004165340.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  57.0    8e-07   
gb|EYU35678.1|  hypothetical protein MIMGU_mgv1a018208mg              56.2    2e-06   
ref|XP_004144310.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  56.2    2e-06   
ref|XP_003624869.1|  E3 ubiquitin-protein ligase                      55.8    2e-06   
ref|XP_011070049.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  55.8    3e-06   
ref|XP_004493023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  55.1    5e-06   
gb|EPS69634.1|  hypothetical protein M569_05133                       53.5    2e-05   
gb|AFW80142.1|  putative RING zinc finger domain superfamily protein  53.1    2e-05   
ref|XP_002886882.1|  predicted protein                                50.4    2e-05   
ref|XP_002867833.1|  predicted protein                                50.1    3e-05   
ref|XP_002886880.1|  predicted protein                                49.3    5e-05   
ref|XP_002886881.1|  predicted protein                                49.3    6e-05   
ref|XP_008221359.1|  PREDICTED: cleavage and polyadenylation spec...  50.1    3e-04   
gb|KHN35002.1|  E3 ubiquitin-protein ligase                           48.1    0.001   



>gb|KJB20721.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=283

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            + TRPS+RR S+R+    +RRA SR   MREPS LVR+ AAEQ++ERQSDWAYSKPVVIL
Sbjct  33   SATRPSVRRQSLREAARFMRRATSR-RTMREPSMLVRETAAEQLEERQSDWAYSKPVVIL  91

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN AFV +A  VL LSRDE PE+PLRLWI+GYA QC+LH V V +EY+
Sbjct  92   DVIWNFAFVAVAVGVLFLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYK  142



>gb|KJB20720.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=381

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            + TRPS+RR S+R+    +RRA SR   MREPS LVR+ AAEQ++ERQSDWAYSKPVVIL
Sbjct  33   SATRPSVRRQSLREAARFMRRATSR-RTMREPSMLVRETAAEQLEERQSDWAYSKPVVIL  91

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN AFV +A  VL LSRDE PE+PLRLWI+GYA QC+LH V V +EY+
Sbjct  92   DVIWNFAFVAVAVGVLFLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYK  142



>gb|KJB20719.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=389

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            + TRPS+RR S+R+    +RRA SR   MREPS LVR+ AAEQ++ERQSDWAYSKPVVIL
Sbjct  33   SATRPSVRRQSLREAARFMRRATSR-RTMREPSMLVRETAAEQLEERQSDWAYSKPVVIL  91

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN AFV +A  VL LSRDE PE+PLRLWI+GYA QC+LH V V +EY+
Sbjct  92   DVIWNFAFVAVAVGVLFLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYK  142



>gb|KHG00577.1| hypothetical protein F383_17805 [Gossypium arboreum]
 gb|KHG12148.1| hypothetical protein F383_00012 [Gossypium arboreum]
Length=382

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            + TRPS+RR S+R+    +RRA SR   MREPS LVR+ AAEQ++ERQSDWAYSKPVVIL
Sbjct  34   SATRPSVRRQSLREAARFMRRATSR-RSMREPSMLVRETAAEQLEERQSDWAYSKPVVIL  92

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN AFV +AA VL LSRDE PE+PLRLWI+GYA QC+LH V V +EY+
Sbjct  93   DVIWNFAFVAVAAGVLFLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYK  143



>emb|CDY26592.1| BnaA09g46850D [Brassica napus]
Length=384

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
             G R S RR  +R+    L RA S G  MREPS LVR+AAAEQ++ERQSDWAYSKPVV+L
Sbjct  31   GGGRRSARRQGLREAAMFLSRASSGGRAMREPSMLVREAAAEQLEERQSDWAYSKPVVVL  90

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            D+VWNLAFV +AA VLV+SRDE P +PLR+W++GYALQCVLH V V +EY
Sbjct  91   DIVWNLAFVSVAAGVLVMSRDENPIMPLRVWLLGYALQCVLHMVCVGIEY  140



>ref|XP_009118058.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Brassica 
rapa]
Length=382

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
             G R S RR  +R+    L RA S G  MREPS LVR+AAAEQ++ERQSDWAYSKPVV+L
Sbjct  31   GGERRSARRQGLREAAMFLSRASSGGRAMREPSMLVREAAAEQLEERQSDWAYSKPVVVL  90

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            D+VWNLAFV +AA VLV+SRDE P +PLR+W++GYALQCV+H V V +EY
Sbjct  91   DIVWNLAFVSVAAGVLVMSRDENPIMPLRVWLLGYALQCVVHMVCVGIEY  140



>ref|XP_009118057.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Brassica 
rapa]
Length=383

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
             G R S RR  +R+    L RA S G  MREPS LVR+AAAEQ++ERQSDWAYSKPVV+L
Sbjct  31   GGERRSARRQGLREAAMFLSRASSGGRAMREPSMLVREAAAEQLEERQSDWAYSKPVVVL  90

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            D+VWNLAFV +AA VLV+SRDE P +PLR+W++GYALQCV+H V V +EY
Sbjct  91   DIVWNLAFVSVAAGVLVMSRDENPIMPLRVWLLGYALQCVVHMVCVGIEY  140



>ref|XP_010553507.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Tarenaya hassleriana]
Length=399

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR S+R+    LRRA S G +MR+PS LVR+ AAEQ++ RQSDWAYSKPVV+LD+V
Sbjct  56   RRSVRRQSLREAARFLRRASS-GRMMRQPSMLVRETAAEQLEVRQSDWAYSKPVVVLDIV  114

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AV+VLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  115  WNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  161



>ref|XP_010553505.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Tarenaya hassleriana]
Length=413

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR S+R+    LRRA S G +MR+PS LVR+ AAEQ++ RQSDWAYSKPVV+LD+V
Sbjct  56   RRSVRRQSLREAARFLRRASS-GRMMRQPSMLVRETAAEQLEVRQSDWAYSKPVVVLDIV  114

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AV+VLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  115  WNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  161



>ref|XP_010553509.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Tarenaya hassleriana]
Length=398

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR S+R+    LRRA S G +MR+PS LVR+ AAEQ++ RQSDWAYSKPVV+LD+V
Sbjct  56   RRSVRRQSLREAARFLRRASS-GRMMRQPSMLVRETAAEQLEVRQSDWAYSKPVVVLDIV  114

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AV+VLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  115  WNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  161



>ref|XP_010553508.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Tarenaya hassleriana]
Length=399

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR S+R+    LRRA S G +MR+PS LVR+ AAEQ++ RQSDWAYSKPVV+LD+V
Sbjct  56   RRSVRRQSLREAARFLRRASS-GRMMRQPSMLVRETAAEQLEVRQSDWAYSKPVVVLDIV  114

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AV+VLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  115  WNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  161



>ref|XP_010553504.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Tarenaya hassleriana]
Length=414

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR S+R+    LRRA S G +MR+PS LVR+ AAEQ++ RQSDWAYSKPVV+LD+V
Sbjct  56   RRSVRRQSLREAARFLRRASS-GRMMRQPSMLVRETAAEQLEVRQSDWAYSKPVVVLDIV  114

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AV+VLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  115  WNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  161



>emb|CDY57781.1| BnaCnng32440D [Brassica napus]
Length=391

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +3

Query  186  AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYS  365
            A+ DG  G + S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYS
Sbjct  46   ASVDGENGNQRSARRQGLREAARFLRHAGSRRM-MREPSVLVRETAAEQLEERQSDWAYS  104

Query  366  KPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            KPVV LD++WNLAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  105  KPVVFLDILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGVQCGLHMACVCVEY  160



>ref|XP_010458710.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Camelina sativa]
Length=408

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR  +R+    L RA S G VMREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+V
Sbjct  48   RRSVRRQGLREAARFLSRASS-GRVMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIV  106

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AVLV+SRDE P +PLR+W++GYALQCVLH V V  EY
Sbjct  107  WNLAFVSVATAVLVMSRDEHPIMPLRVWLLGYALQCVLHMVCVCFEY  153



>ref|XP_008448958.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
melo]
Length=383

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +3

Query  168  SPLM-TP--AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            SPLM TP  +  D ++G R  ++R S+R     LR+A SR   MREPS LVR+ AAEQ++
Sbjct  18   SPLMGTPNRSLDDTHSGRR-FVQRQSLRQAARFLRQASSR-RTMREPSMLVRETAAEQLE  75

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKPVVILD+VWN AFV++AA +LVLSR+E P +PLRLWIVGYA QC+LH V 
Sbjct  76   ERQSDWAYSKPVVILDIVWNFAFVVVAATILVLSRNESPSMPLRLWIVGYAFQCILHMVC  135

Query  519  VSLEYQ  536
            V +EY+
Sbjct  136  VCVEYR  141



>emb|CDX86759.1| BnaA09g21490D [Brassica napus]
Length=411

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +3

Query  186  AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYS  365
            A+ DG  G + S RR  +R+    LR AGSR M MREPS +VR+ AAEQ++ERQSDWAYS
Sbjct  42   ASVDGENGIQRSARRQGLREAARFLRHAGSRRM-MREPSVMVRETAAEQLEERQSDWAYS  100

Query  366  KPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            KPVV LD++WNLAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  101  KPVVFLDILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGVQCGLHMACVCVEY  156



>ref|XP_009124794.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=387

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +3

Query  186  AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYS  365
            A+ DG  G + S RR  +R+    LR AGSR M MREPS +VR+ AAEQ++ERQSDWAYS
Sbjct  42   ASVDGENGIQRSARRQGLREAARFLRHAGSRRM-MREPSVMVRETAAEQLEERQSDWAYS  100

Query  366  KPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            KPVV LD++WNLAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  101  KPVVFLDILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGVQCGLHMACVCVEY  156



>ref|XP_006477422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Citrus sinensis]
Length=380

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLS++E+P +PLRLWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_006477421.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Citrus sinensis]
Length=381

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLS++E+P +PLRLWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_006477420.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Citrus sinensis]
Length=382

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLS++E+P +PLRLWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_004147971.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
sativus]
 gb|KGN55952.1| hypothetical protein Csa_3G038740 [Cucumis sativus]
Length=383

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +3

Query  168  SPLM-TP--AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            SPLM TP  +  D ++G R  ++R S+R     LR+A +R   MREPS LVR+ AAEQ++
Sbjct  18   SPLMGTPNRSLDDTHSGRR-FVQRQSLRQAARFLRQASNR-RTMREPSMLVRETAAEQLE  75

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKPVVILD+VWN AFV++AA +LVLSR+E P +PLRLWIVGYA QC+LH V 
Sbjct  76   ERQSDWAYSKPVVILDIVWNFAFVVVAATILVLSRNESPSMPLRLWIVGYAFQCILHMVC  135

Query  519  VSLEYQ  536
            V +EY+
Sbjct  136  VCVEYR  141



>ref|XP_006477418.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Citrus sinensis]
Length=387

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLS++E+P +PLRLWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_002887973.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64232.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S+RR  +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWN
Sbjct  23   SVRRQGLREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWN  82

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV +A AVLVLS DE P +PLR+W++GY LQC++H V V +EY
Sbjct  83   LAFVAVATAVLVLSSDENPNMPLRVWVIGYGLQCMMHMVCVCVEY  127



>gb|KJB39631.1| hypothetical protein B456_007G022500 [Gossypium raimondii]
Length=381

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            + TR S+RR S+R+    LRRA SR + MREPS LVR+ AAEQ++ER SDWAYSKPVV+L
Sbjct  34   SATRGSVRRQSLREAARFLRRASSRRL-MREPSMLVRETAAEQLEERHSDWAYSKPVVVL  92

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            D++WN AFV  A  VLVLS +E+P +PLRLWI+GYALQC+LH V V +EY
Sbjct  93   DIIWNFAFVAAAVGVLVLSWNERPSMPLRLWIIGYALQCLLHMVCVCVEY  142



>ref|XP_010494577.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=399

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S+RR  +R+    L RA S G VMREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWN
Sbjct  49   SMRRQGLREAARFLSRASS-GRVMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWN  107

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV +A AVL++S+DE P +PLR+W++GYALQCVLH V V  EY
Sbjct  108  LAFVSVATAVLIMSKDEHPIMPLRVWLLGYALQCVLHMVCVCFEY  152



>ref|XP_006477419.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Citrus sinensis]
Length=386

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLS++E+P +PLRLWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_010476241.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=405

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S+RR  +R+    L RA S G VMREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWN
Sbjct  51   SVRRQGLREAARFLSRASS-GRVMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWN  109

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV +A AVLV+S+DE P +PLR+W++GYALQCVLH V V  EY
Sbjct  110  LAFVSVATAVLVMSKDEHPIMPLRVWLLGYALQCVLHMVCVCFEY  154



>ref|XP_006440560.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53800.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=380

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLSR+E+P +PL LWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_006440563.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53803.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=382

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLSR+E+P +PL LWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_006440561.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53801.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=381

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLSR+E+P +PL LWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQCVLHMVCVCVEYK  140



>ref|NP_172736.2| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q9LN71.1|RING1_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g12760; AltName: 
Full=RING finger protein At1g12760 [Arabidopsis thaliana]
 gb|AAF88088.1|AC025417_16 T12C24.29 [Arabidopsis thaliana]
 gb|AAM97036.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15598.1| unknown protein [Arabidopsis thaliana]
 gb|AAY63561.1| RING domain protein [Arabidopsis thaliana]
 gb|AEE28924.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=408

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR  +R+    L RA S G VMREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+V
Sbjct  48   RRSVRRQGLREAARFLSRASS-GRVMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIV  106

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A A+LV+SR E P +PLR+W++GYALQCVLH V V +EY
Sbjct  107  WNLAFVSVATAILVMSRKEHPIMPLRVWLLGYALQCVLHMVCVCVEY  153



>emb|CDP08874.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +3

Query  180  TPAAADGYAGTRPSLRRH-SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDW  356
            TP   D    +RP LRR  S+R     LRRA SR M +REPS  VR+AAAEQ++ERQSDW
Sbjct  26   TPLLRDQIFRSRPFLRRPPSLRGAARFLRRASSRRM-LREPSMRVREAAAEQIEERQSDW  84

Query  357  AYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            AYSKP+VILDLVWN+AFV+++ +VL+LSR E+P +PLRLW+VGYALQC+LH V V +EY+
Sbjct  85   AYSKPIVILDLVWNVAFVIVSISVLILSRYEKPSMPLRLWVVGYALQCLLHMVCVCVEYK  144



>ref|XP_011463818.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=387

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = +3

Query  168  SPLM--TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            SPL+  +  ++D     R  LR+ S+R     LR+A SR  +MREPS LVR+ AAEQ++E
Sbjct  17   SPLLASSGGSSDESNSGRRYLRQQSLRQAARFLRQASSR-RLMREPSMLVRETAAEQLEE  75

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E PE+PLRLWIVGYA+QC+LH V V
Sbjct  76   RQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRSESPEMPLRLWIVGYAMQCLLHMVCV  135

Query  522  SLEYQ  536
             +E++
Sbjct  136  CVEFK  140



>ref|XP_011463819.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = +3

Query  168  SPLM--TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            SPL+  +  ++D     R  LR+ S+R     LR+A SR  +MREPS LVR+ AAEQ++E
Sbjct  17   SPLLASSGGSSDESNSGRRYLRQQSLRQAARFLRQASSR-RLMREPSMLVRETAAEQLEE  75

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E PE+PLRLWIVGYA+QC+LH V V
Sbjct  76   RQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRSESPEMPLRLWIVGYAMQCLLHMVCV  135

Query  522  SLEYQ  536
             +E++
Sbjct  136  CVEFK  140



>ref|XP_004133878.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 ref|XP_004155812.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN56546.1| hypothetical protein Csa_3G123190 [Cucumis sativus]
Length=385

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +3

Query  165  NSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            NSPL+  +  +G   +R  +RR    +R  V +LRRA  R M++REPS  VR+ AAEQ++
Sbjct  17   NSPLLGHSVTNGLFRSRGFIRRSPQPLRGAVRLLRRASGRQMMLREPSVRVRETAAEQLE  76

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKP+++LDL+WNLAFV+I+  VL LS  E+P +PLR WI+GYALQC++H   
Sbjct  77   ERQSDWAYSKPIILLDLLWNLAFVIISFTVLGLSTSEKPSVPLRFWIIGYALQCIIHMSC  136

Query  519  VSLEYQ  536
            V++EY+
Sbjct  137  VAVEYK  142



>ref|XP_006440562.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53802.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=386

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVI  380
            ++ +R S+RR  +R+    LR A SR   MREPS +VR+ AAEQ++ERQSDWAYSKPVV+
Sbjct  30   HSQSRRSIRRQGLREAARFLRHASSR-RTMREPSMMVRETAAEQLEERQSDWAYSKPVVV  88

Query  381  LDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LD++WNLAFV +A +V+VLSR+E+P +PL LWIVGYA+QCVLH V V +EY+
Sbjct  89   LDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQCVLHMVCVCVEYK  140



>ref|XP_010533709.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Tarenaya hassleriana]
Length=401

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
             G R S+RR  +R+    LRRA S   +MREPS +VR+ AAEQ++E QS+WAYSKPVV+L
Sbjct  47   GGDRRSVRRQGLREAARFLRRASS-SRIMREPSMMVRETAAEQLEESQSNWAYSKPVVVL  105

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            D+VWNLAFV +AAA+LVLSRDE+P +PLR+WI+GYALQCVLH   V +EY
Sbjct  106  DIVWNLAFVAVAAAILVLSRDEKPNMPLRVWIIGYALQCVLHMACVCVEY  155



>ref|XP_010529547.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=400

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +3

Query  192  ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            A+    ++ S RR+ +R+   +LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKP
Sbjct  45   AESEGDSQRSSRRNGLREAARLLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKP  103

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            VV+LD+VWN+AFV +A AVLVLSRDE P +PLR+W+VGYALQC++H   V +EY
Sbjct  104  VVVLDIVWNVAFVAVAVAVLVLSRDELPNMPLRVWVVGYALQCLIHMACVCVEY  157



>ref|XP_010529546.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +3

Query  192  ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            A+    ++ S RR+ +R+   +LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKP
Sbjct  45   AESEGDSQRSSRRNGLREAARLLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKP  103

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            VV+LD+VWN+AFV +A AVLVLSRDE P +PLR+W+VGYALQC++H   V +EY
Sbjct  104  VVVLDIVWNVAFVAVAVAVLVLSRDELPNMPLRVWVVGYALQCLIHMACVCVEY  157



>gb|EYU32071.1| hypothetical protein MIMGU_mgv1a008136mg [Erythranthe guttata]
Length=383

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRRH--SIRDVVWVLRRAGSRGMVMREPSALVRQAA  323
            +P+ T +   TP  +D    + P   R   S+R     LRRA SRG  MR+PS  VR+ A
Sbjct  7    TPSPTAAVDSTPLLSDQILRSSPQFLRRTPSLRGAARFLRRASSRGRAMRDPSVRVRETA  66

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ++ERQSDWAYSKP+VILDLVWNLAF+ ++ +V+++SR E+P +PLRLWIVGYA+QCV
Sbjct  67   AEQIEERQSDWAYSKPIVILDLVWNLAFIAVSISVMIMSRLEKPSMPLRLWIVGYAVQCV  126

Query  504  LHAVSVSLEYQ  536
            LH   V +EY+
Sbjct  127  LHMACVCVEYR  137



>ref|XP_006391774.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29060.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=389

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S+RR  +R+   +LR A S  M+MREPS LVR++AAEQ++ERQSDWAYSKPVV+LD VWN
Sbjct  45   SVRRQGLREAARLLRHASSGRMMMREPSMLVRESAAEQLEERQSDWAYSKPVVVLDFVWN  104

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LAFV +A AVLVLS DE+P +PLR+WI+GY LQC++H + V +EY+
Sbjct  105  LAFVAVATAVLVLSSDEKPNMPLRVWIIGYGLQCMMHMLCVCVEYR  150



>ref|XP_006391773.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29059.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=388

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S+RR  +R+   +LR A S  M+MREPS LVR++AAEQ++ERQSDWAYSKPVV+LD VWN
Sbjct  45   SVRRQGLREAARLLRHASSGRMMMREPSMLVRESAAEQLEERQSDWAYSKPVVVLDFVWN  104

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LAFV +A AVLVLS DE+P +PLR+WI+GY LQC++H + V +EY+
Sbjct  105  LAFVAVATAVLVLSSDEKPNMPLRVWIIGYGLQCMMHMLCVCVEYR  150



>ref|XP_011093163.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Sesamum 
indicum]
Length=376

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRRA SRG  MREPS LVR AAAEQ++ERQSDWAYSKP+VILDLVWN+AFV+
Sbjct  34   SLRGAAQFLRRASSRGGAMREPSVLVRAAAAEQIEERQSDWAYSKPIVILDLVWNVAFVI  93

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            ++ +VL++SRDE P  PLRLWIV YALQCVL  V V  EY+
Sbjct  94   VSVSVLIMSRDETPSTPLRLWIVVYALQCVLRGVCVCTEYK  134



>ref|XP_009788378.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=171

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = +3

Query  144  MFSPTYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSR-GMVMREPSALVRQA  320
            MFS + +NSPL+     D     R S RRHS+R+ + V +RA +R G++MREPS      
Sbjct  1    MFSASSSNSPLLRSNENDESFHLR-SPRRHSLREAIRVFQRASNRSGLMMREPSD-----  54

Query  321  AAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQC  500
              +Q+++RQS+WAYSKPVVI+DL+WN A++++A  VL  SR+E PE+PLR+WIVGY+L C
Sbjct  55   --QQVNDRQSNWAYSKPVVIIDLLWNFAYIIVACFVLFFSREEDPEMPLRIWIVGYSLLC  112

Query  501  VLHAVSVSLEYQ  536
            VLH V V LEY+
Sbjct  113  VLHIVCVFLEYR  124



>ref|XP_006304987.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
 gb|EOA37885.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
Length=397

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S+RR  +R+    L RA S G VMREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWN
Sbjct  43   SVRRQGLREAARFLSRASS-GRVMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWN  101

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV +A AVLV+SR+E P +PLR+W++GYALQCVLH V V +EY
Sbjct  102  LAFVSVATAVLVMSRNEHPIMPLRVWLLGYALQCVLHMVCVCVEY  146



>emb|CDY16029.1| BnaC08g40940D [Brassica napus]
Length=380

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
             G R S RR  +R+    L RA S G  MREPS LVR+AAAEQ++ERQSDWAYSKPVV+L
Sbjct  31   GGERRSARRQGLREAAMFLSRASS-GRAMREPSMLVREAAAEQLEERQSDWAYSKPVVVL  89

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLE  530
            D+VWNLAFV +AA VLV+SR+E P +PLR+W++GYALQCVLH V V +E
Sbjct  90   DIVWNLAFVSVAATVLVMSRNENPIMPLRVWLLGYALQCVLHMVCVGIE  138



>ref|XP_008438088.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Cucumis 
melo]
Length=384

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +3

Query  165  NSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            NSPL+  +  +G   +R  +RR    +R  V +LRRA  R M++REPS  VR+ AAEQ++
Sbjct  17   NSPLLGHSVTNGLFRSRGFIRRSPQPLRGAVRLLRRASGRQMMLREPSVRVRETAAEQLE  76

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKP+++LDL+WNLAFV+I+  VL LS  E P +PLR WI+GYALQC++H   
Sbjct  77   ERQSDWAYSKPIILLDLLWNLAFVIISFTVLGLSTRENPSVPLRFWIIGYALQCIIHMSC  136

Query  519  VSLEYQ  536
            V++EY+
Sbjct  137  VAVEYK  142



>ref|XP_008438087.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Cucumis 
melo]
Length=385

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +3

Query  165  NSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            NSPL+  +  +G   +R  +RR    +R  V +LRRA  R M++REPS  VR+ AAEQ++
Sbjct  17   NSPLLGHSVTNGLFRSRGFIRRSPQPLRGAVRLLRRASGRQMMLREPSVRVRETAAEQLE  76

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKP+++LDL+WNLAFV+I+  VL LS  E P +PLR WI+GYALQC++H   
Sbjct  77   ERQSDWAYSKPIILLDLLWNLAFVIISFTVLGLSTRENPSVPLRFWIIGYALQCIIHMSC  136

Query  519  VSLEYQ  536
            V++EY+
Sbjct  137  VAVEYK  142



>ref|XP_006417201.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
 gb|ESQ35554.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
Length=408

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR  +R+    L RA S G  MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+V
Sbjct  53   RRSVRRQGLREAARFLSRASS-GRAMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIV  111

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A+AVLV+SR+E P +PLR+W++GYALQCVLH V V +EY
Sbjct  112  WNLAFVSVASAVLVMSRNEHPIMPLRVWLLGYALQCVLHMVCVCVEY  158



>emb|CDY31275.1| BnaC08g15700D [Brassica napus]
Length=394

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  222  LRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNl  401
            +RR  +R     L RA S G  MREPS +VR+AAAEQ++ERQSDWAYSKP+V+LD+VWNL
Sbjct  51   VRRQGLRGAARFLSRASSGGRAMREPSVIVREAAAEQLEERQSDWAYSKPIVVLDIVWNL  110

Query  402  afvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AFV +AAAVLV+SR+E P +PLR+W++GYALQCVLH V V +EY
Sbjct  111  AFVSVAAAVLVMSRNEHPIMPLRVWLLGYALQCVLHMVCVCVEY  154



>ref|XP_008800795.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Phoenix 
dactylifera]
Length=384

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +3

Query  156  TYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQM  335
            T    PL+   +  G    R + RR S+R      RRAGSR M +REPS LVR+AAAEQ+
Sbjct  14   TMDPGPLLGTRSGGGEDRGRRNGRRPSLRGAARFFRRAGSRRM-LREPSMLVREAAAEQL  72

Query  336  DERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAV  515
            +ERQ DWAYS+PVV LD++WNLAFV  +AAVLVLSR+E+P +PLRLWI GY LQCVLH V
Sbjct  73   EERQRDWAYSRPVVFLDILWNLAFVAASAAVLVLSREERPSMPLRLWIGGYVLQCVLHMV  132

Query  516  SVSLEYQ  536
             V +EY+
Sbjct  133  CVCIEYR  139



>ref|XP_006396865.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
 gb|ESQ38318.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
Length=402

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +3

Query  189  AADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSK  368
            + D   G   S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSK
Sbjct  45   SVDEDNGIHRSARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSK  103

Query  369  PVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            PVV LD++WNLAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V  EY
Sbjct  104  PVVFLDILWNLAFVAIGVAVLILSRDERPNMPLRVWVVGYGIQCGLHMACVCFEY  158



>gb|KHG14407.1| hypothetical protein F383_04260 [Gossypium arboreum]
Length=381

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            + TR S+RR S+ +    LRRA SR + MREPS LVR+ AAEQ++ER SDWAYSKPVV+L
Sbjct  34   SATRGSVRRQSLWEAARFLRRASSRRL-MREPSMLVRETAAEQLEERHSDWAYSKPVVVL  92

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            D++WN AFV  A  VL+LS +E+P +PLRLWI+GYALQC+LH V V +EY
Sbjct  93   DIIWNFAFVAAAVGVLILSWNERPSMPLRLWIIGYALQCLLHMVCVCVEY  142



>ref|XP_010545944.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X4 [Tarenaya hassleriana]
Length=411

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+    LRRA S G +MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +
Sbjct  67   LREAASFLRRASS-GRMMREPSRLVRETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSV  125

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  126  AAAVLVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  164



>gb|KFK31927.1| hypothetical protein AALP_AA6G177200 [Arabis alpina]
Length=389

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  GTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILD  386
            G   S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD
Sbjct  45   GIHRSARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLD  103

Query  387  LVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            ++WNLAFV I  AVL+LSRDE P +PLR+WIVGY +QC LH   V +EY
Sbjct  104  ILWNLAFVAIGVAVLILSRDEMPNMPLRVWIVGYGVQCGLHMACVCVEY  152



>ref|XP_010545928.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Tarenaya hassleriana]
Length=412

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+    LRRA S G +MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +
Sbjct  67   LREAASFLRRASS-GRMMREPSRLVRETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSV  125

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  126  AAAVLVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  164



>ref|XP_010545919.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Tarenaya hassleriana]
Length=413

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+    LRRA S G +MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +
Sbjct  67   LREAASFLRRASS-GRMMREPSRLVRETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSV  125

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  126  AAAVLVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  164



>ref|XP_010545936.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Tarenaya hassleriana]
Length=412

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+    LRRA S G +MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +
Sbjct  67   LREAASFLRRASS-GRMMREPSRLVRETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSV  125

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLSRDE+P +PLR+WIVGYALQCVLH V V +EY
Sbjct  126  AAAVLVLSRDEKPNMPLRVWIVGYALQCVLHMVCVCVEY  164



>gb|ACN40787.1| unknown [Picea sitchensis]
Length=397

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = +3

Query  180  TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWA  359
            +P A+D   G R   RR SI+     LRRA SR  +MREPS LVR+ AAEQ++ERQSDWA
Sbjct  30   SPNASDD--GARSLSRRASIQGAARFLRRASSR-RIMREPSMLVRETAAEQLEERQSDWA  86

Query  360  YSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            YS+PVV+LD++WNLAFV++A  VLVLSR E P +P+R+W+VGYALQC+LH + V  EY+
Sbjct  87   YSRPVVVLDIIWNLAFVVVATVVLVLSRHENPNMPVRVWVVGYALQCLLHMICVCFEYR  145



>ref|XP_009401775.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=451

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  PTYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQ  332
            P+      + PA   G AG   S R  S+R   W LRRA  R M MREPS +VR+ AAE 
Sbjct  88   PSPGGEGSVDPAPLLGGAGR--SGRGPSLRSAAWFLRRASGRRM-MREPSMMVRETAAEH  144

Query  333  MDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHA  512
            ++ERQ+DWAYSKPVV LD++WNLAFV +A  VL+LSRDE P +PLRLWIVGYA QC+LH 
Sbjct  145  LEERQNDWAYSKPVVFLDILWNLAFVGVAVGVLILSRDETPSMPLRLWIVGYAFQCLLHM  204

Query  513  VSVSLEYQ  536
            V V +EY+
Sbjct  205  VCVCIEYR  212



>gb|KFK43535.1| hypothetical protein AALP_AA1G139400 [Arabis alpina]
Length=397

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  213  RPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLV  392
            R S+RR  +R+    L RA S G  MREPS +VR+ AAEQ++ERQSDWAYSKPVV+LD+V
Sbjct  42   RRSVRRQGLREAARFLSRASS-GRAMREPSMVVRETAAEQLEERQSDWAYSKPVVVLDIV  100

Query  393  WNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            WNLAFV +A AVLV+SR+E P +PLR+WI+GYALQCVLH + V +EY
Sbjct  101  WNLAFVSVATAVLVMSRNEHPIMPLRVWILGYALQCVLHMICVCVEY  147



>ref|XP_009401774.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=452

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  PTYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQ  332
            P+      + PA   G AG   S R  S+R   W LRRA  R M MREPS +VR+ AAE 
Sbjct  88   PSPGGEGSVDPAPLLGGAGR--SGRGPSLRSAAWFLRRASGRRM-MREPSMMVRETAAEH  144

Query  333  MDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHA  512
            ++ERQ+DWAYSKPVV LD++WNLAFV +A  VL+LSRDE P +PLRLWIVGYA QC+LH 
Sbjct  145  LEERQNDWAYSKPVVFLDILWNLAFVGVAVGVLILSRDETPSMPLRLWIVGYAFQCLLHM  204

Query  513  VSVSLEYQ  536
            V V +EY+
Sbjct  205  VCVCIEYR  212



>ref|XP_009778598.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=383

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +3

Query  162  TNSPLMTPAAADGYAGTRPSLRRH-SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +N    TP   D    +R   RR  S+R     LRRA SR M +REPS  VR+AAAEQ++
Sbjct  12   SNGVDTTPLLTDQLFRSRRLARRAPSLRGAARFLRRASSRRM-LREPSRRVREAAAEQIE  70

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKP+VILDL+WNLAFV+++ +VL+LS DE P +PLRLWIVGYALQC+LH V 
Sbjct  71   ERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSLDESPSMPLRLWIVGYALQCLLHMVC  130

Query  519  VSLEYQ  536
            V +EY+
Sbjct  131  VCVEYR  136



>gb|KEH31714.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=371

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 2/123 (2%)
 Frame = +3

Query  168  SPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            +PL+  ++ +  +G R  LR  S+R     LR+A  R + MREPS +VR+ AAEQ++ERQ
Sbjct  7    TPLIGNSSDESNSGRR-VLRAPSLRQAARFLRQASGRRL-MREPSMMVRETAAEQLEERQ  64

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            SDWAYSKPVVILD++WN  F++ A  VL+LSR+E P  PLRLWI+GYALQCVLH V V  
Sbjct  65   SDWAYSKPVVILDILWNFVFIIAAVTVLILSRNESPSSPLRLWILGYALQCVLHVVCVCF  124

Query  528  EYQ  536
            EY+
Sbjct  125  EYR  127



>emb|CAN65431.1| hypothetical protein VITISV_017099 [Vitis vinifera]
Length=342

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRRA SR  +MREPS  VR+ AAEQ++ERQSDWAYSKP+VILD+VWNLAFV+
Sbjct  37   SLRGAARFLRRASSR-RIMREPSMRVRETAAEQLEERQSDWAYSKPIVILDIVWNLAFVV  95

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +A  VLV+SRDE P  PLRLWI+GY LQCVLH V + +EY+
Sbjct  96   VAMTVLVMSRDETPSTPLRLWIIGYGLQCVLHMVCICVEYK  136



>ref|XP_009762973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=389

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 11/134 (8%)
 Frame = +3

Query  162  TNSPLMTPAAADGYAGTRPSL----------RRHSIRDVVWVLRRAGSRGMVMREPSALV  311
            T++  ++P+   G   T P L          RR S+R     LRRA SR + MREPS  V
Sbjct  12   TSNADVSPSNGGGGVDTSPLLTNSRSQRSFHRRPSLRGAAGFLRRASSRRL-MREPSMRV  70

Query  312  RQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            R+AAAEQ++ERQSDWAYSKP+VILDLVWNLAFV++A +VL++S++E P +PLRLWI+GYA
Sbjct  71   REAAAEQIEERQSDWAYSKPIVILDLVWNLAFVIVAISVLIMSKNESPSMPLRLWIIGYA  130

Query  492  LQCVLHAVSVSLEY  533
            LQ VLH V V +EY
Sbjct  131  LQSVLHMVCVFVEY  144



>ref|XP_010430403.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Camelina sativa]
Length=383

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV +
Sbjct  29   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAV  88

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            A+AVLVLS DE+P +PLR+WI+GY LQC++H V V +EY
Sbjct  89   ASAVLVLSSDEKPNMPLRVWIIGYGLQCMMHMVCVCVEY  127



>ref|XP_004511598.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=393

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAE  329
            +P   NS      ++D     R   RR  +      LR+A  R M MREPS +VR+AAAE
Sbjct  18   TPFIANSG----GSSDEINAGRRFARRQRLLQAARFLRQASGRRM-MREPSVVVREAAAE  72

Query  330  QMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLH  509
            Q++ERQSDWAYSKPVVILD+VWN AFV++AA VL LSR E PE+PLRLWI GY LQC+LH
Sbjct  73   QLEERQSDWAYSKPVVILDIVWNFAFVVVAATVLFLSRSEVPEMPLRLWIAGYVLQCILH  132

Query  510  AVSVSLEYQ  536
             V V  EY+
Sbjct  133  MVCVCFEYK  141



>ref|NP_567379.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q93Z92.1|RING4_ARATH RecName: Full=E3 ubiquitin-protein ligase At4g11680; AltName: 
Full=RING finger protein At4g11680 [Arabidopsis thaliana]
 gb|AAL15343.1| AT4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAR23720.1| At4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAY57607.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE83038.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=390

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  59   SARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  117

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  118  LAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEY  162



>ref|XP_008780243.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Phoenix 
dactylifera]
Length=227

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 8/125 (6%)
 Frame = +3

Query  165  NSPLMTP-AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            ++PL+ P  A  G  G      R S+R     LRRA SR  +MREPS +VR+ A EQ++E
Sbjct  63   SAPLLGPHGAGRGLPG------RASLRGAARFLRRASSR-RLMREPSVVVRETAVEQLEE  115

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYS+PV+ LD++WNLAFV +AA VLV SRDE+P +PLRLWIVGYALQC LH + +
Sbjct  116  RQSDWAYSRPVMFLDILWNLAFVSVAAGVLVRSRDERPSMPLRLWIVGYALQCALHVICM  175

Query  522  SLEYQ  536
             +EY+
Sbjct  176  CIEYR  180



>ref|XP_009110628.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Brassica rapa]
Length=390

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  LRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNl  401
            +RR  +R+    L RA S G  MRE S +VR+AAAEQ++ERQSDWAYS+P+V+LD+VWNL
Sbjct  44   VRRQGLREAARFLSRASSGGRAMREQSVIVREAAAEQLEERQSDWAYSRPIVVLDIVWNL  103

Query  402  afvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            AFV +A AVLV+SR+E P +PLR+W++GYALQCVLH V V +EY+
Sbjct  104  AFVSVAGAVLVMSRNEHPIMPLRVWLLGYALQCVLHMVCVCVEYK  148



>ref|XP_009110629.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Brassica rapa]
Length=389

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  LRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNl  401
            +RR  +R+    L RA S G  MRE S +VR+AAAEQ++ERQSDWAYS+P+V+LD+VWNL
Sbjct  44   VRRQGLREAARFLSRASSGGRAMREQSVIVREAAAEQLEERQSDWAYSRPIVVLDIVWNL  103

Query  402  afvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            AFV +A AVLV+SR+E P +PLR+W++GYALQCVLH V V +EY+
Sbjct  104  AFVSVAGAVLVMSRNEHPIMPLRVWLLGYALQCVLHMVCVCVEYK  148



>ref|XP_010473550.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=382

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV +
Sbjct  31   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAV  90

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLS DE+P +PLR+WIVGY LQC++H V V +EY
Sbjct  91   AAAVLVLSSDEKPNMPLRVWIVGYGLQCMMHMVCVCVEY  129



>ref|XP_010422123.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  54   SARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  112

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY  QC LH   V +EY
Sbjct  113  LAFVAIGVAVLILSRDERPNVPLRVWVVGYGFQCGLHMACVCVEY  157



>emb|CAB39939.1| putative protein [Arabidopsis thaliana]
 emb|CAB78211.1| putative protein [Arabidopsis thaliana]
Length=419

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  59   SARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  117

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  118  LAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEY  162



>ref|XP_006302394.1| hypothetical protein CARUB_v10020462mg [Capsella rubella]
 gb|EOA35292.1| hypothetical protein CARUB_v10020462mg [Capsella rubella]
Length=382

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV +
Sbjct  29   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAV  88

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLS DE+P +PLR+WI+GY LQC++H V V +EY
Sbjct  89   AAAVLVLSSDEKPNMPLRVWIIGYGLQCMMHMVCVCVEY  127



>ref|XP_010434567.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  54   SARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  112

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY  QC LH   V +EY
Sbjct  113  LAFVAIGVAVLILSRDERPNVPLRVWVVGYGFQCGLHMACVCVEY  157



>ref|XP_002271651.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Vitis vinifera]
Length=382

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRRA SR  +MREPS  VR+ AAEQ++ERQSDWAYSKP+VILD+VWNLAFV+
Sbjct  37   SLRGAARFLRRASSR-RIMREPSMRVRETAAEQLEERQSDWAYSKPIVILDIVWNLAFVV  95

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +A  VLV+SRDE P  PLRLWI+GY LQCVLH V V +EY+
Sbjct  96   VAMTVLVMSRDETPSTPLRLWIIGYGLQCVLHMVCVCVEYK  136



>ref|XP_010418331.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=382

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV +
Sbjct  30   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAV  89

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            AAAVLVLS DE+P +PLR+WI+GY LQC++H V V +EY
Sbjct  90   AAAVLVLSSDEKPNMPLRVWIIGYGLQCMMHMVCVCVEY  128



>ref|XP_006287901.1| hypothetical protein CARUB_v10001135mg [Capsella rubella]
 gb|EOA20799.1| hypothetical protein CARUB_v10001135mg [Capsella rubella]
Length=395

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  56   SARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  114

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  115  LAFVAIGVAVLILSRDERPNVPLRVWVVGYGIQCWLHMACVCVEY  159



>ref|XP_010455583.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=392

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  54   SARRQGLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  112

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY  QC LH   V +EY
Sbjct  113  LAFVAIGVAVLILSRDERPNVPLRVWVVGYGFQCGLHMACVCVEY  157



>ref|XP_002874711.1| hypothetical protein ARALYDRAFT_327304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50970.1| hypothetical protein ARALYDRAFT_327304 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            S RR  +R+    LR AGSR MV REPS LVR+ AAEQ++ERQSDWAYSKPVV LD++WN
Sbjct  58   SARRQGLREAARFLRHAGSRRMV-REPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWN  116

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            LAFV I  AVL+LSRDE+P +PLR+W+VGY +QC LH   V +EY
Sbjct  117  LAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEY  161



>ref|NP_564810.1| zinc finger, C3HC4 type (RING finger) family protein [Arabidopsis 
thaliana]
 sp|Q8LDB8.2|RING2_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g63170; AltName: 
Full=RING finger protein At1g63170 [Arabidopsis thaliana]
 gb|AAG51597.1|AC010795_1 hypothetical protein; 76801-78300 [Arabidopsis thaliana]
 gb|AEE34064.1| zinc finger, C3HC4 type (RING finger) family protein [Arabidopsis 
thaliana]
Length=381

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV++
Sbjct  29   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVVV  88

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            A AVLVLS DE P +PLR+WI+GY LQC++H V V +EY
Sbjct  89   ATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEY  127



>ref|XP_010540680.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X4 [Tarenaya hassleriana]
Length=403

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
             +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD+VWN+AFV 
Sbjct  62   GLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVVLDIVWNVAFVA  120

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            +A A LVLSR+E+P +PLR+W+VGYALQC+LH   V +EY
Sbjct  121  VAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>gb|AAM63303.1| unknown [Arabidopsis thaliana]
Length=381

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV++
Sbjct  29   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVVV  88

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            A AVLVLS DE P +PLR+WI+GY LQC++H V V +EY
Sbjct  89   ATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEY  127



>ref|XP_010540663.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Tarenaya hassleriana]
Length=404

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
             +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD+VWN+AFV 
Sbjct  62   GLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVVLDIVWNVAFVA  120

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            +A A LVLSR+E+P +PLR+W+VGYALQC+LH   V +EY
Sbjct  121  VAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>ref|XP_010540654.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Tarenaya hassleriana]
Length=405

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
             +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD+VWN+AFV 
Sbjct  62   GLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVVLDIVWNVAFVA  120

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            +A A LVLSR+E+P +PLR+W+VGYALQC+LH   V +EY
Sbjct  121  VAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>ref|XP_010540671.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X3 [Tarenaya hassleriana]
Length=404

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
             +R+    LR AGSR M MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD+VWN+AFV 
Sbjct  62   GLREAARFLRHAGSRRM-MREPSMLVRETAAEQLEERQSDWAYSKPVVVLDIVWNVAFVA  120

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            +A A LVLSR+E+P +PLR+W+VGYALQC+LH   V +EY
Sbjct  121  VAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>gb|AAL24200.1| At1g63170/F16M19_7 [Arabidopsis thaliana]
Length=381

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R+   +LR A S  M+MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD VWNLAFV++
Sbjct  29   LREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVVV  88

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            A AVLVLS DE P +PLR+WI+GY LQC++H V V +EY
Sbjct  89   ATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEY  127



>ref|XP_009352819.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Pyrus 
x bretschneideri]
Length=381

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAA  323
            SP+  +SPL+  + AD    +R  +RR  H +R     LRRA SR M++REPS  VR+AA
Sbjct  10   SPSDASSPLLGHSIADNIVRSRRLIRRAPHPLRGAARFLRRASSRRMMLREPSVRVREAA  69

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ+++RQSDWAYS+P+++LDL+WN   + +A  VL LS  E+P +PLR WI GYA QC+
Sbjct  70   AEQVEDRQSDWAYSRPIIVLDLLWNAGLLGLAVGVLSLSWKEEPSVPLRTWIGGYAFQCL  129

Query  504  LHAVSVSLEYQ  536
            +H V V +E +
Sbjct  130  VHMVCVVVECK  140



>ref|XP_003570089.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
 ref|XP_010235813.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
Length=374

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTR--PSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAA  323
            SP+     L+  A   G  GTR    LRR S+R    +LR+ G R   MREPS LVR+ A
Sbjct  6    SPSSRGDALLDSAPLLG-GGTRRRGVLRRPSLRGTARLLRQGGRR--AMREPSLLVRETA  62

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ++ERQ+DWAYS+PVV LDL+WNLAF+L++A VLV S DE P +PLR+WI GYA+QCV
Sbjct  63   AEQLEERQADWAYSRPVVALDLLWNLAFILVSAVVLVFSSDENPSVPLRIWIAGYAVQCV  122

Query  504  LHAVSVSLEYQ  536
            LH V V++EY+
Sbjct  123  LHIVCVAIEYR  133



>gb|KJB25759.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
 gb|KJB25760.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
Length=381

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  165  NSPLMTPA--AADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
             +P ++P   A++  + TR ++RR S+RD    LRRA SR  +MREPS LVR+ AAEQ++
Sbjct  18   TTPFLSPTSNASNDDSSTRRTVRRQSLRDAARFLRRASSR-RMMREPSMLVRETAAEQLE  76

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKPVV+LD++WNLAFV++A  VL+LSR+E P++PLRLWI+GYA QC LH V 
Sbjct  77   ERQSDWAYSKPVVVLDIIWNLAFVVVAVGVLILSRNESPDMPLRLWIIGYAFQCFLHIVC  136

Query  519  VSLEY  533
            V +EY
Sbjct  137  VCVEY  141



>gb|KFK40526.1| hypothetical protein AALP_AA2G007300 [Arabis alpina]
Length=359

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 4/132 (3%)
 Frame = +3

Query  144  MFSPTYTNSPLMTPAAADG--YAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQ  317
            M + T   SPL+     D    +G R S+RR  +R+   +LR A S    MR+ S LVR+
Sbjct  1    MSNNTIDASPLLLTRGVDNDDGSGGRRSVRRQGLREAARLLRHASSG--RMRDSSMLVRE  58

Query  318  AAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            +AAEQ++ERQSDWAYSKPVV+LD VWN AFV++A  VLV S DE P +PLR+WIVGY LQ
Sbjct  59   SAAEQLEERQSDWAYSKPVVVLDFVWNFAFVVVAIVVLVFSNDENPNMPLRVWIVGYGLQ  118

Query  498  CVLHAVSVSLEY  533
            C++H   V +EY
Sbjct  119  CMMHMGCVCVEY  130



>ref|XP_003611137.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES94095.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
 gb|AFK41451.1| unknown [Medicago truncatula]
Length=387

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R   MREPS +VR+AAAEQ++ERQSDWAYSKPVVILD+VWN AFV++A   L L
Sbjct  48   LRQASGR-RTMREPSVVVREAAAEQLEERQSDWAYSKPVVILDIVWNFAFVIVAGTALFL  106

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            SR+E PE+PLRLWI GY LQCVLH V V  EY
Sbjct  107  SRNEAPEMPLRLWIAGYVLQCVLHMVCVCFEY  138



>ref|XP_010278589.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Nelumbo 
nucifera]
Length=387

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R     L+RA SR M +REPS LVR+ AAEQ++ERQSDWAYS+PVV+LD+VWN+A
Sbjct  38   RRPSLRGAARFLQRASSRRM-LREPSMLVRETAAEQLEERQSDWAYSRPVVVLDMVWNMA  96

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV++A A L+LSR+E P +PLRLWI+GYA+QC+LH V V  EY+
Sbjct  97   FVIVAVAFLILSRNESPSMPLRLWIMGYAVQCILHMVCVYAEYR  140



>ref|XP_010278591.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Nelumbo 
nucifera]
Length=386

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R     L+RA SR M +REPS LVR+ AAEQ++ERQSDWAYS+PVV+LD+VWN+A
Sbjct  38   RRPSLRGAARFLQRASSRRM-LREPSMLVRETAAEQLEERQSDWAYSRPVVVLDMVWNMA  96

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV++A A L+LSR+E P +PLRLWI+GYA+QC+LH V V  EY+
Sbjct  97   FVIVAVAFLILSRNESPSMPLRLWIMGYAVQCILHMVCVYAEYR  140



>ref|XP_010278588.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R     L+RA SR M +REPS LVR+ AAEQ++ERQSDWAYS+PVV+LD+VWN+A
Sbjct  38   RRPSLRGAARFLQRASSRRM-LREPSMLVRETAAEQLEERQSDWAYSRPVVVLDMVWNMA  96

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV++A A L+LSR+E P +PLRLWI+GYA+QC+LH V V  EY+
Sbjct  97   FVIVAVAFLILSRNESPSMPLRLWIMGYAVQCILHMVCVYAEYR  140



>ref|XP_010278590.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Nelumbo 
nucifera]
Length=387

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R     L+RA SR M +REPS LVR+ AAEQ++ERQSDWAYS+PVV+LD+VWN+A
Sbjct  38   RRPSLRGAARFLQRASSRRM-LREPSMLVRETAAEQLEERQSDWAYSRPVVVLDMVWNMA  96

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV++A A L+LSR+E P +PLRLWI+GYA+QC+LH V V  EY+
Sbjct  97   FVIVAVAFLILSRNESPSMPLRLWIMGYAVQCILHMVCVYAEYR  140



>ref|XP_009148567.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Brassica rapa]
Length=400

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGM-VMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVW  395
            S+RR  +R+   +L RA S G   MREPS +VR+AAAEQ++ERQSDWAYSKP+V+LD+VW
Sbjct  49   SVRRPGLREAARLLSRASSGGGRAMREPSMVVREAAAEQLEERQSDWAYSKPIVVLDIVW  108

Query  396  NlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            NLAFV +A AVLV++R+E P +PLR+W++GYALQCVLH V V +EY
Sbjct  109  NLAFVSVAGAVLVMARNEHPMMPLRVWLLGYALQCVLHMVCVLVEY  154



>emb|CDY66607.1| BnaA06g38090D [Brassica napus]
Length=399

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGM-VMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVW  395
            S+RR  +R+   +L RA S G   MREPS +VR+AAAEQ++ERQSDWAYSKP+V+LD+VW
Sbjct  47   SVRRPGLREAARLLSRASSGGGRAMREPSMVVREAAAEQLEERQSDWAYSKPIVVLDIVW  106

Query  396  NlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            NLAFV +A AVLV++R+E P +PLR+W++GYALQCVLH V V +EY
Sbjct  107  NLAFVSVAGAVLVMARNEHPMMPLRVWLLGYALQCVLHMVCVLVEY  152



>ref|XP_003525718.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=380

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R + MREPS +VR+AAAEQ++ERQSDWAYSKPVV+LD++WN AFV  AA V +L
Sbjct  48   LRQASGRRL-MREPSMVVREAAAEQLEERQSDWAYSKPVVVLDILWNFAFVAAAATVFIL  106

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            SR+E P +PLRLWIVGYALQCVLH   V +EYQ
Sbjct  107  SRNENPNMPLRLWIVGYALQCVLHVACVCVEYQ  139



>gb|KHG06982.1| hypothetical protein F383_33104 [Gossypium arboreum]
Length=381

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  165  NSPLMTPAA--ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
             +P ++P +  ++  + TR ++RR S+RD    LRRA SR  +MREPS LVR+ AAEQ++
Sbjct  18   TTPFLSPTSNVSNDDSSTRRTVRRQSLRDAARFLRRASSR-RMMREPSMLVRETAAEQLE  76

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKPVV+LD++WNLAFV++A  +L+LSR+E P++PLRLWI+GYA QC LH V 
Sbjct  77   ERQSDWAYSKPVVVLDIIWNLAFVVVAVGILILSRNESPDMPLRLWIIGYAFQCFLHIVC  136

Query  519  VSLEY  533
            V +EY
Sbjct  137  VCVEY  141



>emb|CDY60265.1| BnaC05g49290D [Brassica napus]
Length=359

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +3

Query  186  AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGM-VMREPSALVRQAAAEQMDERQSDWAY  362
            ++++G    R S+RR  +R+   +L RA S G   MREPS +VR+AAAEQ++ERQSDWAY
Sbjct  34   SSSNGGEQRRSSVRRPGLREAARLLSRASSGGGRAMREPSMVVREAAAEQLEERQSDWAY  93

Query  363  SKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            SKP+V+LD+VWNLAFV +A A+LV++R+E P +PLR+W++GYALQCVLH V V
Sbjct  94   SKPIVVLDIVWNLAFVSVAGAILVMARNEHPIMPLRVWLLGYALQCVLHMVCV  146



>ref|XP_003517458.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=385

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LRRA  R M MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWN AFV++A AVLVL
Sbjct  47   LRRASGRRM-MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNFAFVVVAGAVLVL  105

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            S  E P +PLRLWIVGYA+QCVLH V V +EY
Sbjct  106  SASEAPGMPLRLWIVGYAMQCVLHMVCVCVEY  137



>ref|XP_004229832.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Solanum lycopersicum]
Length=383

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +3

Query  162  TNSPLMTPAAADGYAGTRPSLRRH-SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +N    TP   D    +R   RR  ++R     LRRA S   +MREPS  VR+AAAE ++
Sbjct  12   SNGVDTTPLLTDQVFRSRRLARRAPTLRGAARFLRRA-SNHRLMREPSRRVREAAAEHIE  70

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKP+VILDL+WNLAFV+++ +VL+LS DE P +PLRLWIVGYALQC+LH V 
Sbjct  71   ERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSHDELPSMPLRLWIVGYALQCLLHMVC  130

Query  519  VSLEYQ  536
            V +EY+
Sbjct  131  VCVEYR  136



>gb|EPS63490.1| hypothetical protein M569_11294, partial [Genlisea aurea]
Length=347

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRRA SRG  MREPS  VR+AA E+++ERQSD AYSKP+VILD+VWN+ F++
Sbjct  1    SLRGAARFLRRASSRGRTMREPSVRVREAATEEIEERQSDLAYSKPIVILDIVWNVLFLI  60

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +A +VLV+SR E P +PLR+WIVGYALQC+LH   V +EY+
Sbjct  61   VAVSVLVVSRFETPSMPLRMWIVGYALQCLLHMFCVCVEYK  101



>ref|XP_007040144.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
 gb|EOY24645.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
Length=381

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  TRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDL  389
            TR S+RR S+R+    LRRA SR  +MREPS LVR+ AAEQ++ERQSDWAYSKPVVILD+
Sbjct  35   TRRSVRRQSLREAARFLRRASSR-RMMREPSMLVRETAAEQLEERQSDWAYSKPVVILDI  93

Query  390  VWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            +WN AFV +A  VLV SRDE+P +PLRLWI+GYALQC+LH V V +EY
Sbjct  94   IWNFAFVAVAVGVLVWSRDERPNMPLRLWIIGYALQCLLHMVCVCVEY  141



>ref|XP_007040145.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
 gb|EOY24646.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
Length=380

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  TRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDL  389
            TR S+RR S+R+    LRRA SR  +MREPS LVR+ AAEQ++ERQSDWAYSKPVVILD+
Sbjct  35   TRRSVRRQSLREAARFLRRASSR-RMMREPSMLVRETAAEQLEERQSDWAYSKPVVILDI  93

Query  390  VWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            +WN AFV +A  VLV SRDE+P +PLRLWI+GYALQC+LH V V +EY
Sbjct  94   IWNFAFVAVAVGVLVWSRDERPNMPLRLWIIGYALQCLLHMVCVCVEY  141



>ref|XP_004515807.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=379

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = +3

Query  123  VSKIRLKMFSPTYTNSPL-MTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREP  299
            +S  R +  SP  T  P  +  +++D     R  +R  S+R     LR+A  R + MREP
Sbjct  1    MSTTRSQNRSPDETTDPTPLIGSSSDESNSGRRVIRAPSLRQAARFLRQASGRRL-MREP  59

Query  300  SALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWI  479
            S +VR+ AAEQ++ERQSDWAYSKPVVILD++WN AFV+ A  VL+LS +E P  PLRLWI
Sbjct  60   SMMVRETAAEQLEERQSDWAYSKPVVILDILWNFAFVVAAVTVLILSPNESPSTPLRLWI  119

Query  480  VGYALQCVLHAVSVSLEY  533
            +GYALQCV+H + V  E+
Sbjct  120  LGYALQCVVHVLCVCFEF  137



>ref|XP_010112554.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC34101.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=378

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  165  NSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDER  344
             +P +  ++ DG + +R  ++R S+R     LR+A SR + MREPS LVR+AAAEQ++ER
Sbjct  17   TTPFLGGSSEDGNSASRRFVQRQSLRQAARFLRQASSRRL-MREPSMLVREAAAEQLEER  75

Query  345  QSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            Q DWAYSKPVVILD++WN AFV+ AA VLVLS  E PE+PLRLWIVGYALQ
Sbjct  76   QGDWAYSKPVVILDVIWNFAFVVAAATVLVLSHRESPEMPLRLWIVGYALQ  126



>ref|XP_007158469.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
 gb|ESW30463.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
Length=390

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R M MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWN AFV++A  VLVL
Sbjct  51   LRQASGRRM-MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNFAFVIVAGTVLVL  109

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            S  E P +PLRLWI+GYALQC+LH V V +EY
Sbjct  110  SASEAPGMPLRLWILGYALQCILHMVCVCVEY  141



>ref|XP_008383660.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAA  323
            S +  +SPL+  + AD    +R  +RR  H +R     LRRA SR M++REPS  VR+AA
Sbjct  10   SASDASSPLLGHSLADNIVRSRRLIRRPPHPLRGAARFLRRASSRRMMLREPSVRVREAA  69

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ+++RQSDWAYS+P+++LDL+WN   + IA  VL LS  E+P +PLR WI GYA QC+
Sbjct  70   AEQVEDRQSDWAYSRPIIVLDLLWNAGLLGIAVGVLSLSWKEEPSVPLRTWIGGYAFQCL  129

Query  504  LHAVSVSLEYQ  536
            +H V V +E +
Sbjct  130  VHMVCVVVECK  140



>ref|XP_010940871.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=383

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     L+RA SR M MREPS LVR+AAAEQ++ERQSDWAYS+PVV LD++WNLAFV 
Sbjct  40   SLRGAARFLQRASSRHM-MREPSMLVREAAAEQLEERQSDWAYSRPVVFLDILWNLAFVA  98

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             AAAVL+LS +E+P +PLRLWI GYALQCVLH V V +EYQ
Sbjct  99   AAAAVLILSWEERPSVPLRLWIGGYALQCVLHMVCVCIEYQ  139



>ref|XP_010940872.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=382

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     L+RA SR M MREPS LVR+AAAEQ++ERQSDWAYS+PVV LD++WNLAFV 
Sbjct  40   SLRGAARFLQRASSRHM-MREPSMLVREAAAEQLEERQSDWAYSRPVVFLDILWNLAFVA  98

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             AAAVL+LS +E+P +PLRLWI GYALQCVLH V V +EYQ
Sbjct  99   AAAAVLILSWEERPSVPLRLWIGGYALQCVLHMVCVCIEYQ  139



>ref|XP_009617349.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
tomentosiformis]
Length=389

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 94/135 (70%), Gaps = 11/135 (8%)
 Frame = +3

Query  162  TNSPLMTPAAADGYAGTRPSLRRHS----------IRDVVWVLRRAGSRGMVMREPSALV  311
            T++  ++P+   G   T P L              +R     LRRA SR  +MREPS  V
Sbjct  12   TSNADISPSDGGGGVDTSPLLTNSRSRRSFHRRPSLRGAAGFLRRASSR-RLMREPSMRV  70

Query  312  RQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            R+AAAEQ++ERQSDWAYSKP+VILDL+WNLAFV++A +VL++S++E P +PLRLWI+GYA
Sbjct  71   REAAAEQIEERQSDWAYSKPIVILDLIWNLAFVIVAISVLIMSKNESPSMPLRLWIIGYA  130

Query  492  LQCVLHAVSVSLEYQ  536
            LQ VLH V V +EY+
Sbjct  131  LQSVLHMVCVFVEYR  145



>ref|XP_006345510.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=396

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRRA SR  +MREPS  VR+AAAEQ++ERQSDWAYSKP+VI+DL+WNLAFV+
Sbjct  46   SLRGAAGFLRRASSR-RLMREPSMRVREAAAEQIEERQSDWAYSKPIVIIDLLWNLAFVI  104

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            ++ +VLVLSR+E P +PLRLWIVGYALQ VLH V V +EY
Sbjct  105  VSISVLVLSRNESPSMPLRLWIVGYALQSVLHMVCVFVEY  144



>ref|XP_008358659.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAA  323
            S +  +SPL+  + AD    +R  +RR  H +R     LRRA SR M++REPS  VR+AA
Sbjct  10   SASDASSPLLGHSLADNIVRSRRLIRRPPHPLRGAARFLRRASSRRMMLREPSVRVREAA  69

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ+++RQSDWAYS+P+++LDL+WN   + IA  VL LS  E+P +PLR WI GYA QC+
Sbjct  70   AEQVEDRQSDWAYSRPIIVLDLLWNAGLLGIAVGVLSLSWKEEPSVPLRTWIGGYAFQCL  129

Query  504  LHAVSVSLEYQ  536
            +H V V +E +
Sbjct  130  VHMVCVVVECK  140



>ref|XP_006590532.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
Length=388

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R M MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWNLAFV++A  VLVL
Sbjct  47   LRQASGRRM-MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVVVAGTVLVL  105

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            S  E P +PLRLWIVGYA+QCVLH V V +EY
Sbjct  106  SASEAPGMPLRLWIVGYAMQCVLHMVFVCVEY  137



>ref|XP_003538385.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
Length=387

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R M MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWNLAFV++A  VLVL
Sbjct  47   LRQASGRRM-MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVVVAGTVLVL  105

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            S  E P +PLRLWIVGYA+QCVLH V V +EY
Sbjct  106  SASEAPGMPLRLWIVGYAMQCVLHMVFVCVEY  137



>dbj|BAD29468.1| ring zinc finger protein-like [Oryza sativa Japonica Group]
Length=399

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 84/101 (83%), Gaps = 2/101 (2%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRR+G R M  REPS LVR+AAA+Q++ERQ+DWAYS+PVV LDL+WNLAF+L
Sbjct  40   SLRGAARFLRRSGRRAM--REPSLLVREAAADQLEERQADWAYSRPVVALDLLWNLAFIL  97

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +AAAVL LSR+E P +PLRLWIVGYA+QCVLH   V++EY+
Sbjct  98   VAAAVLALSREESPSMPLRLWIVGYAVQCVLHMACVAIEYR  138



>ref|NP_001047717.2| Os02g0674700 [Oryza sativa Japonica Group]
 dbj|BAF09631.2| Os02g0674700 [Oryza sativa Japonica Group]
Length=379

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 84/101 (83%), Gaps = 2/101 (2%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R     LRR+G R M  REPS LVR+AAA+Q++ERQ+DWAYS+PVV LDL+WNLAF+L
Sbjct  40   SLRGAARFLRRSGRRAM--REPSLLVREAAADQLEERQADWAYSRPVVALDLLWNLAFIL  97

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +AAAVL LSR+E P +PLRLWIVGYA+QCVLH   V++EY+
Sbjct  98   VAAAVLALSREESPSMPLRLWIVGYAVQCVLHMACVAIEYR  138



>ref|XP_007155554.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
 gb|ESW27548.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
Length=378

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R + MREPS +VR+AAAEQ++ERQSDWAYSKPVV+LD++WN AFV+ AA VL+L
Sbjct  47   LRQASGRRL-MREPSMVVREAAAEQLEERQSDWAYSKPVVVLDILWNFAFVVAAATVLIL  105

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
             R+E P +PLRLWIVGYA+QCVLH   V +EY
Sbjct  106  GRNENPNMPLRLWIVGYAMQCVLHVACVCVEY  137



>gb|KHG06981.1| hypothetical protein F383_33104 [Gossypium arboreum]
Length=686

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  165  NSPLMTPAA--ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
             +P ++P +  ++  + TR ++RR S+RD    LRRA SR  +MREPS LVR+ AAEQ++
Sbjct  18   TTPFLSPTSNVSNDDSSTRRTVRRQSLRDAARFLRRASSR-RMMREPSMLVRETAAEQLE  76

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKPVV+LD++WNLAFV++A  +L+LSR+E P++PLRLWI+GYA QC LH V 
Sbjct  77   ERQSDWAYSKPVVVLDIIWNLAFVVVAVGILILSRNESPDMPLRLWIIGYAFQCFLHIVC  136

Query  519  VSLEY  533
            V +EY
Sbjct  137  VCVEY  141



>ref|XP_006339453.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=383

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +3

Query  162  TNSPLMTPAAADGYAGTRPSLRRH-SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +N    TP   D    +R   RR  ++R     LRRA S   +MREPS  VR+AAAE ++
Sbjct  12   SNGVDTTPLLTDQVFRSRRLARRAPTLRGAARFLRRA-SNHRLMREPSRRVREAAAEHIE  70

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYSKP+VILDL+WNLAFV+++ +VL+LS DE P +PLRLWIVGY LQC+LH V 
Sbjct  71   ERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSLDELPSMPLRLWIVGYGLQCLLHMVC  130

Query  519  VSLEYQ  536
            V +EY+
Sbjct  131  VCVEYR  136



>ref|XP_009382298.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            L  A SR  VMREPS +VR+ AAE ++ERQSDWAYSKPVV LD++WNLAFV +A  VL+L
Sbjct  43   LHGASSR-HVMREPSMMVRETAAEHLEERQSDWAYSKPVVFLDILWNLAFVGVAFGVLIL  101

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            SRDE P +PLRLWIVGYALQCVLH V V +EY+
Sbjct  102  SRDEMPSMPLRLWIVGYALQCVLHMVCVCIEYR  134



>ref|XP_009393489.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R     LRRAGSR   MREPS LVR+AAAEQ+ ERQS WA S+PVV LD +WNLA
Sbjct  40   RRPSLRGAARFLRRAGSR-RGMREPSLLVREAAAEQLQERQSGWAQSRPVVFLDALWNLA  98

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV  A  VLVLSR+E P +PLRLWI GYALQCVLH + VS+++Q
Sbjct  99   FVAAAGGVLVLSREETPSMPLRLWIGGYALQCVLHIICVSVQFQ  142



>ref|XP_009411463.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +3

Query  252  WVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavl  431
            W  RR  SR M MREPS +VR+ AAE ++ERQ+DWAYSKPVV LD++WNLAFV +A  VL
Sbjct  41   WFFRRTSSRQM-MREPSMMVRETAAEHLEERQTDWAYSKPVVFLDILWNLAFVGVAVGVL  99

Query  432  vlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            VLSR+E P +PLR WIVGYALQCVLH V V +EY+
Sbjct  100  VLSRNETPLMPLRAWIVGYALQCVLHMVCVCIEYR  134



>dbj|BAK02342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            +LRR S+R    +LRR+G R M  REPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WN
Sbjct  33   ALRRPSLRGAARLLRRSGRRAM--REPSMLVREAAAEHLEERQADWAYSRPVVALDLLWN  90

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            ++F+ +AA VLVLSR+E   +PLR W+ GYALQC++H V V++EY+
Sbjct  91   ISFITVAAVVLVLSRNENSPMPLRTWVAGYALQCIVHMVCVAVEYR  136



>gb|KDO63535.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=323

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS +VR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +A +V+VLS++E+P +PL
Sbjct  1    MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            RLWIVGYA+QCVLH V V +EY+
Sbjct  61   RLWIVGYAIQCVLHMVCVCVEYK  83



>gb|KDO63537.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=325

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS +VR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +A +V+VLS++E+P +PL
Sbjct  1    MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            RLWIVGYA+QCVLH V V +EY+
Sbjct  61   RLWIVGYAIQCVLHMVCVCVEYK  83



>gb|KDO63536.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=324

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS +VR+ AAEQ++ERQSDWAYSKPVV+LD++WNLAFV +A +V+VLS++E+P +PL
Sbjct  1    MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            RLWIVGYA+QCVLH V V +EY+
Sbjct  61   RLWIVGYAIQCVLHMVCVCVEYK  83



>gb|KHG00725.1| hypothetical protein F383_22058 [Gossypium arboreum]
Length=381

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = +3

Query  168  SPLM--TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            +PL+  T  A+   +  R S+RR S+R+    LRRA SR  +MREPS LVR+ AAEQ++E
Sbjct  19   TPLLSSTSNASRDESNPRRSVRRQSLREAARFLRRASSR-RMMREPSMLVRETAAEQLEE  77

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYSKPVV+LD++WN AFV ++  VL+ SR+E+P+ PLRLWI+GYALQC+LH V V
Sbjct  78   RQSDWAYSKPVVVLDIIWNFAFVAVSIGVLLSSREERPDTPLRLWIIGYALQCLLHMVCV  137

Query  522  SLEYQ  536
             +EY+
Sbjct  138  CVEYR  142



>ref|XP_002889965.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66224.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWNLAFV +A A+LV+SR+E P +PL
Sbjct  1    MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRNEHPIMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEY  533
            R+W++GYALQCVLH V V +EY
Sbjct  61   RVWLLGYALQCVLHMVCVCVEY  82



>dbj|BAK00653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            +LRR S+R    +LRR+G R M  REPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WN
Sbjct  33   ALRRPSLRGAARLLRRSGRRAM--REPSMLVREAAAEHLEERQADWAYSRPVVALDLLWN  90

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            ++F+ +AA VLVLSR+E   +PLR W+ GYALQC++H V V++EY+
Sbjct  91   ISFITVAAVVLVLSRNENSPMPLRTWVAGYALQCIVHMVCVAVEYR  136



>ref|XP_002509740.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF51127.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=383

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = +3

Query  150  SPTYTNSPLM--TPAAADGYAG-TRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQA  320
            +P  +N  ++  TP  + G  G +  S RR S+R+    LRRA SR  +MREPS LVR+ 
Sbjct  11   NPIRSNDDIVDTTPLLSSGSQGESNSSSRRQSLREAARFLRRASSR-RMMREPSMLVRET  69

Query  321  AAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQC  500
            AAEQ++ERQSDWAYSKPVVILD++WN AFV +A  VL++SR E P +PLRLWIVGY LQC
Sbjct  70   AAEQLEERQSDWAYSKPVVILDILWNFAFVAVAIGVLIMSRKEDPSMPLRLWIVGYGLQC  129

Query  501  VLHAVSVSLEY  533
            VLH V V +EY
Sbjct  130  VLHMVCVCVEY  140



>dbj|BAK01729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +3

Query  219  SLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWN  398
            +LRR S+R    +LRR+G R M  REPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WN
Sbjct  33   ALRRPSLRGAARLLRRSGRRAM--REPSMLVREAAAEHLEERQADWAYSRPVVALDLLWN  90

Query  399  lafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            ++F+ +AA VLVLSR+E   +PLR W+ GYALQC++H V V++EY+
Sbjct  91   ISFITVAAVVLVLSRNENSPMPLRTWVAGYALQCIVHMVCVAVEYR  136



>ref|XP_010933860.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=377

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LRRA  R + MREPS  VR+ AAEQ++ERQ+DWAYS+PVV LD++WNLAFV +AA VLVL
Sbjct  43   LRRASGRRL-MREPSVQVRETAAEQLEERQTDWAYSRPVVFLDILWNLAFVSVAAGVLVL  101

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            SRDE+P +PLRLWIVGY LQCVLH + V +EY+
Sbjct  102  SRDERPSMPLRLWIVGYVLQCVLHVICVCIEYR  134



>ref|XP_010933858.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=378

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LRRA  R + MREPS  VR+ AAEQ++ERQ+DWAYS+PVV LD++WNLAFV +AA VLVL
Sbjct  43   LRRASGRRL-MREPSVQVRETAAEQLEERQTDWAYSRPVVFLDILWNLAFVSVAAGVLVL  101

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            SRDE+P +PLRLWIVGY LQCVLH + V +EY+
Sbjct  102  SRDERPSMPLRLWIVGYVLQCVLHVICVCIEYR  134



>tpg|DAA60523.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=209

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +3

Query  168  SPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            SP  +PA+  G +G  P  R  S+R     +RR GSR  +MREPS  VR+ AAE ++ERQ
Sbjct  24   SPPTSPAS--GPSGG-PLGRLTSLRGAARFIRRTGSR-RLMREPSVAVRETAAEHLEERQ  79

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            +DWAYSKPVV+LD++WNLAFV +AAAVL  S  E+P +PLR+WIVGY LQC+LH +SV++
Sbjct  80   TDWAYSKPVVVLDMLWNLAFVAVAAAVLAASVGERPTVPLRVWIVGYVLQCLLHVLSVTV  139

Query  528  EYQ  536
            EY+
Sbjct  140  EYR  142



>ref|XP_003550874.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=379

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LR+A  R + MREPS +VR+AAAEQ++ERQSDWAYSKPVV+LD++WN AFV  AA VLVL
Sbjct  50   LRQASGRRL-MREPSMVVREAAAEQLEERQSDWAYSKPVVVLDILWNCAFVAAAATVLVL  108

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            SR+E P +PLRLWIVGYALQ VLH   V +EY+
Sbjct  109  SRNENPNMPLRLWIVGYALQSVLHVACVCVEYR  141



>ref|NP_001031032.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 dbj|BAH20087.1| AT1G12760 [Arabidopsis thaliana]
 gb|AEE28925.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=337

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAEQ++ERQSDWAYSKPVV+LD+VWNLAFV +A A+LV+SR E P +PL
Sbjct  1    MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRKEHPIMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEY  533
            R+W++GYALQCVLH V V +EY
Sbjct  61   RVWLLGYALQCVLHMVCVCVEY  82



>emb|CBI38762.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS  VR+ AAEQ++ERQSDWAYSKP+VILD+VWNLAFV++A  VLV+SRDE P  PL
Sbjct  1    MREPSMRVRETAAEQLEERQSDWAYSKPIVILDIVWNLAFVVVAMTVLVMSRDETPSTPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            RLWI+GY LQCVLH V V +EY+
Sbjct  61   RLWIIGYGLQCVLHMVCVCVEYK  83



>ref|XP_009346865.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
Length=380

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 2/131 (2%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAA  323
            SP+  +SPL+  + ++    +R  +R+    +R     LRRA SR M++REPS  VR+AA
Sbjct  11   SPSDASSPLLGQSMSENLVRSRLLVRQPPRPLRGAARFLRRASSRRMMLREPSVRVREAA  70

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ++ERQSDWAYS+P+++LDL+WN   + IA  VL +S  E P +PLR WI GYA QC+
Sbjct  71   AEQLEERQSDWAYSRPIIVLDLLWNAGLLGIAVGVLSMSWKEAPSVPLRTWIGGYAFQCL  130

Query  504  LHAVSVSLEYQ  536
            +H V V +E +
Sbjct  131  VHMVCVGVECK  141



>ref|XP_004295567.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = +3

Query  165  NSPLMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +SPL++ + AD    +R  +R+    +R     LRRA  R M +REPS  VR++AAEQ++
Sbjct  48   SSPLLSTSIADNLLRSRRLIRQPPRPLRGAARFLRRASGRRMRLREPSVRVRESAAEQLE  107

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVS  518
            ERQSDWAYS+P+V+LDL+WN   ++IA AVL  S +E PE+PLR+WI GYALQC +H   
Sbjct  108  ERQSDWAYSRPIVVLDLLWNAVLLVIALAVLWFSYEESPEVPLRVWIGGYALQCAVHMFC  167

Query  519  VSLE  530
            V +E
Sbjct  168  VGVE  171



>ref|NP_001130198.1| uncharacterized LOC100191292 [Zea mays]
 gb|ACF78345.1| unknown [Zea mays]
 gb|ACF85407.1| unknown [Zea mays]
 gb|AFW59269.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=380

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 2/101 (2%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R    +LRR G R M  REPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WNLAF+ 
Sbjct  40   SLRGAAQLLRRGGRRAM--REPSVLVREAAAEHLEERQADWAYSRPVVALDLLWNLAFIT  97

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +AA VLVLSRDE   +PLR W+ GYALQCV+H V V++EY+
Sbjct  98   VAAVVLVLSRDEDSPMPLRTWVAGYALQCVIHMVCVAIEYR  138



>ref|XP_008803038.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=384

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R      +RA SR   MREPS LVR+AAAEQ++ERQSDWAYS+PVV LD++WNLA
Sbjct  38   RRPSLRGAARFFQRASSR-RTMREPSMLVREAAAEQLEERQSDWAYSRPVVFLDILWNLA  96

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV  A AVL+LS +E+P  PLRLWI GYALQCVLH V V +EY+
Sbjct  97   FVAAAVAVLILSWEERPSTPLRLWIGGYALQCVLHMVCVRIEYR  140



>ref|XP_008803037.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=385

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            RR S+R      +RA SR   MREPS LVR+AAAEQ++ERQSDWAYS+PVV LD++WNLA
Sbjct  38   RRPSLRGAARFFQRASSR-RTMREPSMLVREAAAEQLEERQSDWAYSRPVVFLDILWNLA  96

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV  A AVL+LS +E+P  PLRLWI GYALQCVLH V V +EY+
Sbjct  97   FVAAAVAVLILSWEERPSTPLRLWIGGYALQCVLHMVCVRIEYR  140



>ref|XP_011091747.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=329

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS  VR+AAAEQ++ERQSDWAYSKP+VILDLVWNLAFV+++ +VL++SR E P +PL
Sbjct  1    MREPSVRVREAAAEQIEERQSDWAYSKPIVILDLVWNLAFVIVSISVLIMSRHEDPSMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            RLWIVGY LQC+LH V V  EY+
Sbjct  61   RLWIVGYDLQCILHMVCVCAEYK  83



>ref|XP_004240042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=396

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  237  IRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvli  416
            +R     LRRA SR + MREPS  VR+AAAEQ++ERQSDWAYSKP+VI+DL+WNLAFV++
Sbjct  47   LRGAAGFLRRASSRRL-MREPSMRVREAAAEQIEERQSDWAYSKPIVIIDLLWNLAFVIV  105

Query  417  aaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            + +VLVLSR+E P +PLRLWIVGYA Q VLH V V +EY
Sbjct  106  SISVLVLSRNESPSMPLRLWIVGYASQSVLHMVCVFVEY  144



>ref|XP_003570086.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
Length=374

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 2/101 (2%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R    +LR+ G R M  REPS LVR+ AAEQ++ERQ+DWAYS+PVV LDL+WNLAF+L
Sbjct  35   SLRGTARLLRQGGRRAM--REPSLLVRETAAEQLEERQADWAYSRPVVALDLLWNLAFIL  92

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +AA VLVLS DE P +PLR+WI GYA+QCVLH V V++EY+
Sbjct  93   VAAVVLVLSSDESPSVPLRVWIAGYAVQCVLHMVCVAIEYR  133



>gb|KDP25486.1| hypothetical protein JCGZ_20642 [Jatropha curcas]
Length=389

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 105/145 (72%), Gaps = 11/145 (8%)
 Frame = +3

Query  126  SKIRLKMFSPTYTN------SPLMTPAA---ADGYAGTRPSLRRHSIRDVVWVLRRAGSR  278
            S I +++ +PT ++      +PL++  +   ++   G RP +RR ++RD    +RRA SR
Sbjct  6    STITIRVQTPTRSSDDIVDTTPLLSSGSNVESNSNNGRRP-VRRPTLRDAARFVRRASSR  64

Query  279  GMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPE  458
              +MREPS LVR+ AAEQ++ERQSDWAYSKPVVILD++WN AFV +A AVL+LSR+E P 
Sbjct  65   -RMMREPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAVAVLILSREEHPS  123

Query  459  LPLRLWIVGYALQCVLHAVSVSLEY  533
            +PLRLWI+GY  QCVLH V V +EY
Sbjct  124  MPLRLWIIGYGFQCVLHMVCVFVEY  148



>ref|XP_008651537.1| PREDICTED: protein binding protein isoform X2 [Zea mays]
 gb|ACF84516.1| unknown [Zea mays]
 tpg|DAA60521.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=356

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +3

Query  168  SPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            SP  +PA+  G +G  P  R  S+R     +RR GSR + MREPS  VR+ AAE ++ERQ
Sbjct  24   SPPTSPAS--GPSGG-PLGRLTSLRGAARFIRRTGSRRL-MREPSVAVRETAAEHLEERQ  79

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            +DWAYSKPVV+LD++WNLAFV +AAAVL  S  E+P +PLR+WIVGY LQC+LH +SV++
Sbjct  80   TDWAYSKPVVVLDMLWNLAFVAVAAAVLAASVGERPTVPLRVWIVGYVLQCLLHVLSVTV  139

Query  528  EYQ  536
            EY+
Sbjct  140  EYR  142



>ref|NP_001151256.1| protein binding protein [Zea mays]
 gb|ACG42147.1| protein binding protein [Zea mays]
Length=359

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +3

Query  168  SPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            SP  +PA+  G +G  P  R  S+R     +RR GSR + MREPS  VR+ AAE ++ERQ
Sbjct  24   SPPTSPAS--GPSGG-PLGRLTSLRGAARFIRRTGSRRL-MREPSVAVRETAAEHLEERQ  79

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            +DWAYSKPVV+LD++WNLAFV +AAAVL  S  E+P +PLR+WIVGY LQC+LH +SV++
Sbjct  80   TDWAYSKPVVVLDMLWNLAFVAVAAAVLAASVGERPTVPLRVWIVGYVLQCLLHVLSVTV  139

Query  528  EYQ  536
            EY+
Sbjct  140  EYR  142



>tpg|DAA60522.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=359

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +3

Query  168  SPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            SP  +PA+  G +G  P  R  S+R     +RR GSR + MREPS  VR+ AAE ++ERQ
Sbjct  24   SPPTSPAS--GPSGG-PLGRLTSLRGAARFIRRTGSRRL-MREPSVAVRETAAEHLEERQ  79

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            +DWAYSKPVV+LD++WNLAFV +AAAVL  S  E+P +PLR+WIVGY LQC+LH +SV++
Sbjct  80   TDWAYSKPVVVLDMLWNLAFVAVAAAVLAASVGERPTVPLRVWIVGYVLQCLLHVLSVTV  139

Query  528  EYQ  536
            EY+
Sbjct  140  EYR  142



>ref|XP_008651536.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 gb|ADX60132.1| WRKY transcription factor [Zea mays]
 tpg|DAA60520.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=357

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +3

Query  168  SPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            SP  +PA+  G +G  P  R  S+R     +RR GSR  +MREPS  VR+ AAE ++ERQ
Sbjct  24   SPPTSPAS--GPSGG-PLGRLTSLRGAARFIRRTGSR-RLMREPSVAVRETAAEHLEERQ  79

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            +DWAYSKPVV+LD++WNLAFV +AAAVL  S  E+P +PLR+WIVGY LQC+LH +SV++
Sbjct  80   TDWAYSKPVVVLDMLWNLAFVAVAAAVLAASVGERPTVPLRVWIVGYVLQCLLHVLSVTV  139

Query  528  EYQ  536
            EY+
Sbjct  140  EYR  142



>gb|ACN30552.1| unknown [Zea mays]
Length=166

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +3

Query  192  ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            A G  G  P  R  S+R     +RR GSR + MREPS  VR+ AAE ++ERQ+DWAYSKP
Sbjct  29   ASGSPGG-PLGRLTSLRGAARFIRRTGSRSL-MREPSVAVRETAAEHLEERQTDWAYSKP  86

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            VV++D++WN+AFV IAAAVL  S  E P +PLR+WI GY LQC+LH + V++EY+
Sbjct  87   VVVVDMLWNVAFVAIAAAVLAASLGESPAVPLRVWIAGYVLQCLLHILCVTVEYR  141



>dbj|BAJ98696.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 80/101 (79%), Gaps = 2/101 (2%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R    +LR+ G R   MREPS LVR+ AAEQ++ERQ+DWAYS+PVV LDL+WNLAF+L
Sbjct  35   SLRGTARLLRQGGRR--AMREPSLLVRETAAEQLEERQADWAYSRPVVALDLLWNLAFIL  92

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
              A VLVLS DE P +PLR+WI GYA+QCV+H V V++EY+
Sbjct  93   TTAVVLVLSGDESPSVPLRIWIAGYAVQCVVHMVCVAIEYR  133



>ref|XP_009615319.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Nicotiana tomentosiformis]
Length=357

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 8/105 (8%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSR-GMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNl  401
            RRHS+R+ + V +RA +R G++MREPS        +Q+++RQS+WAYSKPVVI+DL+WN 
Sbjct  27   RRHSLREAIRVFQRASNRSGLMMREPSD-------QQINDRQSNWAYSKPVVIIDLLWNF  79

Query  402  afvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            A++++A  VL  SR+E PE+PLR+WIVGY+L C+LH V V LEY+
Sbjct  80   AYIIVACFVLFFSREEDPEMPLRIWIVGYSLLCLLHIVCVFLEYR  124



>ref|XP_009615318.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Nicotiana tomentosiformis]
Length=360

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 8/105 (8%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSR-GMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNl  401
            RRHS+R+ + V +RA +R G++MREPS        +Q+++RQS+WAYSKPVVI+DL+WN 
Sbjct  27   RRHSLREAIRVFQRASNRSGLMMREPSD-------QQINDRQSNWAYSKPVVIIDLLWNF  79

Query  402  afvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            A++++A  VL  SR+E PE+PLR+WIVGY+L C+LH V V LEY+
Sbjct  80   AYIIVACFVLFFSREEDPEMPLRIWIVGYSLLCLLHIVCVFLEYR  124



>gb|EYU35067.1| hypothetical protein MIMGU_mgv1a008119mg [Erythranthe guttata]
Length=384

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = +3

Query  267  AGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRD  446
            AGSR +  REPS  VR+AA EQ++ERQSDWAYSKP+VILDLVWNLAF+++A +V+++S+ 
Sbjct  49   AGSRAL--REPSVRVREAATEQIEERQSDWAYSKPIVILDLVWNLAFIVVAISVMIMSKT  106

Query  447  EQPELPLRLWIVGYALQCVLHAVSVSLE  530
            E+P +PLRLWIVGYALQCVLH V V  E
Sbjct  107  ERPSMPLRLWIVGYALQCVLHVVCVCTE  134



>ref|XP_008799543.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=378

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +3

Query  153  PTYTNSPLMTPAAADGY-AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAE  329
            P       + PA   G   G R   RR S+R     LRRA SR  +MREPS LVR+ AAE
Sbjct  7    PNSAGDAAVDPAPLLGTRGGDRRLARRPSLRGAARFLRRASSR-RMMREPSMLVRETAAE  65

Query  330  QMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLH  509
            Q++ERQSDWAYS+PVV LD++WNLAFV +AA VLV+SRDE+P +PLRLWIVGYALQCVLH
Sbjct  66   QLEERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVMSRDEKPSMPLRLWIVGYALQCVLH  125

Query  510  AVSVSLEYQ  536
             + V +EY+
Sbjct  126  MMCVCIEYR  134



>ref|XP_008799545.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=377

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +3

Query  153  PTYTNSPLMTPAAADGY-AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAE  329
            P       + PA   G   G R   RR S+R     LRRA SR  +MREPS LVR+ AAE
Sbjct  7    PNSAGDAAVDPAPLLGTRGGDRRLARRPSLRGAARFLRRASSR-RMMREPSMLVRETAAE  65

Query  330  QMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLH  509
            Q++ERQSDWAYS+PVV LD++WNLAFV +AA VLV+SRDE+P +PLRLWIVGYALQCVLH
Sbjct  66   QLEERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVMSRDEKPSMPLRLWIVGYALQCVLH  125

Query  510  AVSVSLEYQ  536
             + V +EY+
Sbjct  126  MMCVCIEYR  134



>ref|XP_002962655.1| hypothetical protein SELMODRAFT_78385 [Selaginella moellendorffii]
 gb|EFJ36118.1| hypothetical protein SELMODRAFT_78385 [Selaginella moellendorffii]
Length=366

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  192  ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            AD      P  RR ++      LR+A  R   MREPS LVRQ AAEQ++ERQSDWAYS+P
Sbjct  19   ADSSRSLAPGHRR-AVHGAARYLRQATGR-RPMREPSMLVRQTAAEQLEERQSDWAYSRP  76

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            VV+LDL+WNLAFV++A AVLV S++E+PE PLR+WIVGYA+QC++H V V  EY
Sbjct  77   VVVLDLMWNLAFVVVAVAVLVNSKEERPETPLRVWIVGYAVQCLVHMVCVCSEY  130



>ref|XP_010919263.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYS+PVV LD++WNLAFV +AA VLVLSRDE+P +PLRL
Sbjct  54   EPSMLVRETAAEQLEERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVLSRDEKPSMPLRL  113

Query  474  WIVGYALQCVLHAVSVSLEYQ  536
            WIVGYALQCVLH + V +EY+
Sbjct  114  WIVGYALQCVLHMICVCIEYR  134



>ref|XP_002980437.1| hypothetical protein SELMODRAFT_112292 [Selaginella moellendorffii]
 gb|EFJ18697.1| hypothetical protein SELMODRAFT_112292 [Selaginella moellendorffii]
Length=366

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  192  ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            AD      P  RR ++      LR+A  R   MREPS LVRQ AAEQ++ERQSDWAYS+P
Sbjct  19   ADSSRSLAPGHRR-AVHGAARYLRQATGR-RPMREPSMLVRQTAAEQLEERQSDWAYSRP  76

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            VV+LDL+WNLAFV++A AVLV S++E+PE PLR+WIVGYA+QC++H V V  EY
Sbjct  77   VVVLDLMWNLAFVVVAVAVLVNSKEERPETPLRVWIVGYAVQCLVHMVCVCSEY  130



>ref|XP_010919264.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Elaeis 
guineensis]
Length=378

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYS+PVV LD++WNLAFV +AA VLVLSRDE+P +PLRL
Sbjct  54   EPSMLVRETAAEQLEERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVLSRDEKPSMPLRL  113

Query  474  WIVGYALQCVLHAVSVSLEYQ  536
            WIVGYALQCVLH + V +EY+
Sbjct  114  WIVGYALQCVLHMICVCIEYR  134



>ref|XP_009116780.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Brassica rapa]
Length=373

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (70%), Gaps = 5/129 (4%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAE  329
            SP    SPL+T    +    ++P LR  + R    +LRRA +R M++REPS  VR+ AAE
Sbjct  12   SPAMDASPLLTRNRRNTPRPSQP-LRGAASR----LLRRASNRRMMLREPSVRVREVAAE  66

Query  330  QMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLH  509
            Q++ERQS WAYSKP++ LD++WN AFV+++ A+L  S +E PE+PLRLWIVGY+LQC+ H
Sbjct  67   QLEERQSQWAYSKPIIALDILWNFAFVVVSIAILGFSPEEHPEVPLRLWIVGYSLQCLFH  126

Query  510  AVSVSLEYQ  536
               V  EY+
Sbjct  127  VGCVIAEYR  135



>emb|CDY52328.1| BnaA09g38770D [Brassica napus]
Length=373

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (70%), Gaps = 5/129 (4%)
 Frame = +3

Query  150  SPTYTNSPLMTPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAE  329
            SP    SPL+T    +    ++P LR  + R    +LRRA +R M++REPS  VR+ AAE
Sbjct  12   SPAMDASPLLTRNRRNTPRPSQP-LRGAASR----LLRRASNRRMMLREPSVRVREVAAE  66

Query  330  QMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLH  509
            Q++ERQS WAYSKP++ LD++WN AFV+++ A+L  S +E PE+PLRLWIVGY+LQC+ H
Sbjct  67   QLEERQSQWAYSKPIIALDILWNFAFVVVSIAILGFSPEEHPEVPLRLWIVGYSLQCLFH  126

Query  510  AVSVSLEYQ  536
               V  EY+
Sbjct  127  VGCVIAEYR  135



>ref|NP_001182980.1| uncharacterized protein LOC100501295 [Zea mays]
 gb|ACR35326.1| unknown [Zea mays]
Length=167

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +3

Query  168  SPLMTP--AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            +PL++   + A G +G  P  R  S+R     +RR GSR  +MREPS  VR+ AAE ++E
Sbjct  19   TPLISSPTSPASGSSGG-PLGRLTSLRGAARFIRRTGSR-RLMREPSVAVRETAAEHLEE  76

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQ+DWAYSKPV+++D++WN+AFV IAAAV+  S  E P +PLR+WI GY LQC+LH + V
Sbjct  77   RQTDWAYSKPVIVVDMLWNVAFVAIAAAVVAASLGEIPAVPLRVWIAGYVLQCLLHILCV  136

Query  522  SLEYQ  536
            ++EY+
Sbjct  137  TVEYR  141



>ref|XP_008225188.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Prunus 
mume]
Length=380

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LRRA SR M++REPS  VR+AAAEQ++ERQSDWAYS+P+++LDL+WN   + IA  VL L
Sbjct  48   LRRATSRRMMLREPSVRVREAAAEQLEERQSDWAYSRPIIVLDLLWNAGLLGIAIGVLWL  107

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLE  530
            SR+E P +PLR WIVGYA QC++H   V +E
Sbjct  108  SREESPLVPLRTWIVGYAFQCLVHMACVGVE  138



>gb|KJB52053.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=236

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +3

Query  168  SPLM--TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            +PL+  T  A+   +  R S+RR S+R+    LRRA SR  +MREPS LVR+ AAEQ++E
Sbjct  19   TPLLSSTSNASRDESNPRRSVRRQSLREAARFLRRASSR-RMMREPSVLVRETAAEQLEE  77

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYSKPVV+LD++WN AFV+++  VL+ S +E+P+ PLRLWI+GYA QC+LH V V
Sbjct  78   RQSDWAYSKPVVVLDIIWNFAFVVVSVGVLLSSWEERPDTPLRLWIIGYAFQCLLHMVCV  137

Query  522  SLEYQ  536
             +EY+
Sbjct  138  CVEYR  142



>ref|XP_010255487.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
Length=445

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            AG RPSLR  +         R  S   +MREPS LVR+ AAEQ++ERQSDWAYS+PVVIL
Sbjct  36   AGRRPSLRGAA------RFLRRASSRRMMREPSMLVRETAAEQLEERQSDWAYSRPVVIL  89

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN+AFV++A +VL+LSR+E P +PLRLWIVGYA+QC+LH V V +EY+
Sbjct  90   DIIWNMAFVIVAVSVLILSRNESPSMPLRLWIVGYAVQCILHMVCVCVEYR  140



>ref|XP_009369023.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Pyrus x bretschneideri]
Length=386

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  165  NSPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQM  335
             +PL++ +     +  +G +   RR S+R    VLR+A SR  +MREPS LVR+ AAEQ+
Sbjct  14   TTPLISNSGGSSDESNSGRQQFARRQSLRQAARVLRQASSR-RLMREPSMLVRETAAEQL  72

Query  336  DERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            +ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  73   EERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>ref|XP_010255490.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            AG RPSLR  +         R  S   +MREPS LVR+ AAEQ++ERQSDWAYS+PVVIL
Sbjct  36   AGRRPSLRGAA------RFLRRASSRRMMREPSMLVRETAAEQLEERQSDWAYSRPVVIL  89

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN+AFV++A +VL+LSR+E P +PLRLWIVGYA+QC+LH V V +EY+
Sbjct  90   DIIWNMAFVIVAVSVLILSRNESPSMPLRLWIVGYAVQCILHMVCVCVEYR  140



>ref|XP_010255491.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Nelumbo nucifera]
Length=381

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            AG RPSLR  +         R  S   +MREPS LVR+ AAEQ++ERQSDWAYS+PVVIL
Sbjct  36   AGRRPSLRGAA------RFLRRASSRRMMREPSMLVRETAAEQLEERQSDWAYSRPVVIL  89

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN+AFV++A +VL+LSR+E P +PLRLWIVGYA+QC+LH V V +EY+
Sbjct  90   DIIWNMAFVIVAVSVLILSRNESPSMPLRLWIVGYAVQCILHMVCVCVEYR  140



>ref|XP_009369025.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Pyrus x bretschneideri]
Length=385

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  165  NSPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQM  335
             +PL++ +     +  +G +   RR S+R    VLR+A SR  +MREPS LVR+ AAEQ+
Sbjct  14   TTPLISNSGGSSDESNSGRQQFARRQSLRQAARVLRQASSR-RLMREPSMLVRETAAEQL  72

Query  336  DERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            +ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  73   EERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>ref|XP_009369026.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Pyrus x bretschneideri]
Length=384

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  165  NSPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQM  335
             +PL++ +     +  +G +   RR S+R    VLR+A SR  +MREPS LVR+ AAEQ+
Sbjct  14   TTPLISNSGGSSDESNSGRQQFARRQSLRQAARVLRQASSR-RLMREPSMLVRETAAEQL  72

Query  336  DERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            +ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  73   EERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>ref|XP_010255488.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Nelumbo nucifera]
Length=444

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVIL  383
            AG RPSLR  +         R  S   +MREPS LVR+ AAEQ++ERQSDWAYS+PVVIL
Sbjct  36   AGRRPSLRGAA------RFLRRASSRRMMREPSMLVRETAAEQLEERQSDWAYSRPVVIL  89

Query  384  DLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            D++WN+AFV++A +VL+LSR+E P +PLRLWIVGYA+QC+LH V V +EY+
Sbjct  90   DIIWNMAFVIVAVSVLILSRNESPSMPLRLWIVGYAVQCILHMVCVCVEYR  140



>emb|CDY21061.1| BnaA08g24640D [Brassica napus]
Length=324

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MRE S +VR+AAAEQ++ERQSDWAYS+P+V+LD+VWNLAFV +A AVLV+SR+E P +PL
Sbjct  1    MREQSVIVREAAAEQLEERQSDWAYSRPIVVLDIVWNLAFVSVAGAVLVMSRNEHPIMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            R+W++GYALQCVLH V V +EY+
Sbjct  61   RVWLLGYALQCVLHMVCVCVEYK  83



>ref|XP_009369024.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Pyrus x bretschneideri]
Length=385

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  165  NSPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQM  335
             +PL++ +     +  +G +   RR S+R    VLR+A SR  +MREPS LVR+ AAEQ+
Sbjct  14   TTPLISNSGGSSDESNSGRQQFARRQSLRQAARVLRQASSR-RLMREPSMLVRETAAEQL  72

Query  336  DERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            +ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  73   EERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>ref|XP_007211433.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
 gb|EMJ12632.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
Length=380

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LRRA SR M++REPS  VR+AAAEQ++ERQ+DWAYS+P+++LDL+WN   + IA  VL L
Sbjct  48   LRRASSRRMMLREPSVRVREAAAEQLEERQTDWAYSRPIIVLDLLWNAGLLGIAIGVLWL  107

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLE  530
            SR+E P +PLR WIVGYA QC++H   V +E
Sbjct  108  SREESPLVPLRTWIVGYAFQCLVHMACVGVE  138



>ref|XP_006857849.1| hypothetical protein AMTR_s00069p00064990 [Amborella trichopoda]
 gb|ERN19316.1| hypothetical protein AMTR_s00069p00064990 [Amborella trichopoda]
Length=383

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYS+PVV+LD++WNLAFV++A AVL+LSRDE P +PLRL
Sbjct  56   EPSMLVRETAAEQLEERQSDWAYSRPVVVLDIIWNLAFVVVAMAVLLLSRDENPSMPLRL  115

Query  474  WIVGYALQCVLHAVSVSLEYQ  536
            WIVGYA QC+LH + V +EY+
Sbjct  116  WIVGYAFQCLLHIICVCVEYR  136



>ref|XP_010661149.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Vitis vinifera]
Length=384

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WN AFV++AAAVLVLSR E P +PLR 
Sbjct  61   EPSMLVRETAAEQLEERQSDWAYSKPVVVLDMIWNFAFVVVAAAVLVLSRRESPSMPLRF  120

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WIVGYALQC+LH V VS+EY
Sbjct  121  WIVGYALQCILHIVCVSVEY  140



>ref|XP_003631422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Vitis vinifera]
Length=383

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WN AFV++AAAVLVLSR E P +PLR 
Sbjct  61   EPSMLVRETAAEQLEERQSDWAYSKPVVVLDMIWNFAFVVVAAAVLVLSRRESPSMPLRF  120

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WIVGYALQC+LH V VS+EY
Sbjct  121  WIVGYALQCILHIVCVSVEY  140



>ref|XP_009626445.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
tomentosiformis]
Length=383

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS  VR+AAAEQ++ERQSDWAYSKP+VILDL+WNLAFV+++ +VL+LS DE P +PLRL
Sbjct  56   EPSRRVREAAAEQIEERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSLDESPSMPLRL  115

Query  474  WIVGYALQCVLHAVSVSLEYQ  536
            WIVGYALQC+LH V V +EY+
Sbjct  116  WIVGYALQCLLHMVCVCVEYR  136



>gb|KJB52054.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=297

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +3

Query  168  SPLM--TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            +PL+  T  A+   +  R S+RR S+R+    LRRA SR  +MREPS LVR+ AAEQ++E
Sbjct  19   TPLLSSTSNASRDESNPRRSVRRQSLREAARFLRRASSR-RMMREPSVLVRETAAEQLEE  77

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYSKPVV+LD++WN AFV+++  VL+ S +E+P+ PLRLWI+GYA QC+LH V V
Sbjct  78   RQSDWAYSKPVVVLDIIWNFAFVVVSVGVLLSSWEERPDTPLRLWIIGYAFQCLLHMVCV  137

Query  522  SLEYQ  536
             +EY+
Sbjct  138  CVEYR  142



>ref|NP_567110.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAL24312.1| putative protein [Arabidopsis thaliana]
 gb|AAL47351.1| putative protein [Arabidopsis thaliana]
 gb|AEE80168.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=379

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA +R M++REPS  VR+ AAEQ++ERQS WAYSKP+++LD++WN  FV+++ A+L 
Sbjct  45   LLRRASNRRMMLREPSVRVREVAAEQLEERQSQWAYSKPIIVLDILWNFLFVIVSIAILG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S DE P++PLRLWI+GY +QC+ H   V  EY+
Sbjct  105  FSSDEDPDVPLRLWIIGYNVQCLFHVGCVIAEYK  138



>emb|CAB71048.1| putative protein [Arabidopsis thaliana]
Length=362

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA +R M++REPS  VR+ AAEQ++ERQS WAYSKP+++LD++WN  FV+++ A+L 
Sbjct  28   LLRRASNRRMMLREPSVRVREVAAEQLEERQSQWAYSKPIIVLDILWNFLFVIVSIAILG  87

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S DE P++PLRLWI+GY +QC+ H   V  EY+
Sbjct  88   FSSDEDPDVPLRLWIIGYNVQCLFHVGCVIAEYK  121



>gb|KDO86039.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=270

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  R +++REPS  VR+ AAEQ++ERQS WAYS+P+++LD++WNL FV++A AVL 
Sbjct  45   LLRRASGRRLMLREPSVRVRETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +S +E+PE+PLRL IVGYALQC+ H   VSLE++
Sbjct  105  VSINEKPEVPLRLRIVGYALQCLFHVFCVSLEFK  138



>ref|XP_008238809.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Prunus 
mume]
Length=383

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +3

Query  168  SPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL++ +     +  +G    +RR S+RD    LR+A SR + MREPS LVR+ AAEQ++
Sbjct  15   TPLLSNSGGSSDESNSGRHRIVRRQSLRDAARFLRQASSRRL-MREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P +PLRLWI+GYALQ
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPNMPLRLWIMGYALQ  126



>ref|XP_008238810.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Prunus 
mume]
Length=382

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +3

Query  168  SPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL++ +     +  +G    +RR S+RD    LR+A SR + MREPS LVR+ AAEQ++
Sbjct  15   TPLLSNSGGSSDESNSGRHRIVRRQSLRDAARFLRQASSRRL-MREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P +PLRLWI+GYALQ
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPNMPLRLWIMGYALQ  126



>gb|KDO86037.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=294

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  R +++REPS  VR+ AAEQ++ERQS WAYS+P+++LD++WNL FV++A AVL 
Sbjct  45   LLRRASGRRLMLREPSVRVRETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +S +E+PE+PLRL IVGYALQC+ H   VSLE++
Sbjct  105  VSINEKPEVPLRLRIVGYALQCLFHVFCVSLEFK  138



>ref|XP_008345901.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=380

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +3

Query  174  LMTPAAADGYAGTRPSLRR--HSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQ  347
            L+  + AD    +R  +R+    +R     LRRA SR M++REPS  VR+AAAEQ++ERQ
Sbjct  19   LLGQSMADNLVRSRLLMRQPPRPLRGAARFLRRASSRRMMLREPSVRVREAAAEQLEERQ  78

Query  348  SDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSL  527
            SDWAYS+P+++LDL+WN   + IA  VL +S  E P +PLR WI GYA QC++H V V +
Sbjct  79   SDWAYSRPIIVLDLLWNAGLLGIAVGVLSMSWKEAPSVPLRTWIGGYAFQCLVHMVCVGV  138

Query  528  EYQ  536
            E +
Sbjct  139  ECK  141



>ref|XP_008670056.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Zea mays]
Length=354

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = +3

Query  168  SPLMTP--AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            +PL++   + A G  G  P  R  S+R     +RR GSR + MREPS  VR+ AAE ++E
Sbjct  19   TPLISSPTSPASGSPGG-PLGRLTSLRGAARFIRRTGSRSL-MREPSVAVRETAAEHLEE  76

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQ+DWAYSKPVV++D++WN+AFV IAAAVL  S  E P +PLR+WI GY LQC+LH + V
Sbjct  77   RQTDWAYSKPVVVVDMLWNVAFVAIAAAVLAASLGESPAVPLRVWIAGYVLQCLLHILCV  136

Query  522  SLEYQ  536
            ++EY+
Sbjct  137  TVEYR  141



>ref|XP_002876598.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52857.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA +R M++REPS  VR+ AAEQ++ERQS WAYSKP+++LD++WN  FV+++ A+L 
Sbjct  45   LLRRASNRRMMLREPSVRVREVAAEQLEERQSQWAYSKPIIVLDILWNFVFVIVSIAILG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S +E P++PLRLWI+GY  QC+LH   V  EY+
Sbjct  105  FSSEEDPDVPLRLWIIGYNFQCLLHVGCVIAEYK  138



>ref|XP_001754436.1| predicted protein [Physcomitrella patens]
 gb|EDQ80886.1| predicted protein, partial [Physcomitrella patens]
Length=338

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +3

Query  258  LRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvl  437
            LRRAGSR + MREPS LVR++AAEQ++ RQSDWAYSKPVV+LDL+WNLAFV ++ AVLVL
Sbjct  11   LRRAGSRRL-MREPSMLVRESAAEQLEVRQSDWAYSKPVVVLDLIWNLAFVQVSLAVLVL  69

Query  438  SRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            S+ E     LR+WI+GYALQCV+H + V  EY
Sbjct  70   SKKETNCNELRIWIIGYALQCVVHMLCVCCEY  101



>emb|CDX71761.1| BnaC08g31130D [Brassica napus]
Length=370

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (66%), Gaps = 7/131 (5%)
 Frame = +3

Query  165  NSPLMTPAAADGYAGTRPSLRRHSIR-------DVVWVLRRAGSRGMVMREPSALVRQAA  323
            N P+  PA++       P L R+  R           +LRRA +R M++REPS  VR+ A
Sbjct  2    NPPIPIPASSSPAMDASPLLTRNIPRPSQPLRGAASRLLRRASNRRMMLREPSVRVREVA  61

Query  324  AEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCV  503
            AEQ++ERQS WAYSKP++ LD++WN AFV+++ A+L  S +E PE+PLRLWI GY+LQC+
Sbjct  62   AEQLEERQSQWAYSKPIIALDILWNFAFVIVSIAILGFSPEEHPEVPLRLWIAGYSLQCL  121

Query  504  LHAVSVSLEYQ  536
             H   V  EY+
Sbjct  122  FHVGCVIAEYR  132



>gb|ADK63418.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=363

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 87/135 (64%), Gaps = 11/135 (8%)
 Frame = +3

Query  153  PTYTNSPLMTPAAADGYA-----GTRPS--LRRHSIRDVVWVLRRAGSRGMVMREPSALV  311
            P  T+S   +PA  D  +       RPS  LR  + R    +LRRA SRGM++RE S  V
Sbjct  5    PILTSSSSSSPATDDASSPLLNRNRRPSQPLRGAASR----LLRRASSRGMMLRESSVRV  60

Query  312  RQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            R+ AAEQ++ERQS+WAYSKPV++LD++WNLAFV +   V   S +E P  PLR WIVGY 
Sbjct  61   RETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSWFSSEEDPRAPLRFWIVGYN  120

Query  492  LQCVLHAVSVSLEYQ  536
            LQC++H   V  EY+
Sbjct  121  LQCLIHIACVIAEYR  135



>gb|KCW77596.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=328

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  285  VMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELP  464
            +MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WN AFV +A  VL++SR E P +P
Sbjct  1    MMREPSMLVRETAAEQLEERQSDWAYSKPVVVLDVLWNFAFVAVAVGVLIVSRGENPTMP  60

Query  465  LRLWIVGYALQCVLHAVSVSLEY  533
            LR+WIVGY LQCVLH   V  EY
Sbjct  61   LRVWIVGYGLQCVLHVACVVDEY  83



>gb|KCW77597.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=329

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  285  VMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELP  464
            +MREPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WN AFV +A  VL++SR E P +P
Sbjct  1    MMREPSMLVRETAAEQLEERQSDWAYSKPVVVLDVLWNFAFVAVAVGVLIVSRGENPTMP  60

Query  465  LRLWIVGYALQCVLHAVSVSLEY  533
            LR+WIVGY LQCVLH   V  EY
Sbjct  61   LRVWIVGYGLQCVLHVACVVDEY  83



>ref|XP_011033785.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Populus euphratica]
Length=394

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVVILD++WN AFV +AA VLVLSR E P +PLRL
Sbjct  71   EPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRL  130

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WI+GY LQCVLH V V +EY
Sbjct  131  WILGYGLQCVLHMVCVCVEY  150



>emb|CDX74763.1| BnaA05g05090D [Brassica napus]
Length=363

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA SRGM++RE S  VR+ AAEQ++ERQS+WAYSKPV++LD++WNLAFV +   V  
Sbjct  42   LLRRASSRGMMLRESSVRVRETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSW  101

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S +E P  PLR WIVGY LQC++H   V  EY+
Sbjct  102  FSSEEDPRAPLRFWIVGYNLQCLIHIACVIAEYR  135



>ref|XP_002303571.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
 gb|EEE78550.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
Length=397

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVVILD++WN AFV +AA VLVLSR E P +PLRL
Sbjct  72   EPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRL  131

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WI+GY LQCVLH V V +EY
Sbjct  132  WILGYGLQCVLHMVCVCVEY  151



>gb|KDO86038.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=325

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  R +++REPS  VR+ AAEQ++ERQS WAYS+P+++LD++WNL FV++A AVL 
Sbjct  45   LLRRASGRRLMLREPSVRVRETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +S +E+PE+PLRL IVGYALQC+ H   VSLE++
Sbjct  105  VSINEKPEVPLRLRIVGYALQCLFHVFCVSLEFK  138



>ref|XP_011033783.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Populus euphratica]
Length=395

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVVILD++WN AFV +AA VLVLSR E P +PLRL
Sbjct  71   EPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRL  130

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WI+GY LQCVLH V V +EY
Sbjct  131  WILGYGLQCVLHMVCVCVEY  150



>gb|KJB52052.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=381

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +3

Query  168  SPLM--TPAAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            +PL+  T  A+   +  R S+RR S+R+    LRRA SR  +MREPS LVR+ AAEQ++E
Sbjct  19   TPLLSSTSNASRDESNPRRSVRRQSLREAARFLRRASSR-RMMREPSVLVRETAAEQLEE  77

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSV  521
            RQSDWAYSKPVV+LD++WN AFV+++  VL+ S +E+P+ PLRLWI+GYA QC+LH V V
Sbjct  78   RQSDWAYSKPVVVLDIIWNFAFVVVSVGVLLSSWEERPDTPLRLWIIGYAFQCLLHMVCV  137

Query  522  SLEYQ  536
             +EY+
Sbjct  138  CVEYR  142



>ref|XP_011033784.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Populus euphratica]
Length=395

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVVILD++WN AFV +AA VLVLSR E P +PLRL
Sbjct  71   EPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRL  130

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WI+GY LQCVLH V V +EY
Sbjct  131  WILGYGLQCVLHMVCVCVEY  150



>ref|XP_009143169.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=364

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA SRGM++RE S  VR+ AAEQ++ERQS+WAYSKPV++LD++WNLAFV +   V  
Sbjct  43   LLRRASSRGMMLRESSVRVRETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSW  102

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S +E P  PLR WIVGY LQC++H   V  EY+
Sbjct  103  FSSEEDPRAPLRFWIVGYNLQCLIHIACVIAEYR  136



>ref|XP_002459812.1| hypothetical protein SORBIDRAFT_02g011130 [Sorghum bicolor]
 gb|EER96333.1| hypothetical protein SORBIDRAFT_02g011130 [Sorghum bicolor]
Length=357

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            R  S+R     +RR GSR + MREPS  VR+ AAE ++ERQ+DWAYSKPVV+LD++WNLA
Sbjct  40   RLTSLRGAARFIRRTGSRRL-MREPSVAVRETAAEHLEERQTDWAYSKPVVVLDMLWNLA  98

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV +AAAVL  S  E P +PLR+WI GY LQC+LH + V++EY+
Sbjct  99   FVAVAAAVLAASTGESPAVPLRVWIAGYVLQCLLHILCVTVEYR  142



>ref|XP_009345443.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Pyrus 
x bretschneideri]
Length=386

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  168  SPLMTPA---AADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL+T +   + D  +G +  +RR S++     LR+A SR  +MREPS LVR+ AAEQ++
Sbjct  15   TPLLTNSGWSSDDSNSGRQRLVRRQSLQQAARFLRQASSR-RLMREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            ERQSDWAYSKPVV+LD++WN AFV++A  VLVLSRDE P +PLRLWIVGYA
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVALTVLVLSRDELPNVPLRLWIVGYA  124



>ref|XP_009345445.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Pyrus 
x bretschneideri]
Length=385

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = +3

Query  168  SPLMTPAA---ADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL+T +     D  +G +  +RR S++     LR+A SR  +MREPS LVR+ AAEQ++
Sbjct  15   TPLLTNSGWSSDDSNSGRQRLVRRQSLQQAARFLRQASSR-RLMREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            ERQSDWAYSKPVV+LD++WN AFV++A  VLVLSRDE P +PLRLWIVGYA
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVALTVLVLSRDELPNVPLRLWIVGYA  124



>ref|XP_009345444.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Pyrus 
x bretschneideri]
Length=385

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  168  SPLMTPA---AADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL+T +   + D  +G +  +RR S++     LR+A SR  +MREPS LVR+ AAEQ++
Sbjct  15   TPLLTNSGWSSDDSNSGRQRLVRRQSLQQAARFLRQASSR-RLMREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            ERQSDWAYSKPVV+LD++WN AFV++A  VLVLSRDE P +PLRLWIVGYA
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVALTVLVLSRDELPNVPLRLWIVGYA  124



>ref|XP_009345446.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Pyrus 
x bretschneideri]
Length=384

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  168  SPLMTPA---AADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL+T +   + D  +G +  +RR S++     LR+A SR  +MREPS LVR+ AAEQ++
Sbjct  15   TPLLTNSGWSSDDSNSGRQRLVRRQSLQQAARFLRQASSR-RLMREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYA  491
            ERQSDWAYSKPVV+LD++WN AFV++A  VLVLSRDE P +PLRLWIVGYA
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVALTVLVLSRDELPNVPLRLWIVGYA  124



>ref|XP_006445135.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
 gb|ESR58375.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
Length=372

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  R +++REPS  VR+ AAEQ++ERQS WAYS+P+++LD++WNL FV++A AVL 
Sbjct  45   LLRRASGRRLMLREPSVRVRETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +S +E+PE+PLRL IVGYALQC+ H   VSLE++
Sbjct  105  VSINEKPEVPLRLRIVGYALQCLFHVFCVSLEFK  138



>ref|XP_008392388.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Malus domestica]
Length=386

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +3

Query  171  PLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            PL++ +     +  +G +   RR S+R     LR+A SR  +MREPS LVR+ AAEQ++E
Sbjct  16   PLISNSGGSSDESNSGRQQLARRQSLRQAARFLRQASSR-RLMREPSMLVRETAAEQLEE  74

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            RQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  75   RQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>ref|XP_009142362.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brassica 
rapa]
 ref|XP_009142363.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brassica 
rapa]
Length=367

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  RGM++RE S  VR+ AAEQ++ERQS+WAYSKPV++LD+VWNLAFV +   VL 
Sbjct  40   LLRRASGRGMMLRESSVRVRETAAEQIEERQSEWAYSKPVIVLDVVWNLAFVFVTVGVLW  99

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S +E P +PLR WIV Y LQC+LH V V  EY+
Sbjct  100  FSSEENPRVPLRFWIVVYNLQCLLHVVCVISEYR  133



>ref|XP_008392390.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Malus domestica]
Length=385

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +3

Query  171  PLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            PL++ +     +  +G +   RR S+R     LR+A SR  +MREPS LVR+ AAEQ++E
Sbjct  16   PLISNSGGSSDESNSGRQQLARRQSLRQAARFLRQASSR-RLMREPSMLVRETAAEQLEE  74

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            RQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  75   RQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>gb|KDO86036.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=372

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  R +++REPS  VR+ AAEQ++ERQS WAYS+P+++LD++WNL FV++A AVL 
Sbjct  45   LLRRASGRRLMLREPSVRVRETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLG  104

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            +S +E+PE+PLRL IVGYALQC+ H   VSLE++
Sbjct  105  VSINEKPEVPLRLRIVGYALQCLFHVFCVSLEFK  138



>ref|XP_008392389.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Malus domestica]
Length=385

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +3

Query  171  PLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            PL++ +     +  +G +   RR S+R     LR+A SR  +MREPS LVR+ AAEQ++E
Sbjct  16   PLISNSGGSSDESNSGRQQLARRQSLRQAARFLRQASSR-RLMREPSMLVRETAAEQLEE  74

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            RQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  75   RQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>ref|XP_003563155.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Brachypodium 
distachyon]
Length=359

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (72%), Gaps = 7/117 (6%)
 Frame = +3

Query  186  AAADGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYS  365
             AA+G  G  PSLR          LRR GSR M MREPS  VR+ AAE ++ERQ+DWAYS
Sbjct  29   GAANG-GGRLPSLR-----GAARFLRRTGSRRM-MREPSVAVRETAAEHLEERQTDWAYS  81

Query  366  KPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            KPVV+LD++WNLAFV +AAAVL  S  E+P +PLR W+ GY LQC+LH + V++EY+
Sbjct  82   KPVVVLDVLWNLAFVAVAAAVLAASLTERPAVPLRFWLAGYVLQCLLHVLCVAVEYK  138



>ref|XP_008392391.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Malus domestica]
Length=384

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +3

Query  171  PLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDE  341
            PL++ +     +  +G +   RR S+R     LR+A SR  +MREPS LVR+ AAEQ++E
Sbjct  16   PLISNSGGSSDESNSGRQQLARRQSLRQAARFLRQASSR-RLMREPSMLVRETAAEQLEE  74

Query  342  RQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            RQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P++PLRLWIVGYALQ
Sbjct  75   RQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPDMPLRLWIVGYALQ  126



>emb|CDY37062.1| BnaA04g26400D [Brassica napus]
Length=367

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA SRGM++RE S  VR+ AAEQ++ERQS+WAYSKPV++LD+VWNLAFVL+   VL 
Sbjct  40   LLRRASSRGMMLRESSVRVRETAAEQIEERQSEWAYSKPVIVLDVVWNLAFVLVTVGVLW  99

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S +E P +PLR WI  Y LQC+LH V V  EY+
Sbjct  100  FSSEENPRVPLRFWIAVYNLQCLLHVVCVISEYR  133



>emb|CDY49194.1| BnaA09g10840D [Brassica napus]
Length=344

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 4/115 (3%)
 Frame = +3

Query  204  AGTRPSLRRHSIRDVVWVLRRA--GSRGM--VMREPSALVRQAAAEQMDERQSDWAYSKP  371
             G R S+RR  +R+   +LR A  G R M  +MREPS LVR++AAEQ++ERQSDWAYSKP
Sbjct  18   GGGRSSVRRQGLREAARLLRHASSGRRRMTTMMREPSMLVRESAAEQLEERQSDWAYSKP  77

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            VV+LD VWNLAF+ +AAAVL LS DE+P  PLR+W VGY LQCV+H V V +EY+
Sbjct  78   VVVLDFVWNLAFIAVAAAVLGLSSDEKPNTPLRVWTVGYGLQCVVHMVCVCVEYR  132



>ref|XP_009112973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Brassica 
rapa]
Length=344

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  207  GTRPSLRRHSIRDVVWVLRRA--GSRGM--VMREPSALVRQAAAEQMDERQSDWAYSKPV  374
            G R S+RR  +R+   +LR A  G R M  +MREPS LVR++AAEQ++ERQSDWAYSKPV
Sbjct  19   GGRSSVRRQGLREAARLLRHASSGRRRMTTMMREPSMLVRESAAEQLEERQSDWAYSKPV  78

Query  375  VILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            V+LD VWNLAF+ +AAAVL LS DE+P  PLR+W VGY LQCV+H V V +EY+
Sbjct  79   VVLDFVWNLAFIAVAAAVLGLSSDEKPNTPLRVWTVGYGLQCVVHMVCVCVEYR  132



>ref|XP_009112972.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Brassica 
rapa]
Length=348

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  207  GTRPSLRRHSIRDVVWVLRRA--GSRGM--VMREPSALVRQAAAEQMDERQSDWAYSKPV  374
            G R S+RR  +R+   +LR A  G R M  +MREPS LVR++AAEQ++ERQSDWAYSKPV
Sbjct  19   GGRSSVRRQGLREAARLLRHASSGRRRMTTMMREPSMLVRESAAEQLEERQSDWAYSKPV  78

Query  375  VILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            V+LD VWNLAF+ +AAAVL LS DE+P  PLR+W VGY LQCV+H V V +EY+
Sbjct  79   VVLDFVWNLAFIAVAAAVLGLSSDEKPNTPLRVWTVGYGLQCVVHMVCVCVEYR  132



>emb|CDY47347.1| BnaCnng14840D [Brassica napus]
Length=344

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  207  GTRPSLRRHSIRDVVWVLRRA--GSRGM--VMREPSALVRQAAAEQMDERQSDWAYSKPV  374
            G R S+RR  +R+   +LR A  G R M  +MREPS LVR++AAEQ++ERQSDWAYSKPV
Sbjct  19   GGRSSVRRQGLREAARLLRHASSGRRRMTTMMREPSMLVRESAAEQLEERQSDWAYSKPV  78

Query  375  VILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            V+LD VWNLAF+ +AAAVL LS DE+P  PLR+W VGY LQCV+H V V +EY+
Sbjct  79   VVLDFVWNLAFIAVAAAVLGLSSDEKPNTPLRVWTVGYGLQCVVHMVCVCVEYR  132



>ref|XP_006279088.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
 gb|EOA11986.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
Length=319

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA +R M++REPS  VR+ AAEQ++ERQS WAYSKP+++LD++WN  FV+++ A+L 
Sbjct  28   LLRRASNRRMMLREPSVRVREVAAEQLEERQSQWAYSKPIIVLDILWNFVFVIVSLAILG  87

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S  E P++PLR+WI+GY LQC+ H   V  EY+
Sbjct  88   FSSGEDPDVPLRVWIIGYNLQCLFHVGCVIAEYR  121



>ref|XP_006364123.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
tuberosum]
Length=356

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 85/115 (74%), Gaps = 10/115 (9%)
 Frame = +3

Query  195  DGYAGTRPSLRRHSIRDVVWVLRRAGSR-GMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            DG+   R S  RHS+R+ +  ++RA +R  ++M EPS        EQ+D+RQS+WAYSKP
Sbjct  18   DGFFLFR-STNRHSLRETIRFMQRASNRRALMMHEPS--------EQIDDRQSNWAYSKP  68

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            VV++DL+WN  +++ A  VLVLS++E PE+PLR+WI+GY+L C++H VSV LE++
Sbjct  69   VVVIDLLWNFMYIIAAIVVLVLSKNENPEMPLRVWIIGYSLLCMVHVVSVYLEFR  123



>ref|NP_001147541.1| protein binding protein [Zea mays]
 gb|ACG27868.1| protein binding protein [Zea mays]
Length=375

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  234  SIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvl  413
            S+R    +LR  G R M  REPS LVR+AAAEQ++ERQ+DWAYS+PVV LD +WNLAF+L
Sbjct  36   SLRGAARLLRCGGRRAM--REPSLLVREAAAEQLEERQADWAYSRPVVALDFLWNLAFIL  93

Query  414  iaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEY  533
            ++A VLVLS  E P +PLR WI GY  QCV+H V V++EY
Sbjct  94   VSAVVLVLSHHESPSMPLRFWIAGYTAQCVVHMVCVAIEY  133



>gb|AEW07558.1| hypothetical protein 0_5075_01, partial [Pinus lambertiana]
Length=130

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AA+Q++ERQSDWAYSKPVVILD++WNL+FV+++  +L  + DE+P  PLR+
Sbjct  48   EPSMLVRENAAQQLEERQSDWAYSKPVVILDILWNLSFVVVSVVILSSTLDERPTTPLRI  107

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WI GYALQC+LH + V+ EY
Sbjct  108  WIAGYALQCILHMIYVAYEY  127



>ref|XP_006279087.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
 gb|EOA11985.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
Length=362

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA +R M++REPS  VR+ AAEQ++ERQS WAYSKP+++LD++WN  FV+++ A+L 
Sbjct  28   LLRRASNRRMMLREPSVRVREVAAEQLEERQSQWAYSKPIIVLDILWNFVFVIVSLAILG  87

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S  E P++PLR+WI+GY LQC+ H   V  EY+
Sbjct  88   FSSGEDPDVPLRVWIIGYNLQCLFHVGCVIAEYR  121



>gb|AFW59158.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=291

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WNLAF+ +AA VLVLSRDE   +PL
Sbjct  56   MREPSVLVREAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPL  115

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            R W+ GYALQCV+H + V++EY+
Sbjct  116  RTWVAGYALQCVVHMICVAIEYR  138



>ref|XP_006402511.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
 gb|ESQ43964.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
Length=374

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA +R M++REPS  VR+ AAEQ++ERQS+WAYSKP++ LD++WN  FV+++  +L 
Sbjct  42   LLRRASNRRMMLREPSVRVREVAAEQLEERQSEWAYSKPIIALDILWNFVFVIVSIGILG  101

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
             S +E P++PLRLW++GY  QC+ H   V  EY+
Sbjct  102  FSSEENPDVPLRLWVIGYNFQCLFHVGCVIAEYK  135



>ref|XP_007209235.1| hypothetical protein PRUPE_ppa007012mg [Prunus persica]
 gb|EMJ10434.1| hypothetical protein PRUPE_ppa007012mg [Prunus persica]
Length=386

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +3

Query  168  SPLMTPAAA---DGYAGTRPSLRRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMD  338
            +PL++ +     +  +G    +R  S+RD    LR+A SR  +MREPS LVR+ AAEQ++
Sbjct  15   TPLLSNSGGSSDESNSGRHRIVRPQSLRDAARFLRQASSR-RLMREPSMLVRETAAEQLE  73

Query  339  ERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQ  497
            ERQSDWAYSKPVV+LD++WN AFV++AA VLVLSR E P +PLRLWI+GYALQ
Sbjct  74   ERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRYELPNMPLRLWIMGYALQ  126



>ref|XP_004956144.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Setaria italica]
Length=353

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            R   +R     +RR GSR + MREPS  VR+ AAE ++ERQ+DWAYSKPVV+LD++WNLA
Sbjct  36   RLTGLRGAARFIRRTGSRRL-MREPSVAVRETAAEHLEERQTDWAYSKPVVVLDVLWNLA  94

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV +AAAVL  S  EQP +PLR+W+ GY LQC+LH + V++EY+
Sbjct  95   FVAVAAAVLAASLGEQPAVPLRVWLAGYVLQCLLHVLCVTVEYR  138



>ref|XP_010934468.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=383

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+AAAEQ++ERQ DWAYS+PVV LD++WNLAFV  AA VLVLSR E+P +PLRL
Sbjct  59   EPSMLVREAAAEQLEERQRDWAYSRPVVFLDILWNLAFVAAAAGVLVLSRQERPSMPLRL  118

Query  474  WIVGYALQCVLHAVSVSLEYQ  536
            WI GYALQCVLH V V +EY+
Sbjct  119  WIGGYALQCVLHVVCVCIEYR  139



>ref|XP_010934467.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=384

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+AAAEQ++ERQ DWAYS+PVV LD++WNLAFV  AA VLVLSR E+P +PLRL
Sbjct  59   EPSMLVREAAAEQLEERQRDWAYSRPVVFLDILWNLAFVAAAAGVLVLSRQERPSMPLRL  118

Query  474  WIVGYALQCVLHAVSVSLEYQ  536
            WI GYALQCVLH V V +EY+
Sbjct  119  WIGGYALQCVLHVVCVCIEYR  139



>gb|AEW07559.1| hypothetical protein 0_5075_01, partial [Pinus radiata]
Length=130

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AA+Q++ERQSDWAYSKPV+ILD++WNL+FV+++  +L  + DE+P  PLR+
Sbjct  48   EPSMLVRENAAQQLEERQSDWAYSKPVIILDILWNLSFVVVSVVILSSTLDERPTTPLRI  107

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WIVGYALQC+LH   V+ EY
Sbjct  108  WIVGYALQCILHMSYVAYEY  127



>ref|XP_004956145.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Setaria italica]
Length=352

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  225  RRHSIRDVVWVLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNla  404
            R   +R     +RR GSR + MREPS  VR+ AAE ++ERQ+DWAYSKPVV+LD++WNLA
Sbjct  36   RLTGLRGAARFIRRTGSRRL-MREPSVAVRETAAEHLEERQTDWAYSKPVVVLDVLWNLA  94

Query  405  fvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            FV +AAAVL  S  EQP +PLR+W+ GY LQC+LH + V++EY+
Sbjct  95   FVAVAAAVLAASLGEQPAVPLRVWLAGYVLQCLLHVLCVTVEYR  138



>gb|AFG60447.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60448.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60449.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60450.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60451.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60452.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60453.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60454.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60455.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60456.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60457.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60458.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60459.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60460.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60461.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60462.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60463.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
 gb|AFG60464.1| hypothetical protein 0_5075_01, partial [Pinus taeda]
Length=130

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AA+Q++ERQSDWAYSKPV+ILD++WNL+FV+++  +L  + DE+P  PLR+
Sbjct  48   EPSMLVRENAAQQLEERQSDWAYSKPVIILDILWNLSFVVVSVVILSSTLDERPTTPLRI  107

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WIVGYALQC+LH   V+ EY
Sbjct  108  WIVGYALQCILHMSYVAYEY  127



>ref|XP_004976528.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Setaria 
italica]
Length=379

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WNLAF+ +AA VLVLSRDE   +PL
Sbjct  56   MREPSVLVREAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPL  115

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            R W+ GYALQCV+H V V++EY+
Sbjct  116  RTWVAGYALQCVVHMVCVAIEYR  138



>ref|NP_001150553.1| LOC100284185 [Zea mays]
 gb|ACG39542.1| protein binding protein [Zea mays]
Length=375

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WNLAF+ +AA VLVLSRDE   +PL
Sbjct  56   MREPSVLVREAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPL  115

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            R W+ GYALQCV+H + V++EY+
Sbjct  116  RTWVAGYALQCVVHMICVAIEYR  138



>ref|XP_008662009.1| PREDICTED: LOC100284185 isoform X1 [Zea mays]
 gb|ACL52451.1| unknown [Zea mays]
 gb|AFW59157.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=382

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WNLAF+ +AA VLVLSRDE   +PL
Sbjct  56   MREPSVLVREAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPL  115

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            R W+ GYALQCV+H + V++EY+
Sbjct  116  RTWVAGYALQCVVHMICVAIEYR  138



>ref|XP_002969635.1| hypothetical protein SELMODRAFT_66385, partial [Selaginella moellendorffii]
 gb|EFJ29723.1| hypothetical protein SELMODRAFT_66385, partial [Selaginella moellendorffii]
Length=321

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MRE S LVR+ A EQ+DERQSDWAYS+PVV+LDL+WNLAFV +A  VLV+S+ EQP  PL
Sbjct  1    MRESSILVRETAVEQLDERQSDWAYSRPVVVLDLIWNLAFVTVALVVLVISQSEQPCTPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEY  533
            R+W++GYALQCVLH   V  EY
Sbjct  61   RIWVLGYALQCVLHMSCVVSEY  82



>ref|XP_002970900.1| hypothetical protein SELMODRAFT_66382, partial [Selaginella moellendorffii]
 gb|EFJ28226.1| hypothetical protein SELMODRAFT_66382, partial [Selaginella moellendorffii]
Length=321

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MRE S LVR+ A EQ+DERQSDWAYS+PVV+LDL+WNLAFV +A  VLV+S+ EQP  PL
Sbjct  1    MRESSILVRETAVEQLDERQSDWAYSRPVVVLDLIWNLAFVTVALVVLVISQSEQPCTPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEY  533
            R+W++GYALQCVLH   V  EY
Sbjct  61   RIWVLGYALQCVLHMSCVVSEY  82



>ref|XP_010053324.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW77595.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=406

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  294  EPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPLRL  473
            EPS LVR+ AAEQ++ERQSDWAYSKPVV+LD++WN AFV +A  VL++SR E P +PLR+
Sbjct  81   EPSMLVRETAAEQLEERQSDWAYSKPVVVLDVLWNFAFVAVAVGVLIVSRGENPTMPLRV  140

Query  474  WIVGYALQCVLHAVSVSLEY  533
            WIVGY LQCVLH   V  EY
Sbjct  141  WIVGYGLQCVLHVACVVDEY  160



>ref|XP_004252582.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=354

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 83/115 (72%), Gaps = 10/115 (9%)
 Frame = +3

Query  195  DGYAGTRPSLRRHSIRDVVWVLRRAGSR-GMVMREPSALVRQAAAEQMDERQSDWAYSKP  371
            DG +  R S  R+S+R+ +  ++RA +R  ++M EPS        EQ+D+RQS+WAYSKP
Sbjct  17   DGLSLFR-STNRYSVRETIRFMQRASNRRALMMHEPS--------EQIDDRQSNWAYSKP  67

Query  372  VVILDLVWNlafvliaaavlvlSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            VVI+DL+WN  +++ A  VLVLSR+E+ E+PLR+WI+GY   C++H VSV LE+Q
Sbjct  68   VVIIDLLWNFMYIIAAVVVLVLSRNEKLEMPLRVWIIGYCFLCMIHVVSVYLEFQ  122



>ref|XP_010053666.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW78019.1| hypothetical protein EUGRSUZ_D02250 [Eucalyptus grandis]
Length=401

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  VLRRAGSRGMVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlv  434
            +LRRA  R M++REPS  VR+ AAEQ++ RQSDWAYS P+V LD++WNLAFV +A  V+ 
Sbjct  56   LLRRASGRRMMLREPSMQVRENAAEQLETRQSDWAYSTPIVALDILWNLAFVGVALGVVA  115

Query  435  lSRDEQPELPLRLWIVGYALQCVLHAVSVSLEYQ  536
            LS +E+PE+PLRLWIV YALQC+ H   V  E++
Sbjct  116  LSPNERPEVPLRLWIVVYALQCLFHVACVVAEFK  149



>gb|KDP28678.1| hypothetical protein JCGZ_14449 [Jatropha curcas]
Length=329

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  282  MVMREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPEL  461
            M++REPS  VR+ AAEQ++ERQ+DW+YSKP+++LD++WN AFV IA  V+VLS  E+ E+
Sbjct  1    MMLREPSVRVRENAAEQLEERQTDWSYSKPIIVLDVLWNFAFVGIAVVVMVLSVKEETEV  60

Query  462  PLRLWIVGYALQCVLHAVSVSLEYQ  536
            PLRLWI+GYALQCV H   V  EY+
Sbjct  61   PLRLWIIGYALQCVFHIACVIFEYR  85



>emb|CAE02249.2| OSJNBb0032E06.5 [Oryza sativa Japonica Group]
 emb|CAH67032.1| OSIGBa0139P06.5 [Oryza sativa Indica Group]
Length=324

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  MREPSALVRQAAAEQMDERQSDWAYSKPVVILDLVWNlafvliaaavlvlSRDEQPELPL  467
            MREPS LVR+AAAE ++ERQ+DWAYS+PVV LDL+WNLAF+ +AA VLVLSR E   +PL
Sbjct  1    MREPSVLVREAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRGEDSPMPL  60

Query  468  RLWIVGYALQCVLHAVSVSLEYQ  536
            R W+ GYALQCV+H V V++EY+
Sbjct  61   RTWVAGYALQCVVHMVCVAIEYR  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000